SMED30035591
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30035591 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Alignments
SMED30035591 aligns in the following genomic locations:
Homology
BLAST of SMED30035591 vs. Planmine SMEST
Match: SMESG000063572.1 (SMESG000063572.1) HSP 1 Score: 115.931 bits (289), Expect = 1.446e-41 Identity = 53/65 (81.54%), Postives = 56/65 (86.15%), Query Frame = 3 Query: 1992 EKFSMQCQVAPGLKQVQYSWYHDNQLMENNQQTITFDSFTRSKFGEYKCKFVGLNQINQKVEFNG 2186 EKFSM+CQVAP LKQVQYSWYHDNQL+ENN QTITFDSFTRSK G YKCK VGL+Q NQKVE Sbjct: 313 EKFSMRCQVAPELKQVQYSWYHDNQLLENNHQTITFDSFTRSKLGVYKCKIVGLDQRNQKVELEA 377 HSP 2 Score: 70.4774 bits (171), Expect = 1.446e-41 Identity = 36/47 (76.60%), Postives = 40/47 (85.11%), Query Frame = 2 Query: 2180 QRLSYFVPIIVKLIEGAGSHVAVIMSQKKELLHEISVDSEYFGSDVR 2320 QRLS+FVPI V+LIEGAGS VAVIMS+KKEL EIS DSE GSDV+ Sbjct: 381 QRLSFFVPIKVELIEGAGSQVAVIMSRKKELHCEISADSENSGSDVQ 427 HSP 3 Score: 24.6386 bits (52), Expect = 1.446e-41 Identity = 11/14 (78.57%), Postives = 12/14 (85.71%), Query Frame = 1 Query: 2323 KFQNQELSIQDLLS 2364 KFQNQELS QD L+ Sbjct: 429 KFQNQELSTQDSLN 442
BLAST of SMED30035591 vs. Planmine SMEST
Match: SMESG000026481.1 (SMESG000026481.1) HSP 1 Score: 111.694 bits (278), Expect = 2.802e-40 Identity = 51/65 (78.46%), Postives = 55/65 (84.62%), Query Frame = 3 Query: 1992 EKFSMQCQVAPGLKQVQYSWYHDNQLMENNQQTITFDSFTRSKFGEYKCKFVGLNQINQKVEFNG 2186 EKFSM+CQV P LKQVQYSWYHDNQL+EN QQTITF+SFTRSK G YKCK VGL+Q NQKVE Sbjct: 1038 EKFSMRCQVGPELKQVQYSWYHDNQLLENQQQTITFNSFTRSKLGVYKCKIVGLDQNNQKVELEA 1102 HSP 2 Score: 72.0182 bits (175), Expect = 2.802e-40 Identity = 36/47 (76.60%), Postives = 41/47 (87.23%), Query Frame = 2 Query: 2180 QRLSYFVPIIVKLIEGAGSHVAVIMSQKKELLHEISVDSEYFGSDVR 2320 QRLS+FVPI V+LIEGAGS VAVI+S+KKEL EIS DSEY GSDV+ Sbjct: 1106 QRLSFFVPIKVELIEGAGSQVAVIVSRKKELHCEISADSEYSGSDVQ 1152 HSP 3 Score: 23.0978 bits (48), Expect = 2.802e-40 Identity = 10/14 (71.43%), Postives = 12/14 (85.71%), Query Frame = 1 Query: 2323 KFQNQELSIQDLLS 2364 KF+NQELS QD L+ Sbjct: 1154 KFENQELSTQDSLN 1167
BLAST of SMED30035591 vs. Planmine SMEST
Match: SMESG000026481.1 (SMESG000026481.1) HSP 1 Score: 110.923 bits (276), Expect = 3.792e-40 Identity = 51/65 (78.46%), Postives = 55/65 (84.62%), Query Frame = 3 Query: 1992 EKFSMQCQVAPGLKQVQYSWYHDNQLMENNQQTITFDSFTRSKFGEYKCKFVGLNQINQKVEFNG 2186 EKFSM+CQV P LKQVQYSWYHDNQL+EN QQTITF+SFTRSK G YKCK VGL+Q NQKVE Sbjct: 520 EKFSMRCQVGPELKQVQYSWYHDNQLLENQQQTITFNSFTRSKLGVYKCKIVGLDQNNQKVELEA 584 HSP 2 Score: 72.0182 bits (175), Expect = 3.792e-40 Identity = 36/47 (76.60%), Postives = 41/47 (87.23%), Query Frame = 2 Query: 2180 QRLSYFVPIIVKLIEGAGSHVAVIMSQKKELLHEISVDSEYFGSDVR 2320 QRLS+FVPI V+LIEGAGS VAVI+S+KKEL EIS DSEY GSDV+ Sbjct: 588 QRLSFFVPIKVELIEGAGSQVAVIVSRKKELHCEISADSEYSGSDVQ 634 HSP 3 Score: 23.0978 bits (48), Expect = 3.792e-40 Identity = 10/14 (71.43%), Postives = 12/14 (85.71%), Query Frame = 1 Query: 2323 KFQNQELSIQDLLS 2364 KF+NQELS QD L+ Sbjct: 636 KFENQELSTQDSLN 649
BLAST of SMED30035591 vs. Planmine SMEST
Match: SMESG000079666.1 (SMESG000079666.1) HSP 1 Score: 80.4925 bits (197), Expect = 1.771e-18 Identity = 44/61 (72.13%), Postives = 47/61 (77.05%), Query Frame = 3 Query: 3 MSNILSIDPKFKRNRIIDKHRLSIIAPDNLLQIWTLVRRFSNLRGNQSYQMSSLTRKCCAS 185 MSNILSIDPKF+RNRIIDKHRLSIIAPDNLLQIWT VRR L G S + + R C AS Sbjct: 1 MSNILSIDPKFERNRIIDKHRLSIIAPDNLLQIWTFVRR--KLIGADSSEETKAIR-CQAS 58
BLAST of SMED30035591 vs. Planmine SMEST
Match: SMESG000079666.1 (SMESG000079666.1) HSP 1 Score: 80.4925 bits (197), Expect = 2.465e-18 Identity = 44/61 (72.13%), Postives = 47/61 (77.05%), Query Frame = 3 Query: 3 MSNILSIDPKFKRNRIIDKHRLSIIAPDNLLQIWTLVRRFSNLRGNQSYQMSSLTRKCCAS 185 MSNILSIDPKF+RNRIIDKHRLSIIAPDNLLQIWT VRR L G S + + R C AS Sbjct: 1 MSNILSIDPKFERNRIIDKHRLSIIAPDNLLQIWTFVRR--KLIGADSSEETKAIR-CQAS 58 HSP 2 Score: 45.0542 bits (105), Expect = 6.190e-6 Identity = 26/46 (56.52%), Postives = 26/46 (56.52%), Query Frame = 1 Query: 118 GFPICEETKAIRCQASQENVARLI*LVGILLNCP*ELYLNLDPRVQ 255 G EETKAIRCQASQEN ELYLNLDPRVQ Sbjct: 43 GADSSEETKAIRCQASQEN----------------ELYLNLDPRVQ 72 The following BLAST results are available for this feature:
BLAST of SMED30035591 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30035591 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30035591 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30035591 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30035591 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30035591 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30035591 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30035591 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30035591 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30035591 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30035591 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30035591 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30035591 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30035591 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30035591 ID=SMED30035591|Name=SMED30035591|organism=Schmidtea mediterranea sexual|type=transcript|length=2563bpback to top protein sequence of SMED30035591-orf-1 >SMED30035591-orf-1 ID=SMED30035591-orf-1|Name=SMED30035591-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp MSNILSIDPKFKRNRIIDKHRLSIIAPDNLLQIWTLVRRFSNLRGNQSYQback to top Annotated Terms
The following terms have been associated with this transcript:
|