E3 ubiquitin-protein ligase ZSWIM2

Overview
NameE3 ubiquitin-protein ligase ZSWIM2
Smed IDSMED30035586
Length (bp)1668
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase ZSWIM2 (SMED30035586) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase ZSWIM2 (SMED30035586) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase ZSWIM2 (SMED30035586) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase ZSWIM2 (SMED30035586) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035586

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035586SMESG000064366.1 SmedASXL_013184SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30035586SMESG000064366.1 dd_Smed_v4_14099_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035586SMESG000064366.1 dd_Smed_v6_14099_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30035586SMESG000064366.1 Contig38375newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035586SMESG000064366.1 Contig38375uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30035586SMESG000064366.1 dd_Smed_v4_14099_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Human
Match: ZSWIM2 (zinc finger SWIM-type containing 2 [Source:HGNC Symbol;Acc:HGNC:30990])

HSP 1 Score: 266.544 bits (680), Expect = 1.254e-80
Identity = 147/387 (37.98%), Postives = 220/387 (56.85%), Query Frame = 2
Query:   74 RRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHE-KKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFREHSNGRWLSAPNSRGLPLSLVNGLQNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPID 1231
            RR ++E ++W+Q +A + + ++LRE+GP GF+++EE  E   ++V LG+PH C+C  F K  +LCKHICW+LLK+F++ ++   + Q  L EREI+DL+     +  T        N   + +  + Q++I+++DIC ICQ+ LL ++ PVTFCR GCGN+IHI+CM +   ++    N  M   + CP+CR EF  L L++ E  NS  +     K  L  K +G+ C+NC   PI GK YKC  C +++LC  CF++C H  H F+FRE  N +W S        +  ++  +N   E + +   +Q         +R   L       IT  SKL  PG+QC +C  ++  G   R LP C H FH  CID WL H+  SCPID
Sbjct:   12 RRHLSERLSWHQDQALSSSIYLLREMGPTGFLLREEEPEYMDFRVFLGNPHVCNCSTFPKGGELCKHICWVLLKKFKLPRNHESALQLGLGEREISDLL-RGIHRVQTPQPGTNDENEHVEEDGYIKQKEIDSEDICSICQELLLEKKLPVTFCRFGCGNSIHIKCMKILANYQSTS-NTSM---LKCPLCRKEFAPLKLILEEFKNSSKLVAAAEKERLD-KHLGIPCNNCKQFPIEGKCYKCTECIEYHLCQECFDSCCHLSHTFTFREKRNQKWRSLEKRADEVVKYIDT-KNEIEEKMSHFQEKQGQVYTPKHIVRSLPLQL-----ITKNSKLLAPGYQCLLCLKAFHLGQHTRLLP-CTHKFHRKCIDNWLFHKCNSCPID 385          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Human
Match: MAP3K1 (mitogen-activated protein kinase kinase kinase 1 [Source:HGNC Symbol;Acc:HGNC:6848])

HSP 1 Score: 82.8037 bits (203), Expect = 7.606e-16
Identity = 54/217 (24.88%), Postives = 102/217 (47.00%), Query Frame = 2
Query:   68 PYR-RQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQR--------------------KIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEF 655
            PY   + N  VN    K      ++L++IGP  F++  +  + KY+V +G P +CSC         C H+ +++L+ F+++  DP+ W+ +L   E+  L      K  +   +     + N  +  VS+                     K E + +CPIC   +L+ ++ +T C +GC N +H  CM++W E  ++      ++ + CP+CR ++
Sbjct:  298 PYSPEETNRRVN----KVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIG-PQNCSCA----RGTFCIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLF----QKYHSRRSSRIKAPSRNTIQKFVSRMSNSHTLSSSSTSTSSSENSIKDEEEQMCPICLLGMLD-EESLTVCEDGCRNKLHHHCMSIWAEECRRN-----REPLICPLCRSKW 495          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Human
Match: RNF150 (ring finger protein 150 [Source:HGNC Symbol;Acc:HGNC:23138])

HSP 1 Score: 51.6026 bits (122), Expect = 1.648e-6
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 2
Query: 1103 CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLL-HRTASCPIDEIEVCK 1249
            C +C   YK  D VR LP C+H+FH  C+DPWLL HRT  CP+ ++ + K
Sbjct:  109 CAVCIEGYKPNDVVRILP-CRHLFHKSCVDPWLLDHRT--CPMCKMNILK 155          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Human
Match: RNF150 (ring finger protein 150 [Source:HGNC Symbol;Acc:HGNC:23138])

HSP 1 Score: 51.6026 bits (122), Expect = 1.934e-6
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 2
Query: 1103 CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLL-HRTASCPIDEIEVCK 1249
            C +C   YK  D VR LP C+H+FH  C+DPWLL HRT  CP+ ++ + K
Sbjct:  137 CAVCIEGYKPNDVVRILP-CRHLFHKSCVDPWLLDHRT--CPMCKMNILK 183          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Human
Match: RNF149 (ring finger protein 149 [Source:HGNC Symbol;Acc:HGNC:23137])

HSP 1 Score: 51.6026 bits (122), Expect = 2.419e-6
Identity = 26/50 (52.00%), Postives = 35/50 (70.00%), Query Frame = 2
Query: 1103 CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLL-HRTASCPIDEIEVCK 1249
            C +C  ++K  D +R LP C+HIFH  CIDPWLL HRT  CP+ +++V K
Sbjct:  269 CAVCIENFKVKDIIRILP-CKHIFHRICIDPWLLDHRT--CPMCKLDVIK 315          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Celegans
Match: C18B12.4 (pep chromosome:WBcel235:X:15036662:15040602:-1 gene:WBGene00007666.1 transcript:C18B12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C18B12.4)

HSP 1 Score: 48.9062 bits (115), Expect = 8.227e-6
Identity = 21/54 (38.89%), Postives = 30/54 (55.56%), Query Frame = 2
Query: 1067 TNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPI 1228
              K +L      C IC  S+ +G+ +R LP C+H+FH +CID WL      CP+
Sbjct:  235 VKKYRLGDDPDTCAICLESFASGEKLRHLP-CRHVFHCNCIDVWLTQTRKICPL 287          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Fly
Match: gol (gene:FBgn0004919 transcript:FBtr0300178)

HSP 1 Score: 53.9138 bits (128), Expect = 2.571e-7
Identity = 32/75 (42.67%), Postives = 42/75 (56.00%), Query Frame = 2
Query: 1103 CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLL-HRTASCPIDEIEVCKLSLNSSGH--------HHKPPHASI 1300
            C IC  +YK  D++R LP C+H FH +CIDPWL+ HRT  CP+ +++V K      G          H  P ASI
Sbjct:  303 CAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHRT--CPMCKLDVLKFYGYVVGDQIYQTPSPQHTAPIASI 374          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Fly
Match: gol (gene:FBgn0004919 transcript:FBtr0306330)

HSP 1 Score: 53.9138 bits (128), Expect = 2.571e-7
Identity = 32/75 (42.67%), Postives = 42/75 (56.00%), Query Frame = 2
Query: 1103 CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLL-HRTASCPIDEIEVCKLSLNSSGH--------HHKPPHASI 1300
            C IC  +YK  D++R LP C+H FH +CIDPWL+ HRT  CP+ +++V K      G          H  P ASI
Sbjct:  303 CAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHRT--CPMCKLDVLKFYGYVVGDQIYQTPSPQHTAPIASI 374          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Fly
Match: gol (gene:FBgn0004919 transcript:FBtr0072459)

HSP 1 Score: 53.1434 bits (126), Expect = 4.227e-7
Identity = 26/51 (50.98%), Postives = 36/51 (70.59%), Query Frame = 2
Query: 1103 CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLL-HRTASCPIDEIEVCKL 1252
            C IC  +YK  D++R LP C+H FH +CIDPWL+ HRT  CP+ +++V K 
Sbjct:  303 CAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHRT--CPMCKLDVLKF 350          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Fly
Match: gol (gene:FBgn0004919 transcript:FBtr0300179)

HSP 1 Score: 53.5286 bits (127), Expect = 4.336e-7
Identity = 26/51 (50.98%), Postives = 36/51 (70.59%), Query Frame = 2
Query: 1103 CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLL-HRTASCPIDEIEVCKL 1252
            C IC  +YK  D++R LP C+H FH +CIDPWL+ HRT  CP+ +++V K 
Sbjct:  303 CAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHRT--CPMCKLDVLKF 350          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Fly
Match: Iru (gene:FBgn0037653 transcript:FBtr0081965)

HSP 1 Score: 51.2174 bits (121), Expect = 1.473e-6
Identity = 37/104 (35.58%), Postives = 57/104 (54.81%), Query Frame = 2
Query:  965 LESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWL-LHRTASCPIDEIEVCKLSLNSSGH 1273
            L+++   +L Q++  G    L  Q +N+     I N  ++++   QC IC   +K  ++VRKLP C H++H +CI PWL LH T  CPI     C+ SL   G+
Sbjct:  210 LDTIVTQMLNQMETSGPPP-LSAQRINEIPNVQI-NAEEVNR-KIQCSICWDDFKIDETVRKLP-CSHLYHENCIVPWLNLHST--CPI-----CRKSLADDGN 302          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Zebrafish
Match: zswim2 (zinc finger, SWIM-type containing 2 [Source:ZFIN;Acc:ZDB-GENE-070719-8])

HSP 1 Score: 267.314 bits (682), Expect = 1.179e-81
Identity = 140/391 (35.81%), Postives = 223/391 (57.03%), Query Frame = 2
Query:   71 YRRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAE----NQAENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFREHSNGRWLSAPNSRGLPLSLVNGLQNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPID 1231
            +R+ +++ V+ +Q +A N T FIL+E GP+GF++QE+G  K YKVCLGDPH+C+C  ++KEKDLC HICWIL+++FR+ +D    +Q  L ER+I +L+   ++ K TT   +    A      + +  + Q+ +E DDICPICQ++LL ++ PVT+C+  CGNNIHI CM VW +H+ K+    +   + CP+CR +FGT   L+ ++ N+  +     +  L  K +G+ C+ C   PI+G+ +KC  CS F+LC  CF   +H +H F  R     +W +           V    + + + ++  L            +    +      ++  +S+L  PG QCR+C   ++ G  +R LP C+H FH  CIDP LL  +  CP++
Sbjct:    7 WRKTVSDAVSSHQHRALNTTIFILKEYGPIGFLLQEDGESKHYKVCLGDPHTCTCPTYQKEKDLCTHICWILMRKFRLPRDHEYCFQYGLVERQILELLQGLHVTKTTTNNDHGSSGATCPEPAEEDGGIKQKVVEKDDICPICQEELLLKKLPVTYCKFSCGNNIHISCMKVWADHQTKKDPRAL---LKCPLCREDFGTFKELIEQVKNASELVTCYERDCLD-KHLGVLCNICRVCPIVGECFKCTECSFFHLCEDCFKKTLHPKHCFMVRMKRGQQWQT-----------VGAHASQETQKIENHLTGSSSVSMSCDIVPNHVIKSLPVITVRKESRLLHPGVQCRLCLSRFQLGQCIRTLP-CKHKFHTGCIDP-LLRVSNCCPLE 380          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Zebrafish
Match: map3k1 (mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-090313-412])

HSP 1 Score: 89.3521 bits (220), Expect = 5.177e-18
Identity = 49/181 (27.07%), Postives = 90/181 (49.72%), Query Frame = 2
Query:  113 KAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEF 655
            K      ++L++IGP  F++  +  + K++V +G P +CSC         C H+ +++L+ F+++  DP+ W+ +L   E+  L            K       EN     +   K E + +CPIC  D+L+ ++ +T C  GC N +H  CM++W E  ++       D + CP+CR ++
Sbjct:  149 KVMRARLYLLQQIGPNSFLIGGDSPDNKFRVFIG-PQTCSCG----RGTFCIHVLFVMLRVFQLEPSDPLLWRKTLKNFEVRRLY--------NPNKAPQNIKWENSGRGFM---KDEEEQMCPICLLDMLD-EESLTVCEEGCRNKLHHHCMSIWAEECRRN-----HDPLICPLCRAKW 307          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Zebrafish
Match: map3k1 (mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-090313-412])

HSP 1 Score: 84.7297 bits (208), Expect = 1.325e-16
Identity = 48/197 (24.37%), Postives = 99/197 (50.25%), Query Frame = 2
Query:  113 KAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAE---NQAENTVSQR-------------KIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEF 655
            K      ++L++IGP  F++  +  + K++V +G P +CSC         C H+ +++L+ F+++  DP+ W+ +L   E+  L    + ++ + +K  +    +   ++  N+ +               K E + +CPIC  D+L+ ++ +T C  GC N +H  CM++W E  ++       D + CP+CR ++
Sbjct:  137 KVMRARLYLLQQIGPNSFLIGGDSPDNKFRVFIG-PQTCSCG----RGTFCIHVLFVMLRVFQLEPSDPLLWRKTLKNFEVESLFQKYHNRRSSRIKAPSRSTIQKFVSRMSNSHTSCTSSASPSSNESSMKDEEEQMCPICLLDMLD-EESLTVCEEGCRNKLHHHCMSIWAEECRRN-----HDPLICPLCRAKW 322          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Zebrafish
Match: map3k1 (mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-090313-412])

HSP 1 Score: 84.7297 bits (208), Expect = 1.335e-16
Identity = 48/197 (24.37%), Postives = 99/197 (50.25%), Query Frame = 2
Query:  113 KAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAE---NQAENTVSQR-------------KIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEF 655
            K      ++L++IGP  F++  +  + K++V +G P +CSC         C H+ +++L+ F+++  DP+ W+ +L   E+  L    + ++ + +K  +    +   ++  N+ +               K E + +CPIC  D+L+ ++ +T C  GC N +H  CM++W E  ++       D + CP+CR ++
Sbjct:  149 KVMRARLYLLQQIGPNSFLIGGDSPDNKFRVFIG-PQTCSCG----RGTFCIHVLFVMLRVFQLEPSDPLLWRKTLKNFEVESLFQKYHNRRSSRIKAPSRSTIQKFVSRMSNSHTSCTSSASPSSNESSMKDEEEQMCPICLLDMLD-EESLTVCEEGCRNKLHHHCMSIWAEECRRN-----HDPLICPLCRAKW 334          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Zebrafish
Match: rnf11a (ring finger protein 11a [Source:ZFIN;Acc:ZDB-GENE-040426-1277])

HSP 1 Score: 50.8322 bits (120), Expect = 3.684e-7
Identity = 21/42 (50.00%), Postives = 29/42 (69.05%), Query Frame = 2
Query: 1100 QCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCP 1225
            +C IC M ++ GD +R LP C HI+H  CID WL+ R+ +CP
Sbjct:   90 ECVICMMDFEYGDPIRFLP-CMHIYHVDCIDAWLM-RSFTCP 129          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Xenopus
Match: slc2a1 (solute carrier family 2 (facilitated glucose transporter), member 1 [Source:Xenbase;Acc:XB-GENE-5755357])

HSP 1 Score: 79.7221 bits (195), Expect = 6.376e-15
Identity = 50/211 (23.70%), Postives = 98/211 (46.45%), Query Frame = 2
Query:  113 KAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQR--------------------KIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEM 685
            K      ++L++IGP  F++  +  + KY+V +G P +CSC         C H+ +++L+ F+++  D + W+ +L   E+  L      K  +   +     + N  +  VS+                     K E + +CPIC   +L+ ++ +T C  GC N +H  CM++W E  ++      ++ + CP+CR ++ +     VE+
Sbjct:  247 KVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIG-PQACSCG----RGTFCIHLLFVMLRVFQLEPSDTMLWRKALKNFEVESLF----QKYHSRRSSRIKAPSRNTIQKFVSRMSSSHTLSSSTTSTSSSDTSMKDEEEQMCPICLLGMLD-EESLTVCEEGCRNKLHHHCMSIWAEECRRN-----REPLICPLCRAKWRSQDFNSVEL 442          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Xenopus
Match: slc2a1 (solute carrier family 2 (facilitated glucose transporter), member 1 [Source:Xenbase;Acc:XB-GENE-5755357])

HSP 1 Score: 58.9214 bits (141), Expect = 2.283e-8
Identity = 39/174 (22.41%), Postives = 77/174 (44.25%), Query Frame = 2
Query:  224 SCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQR--------------------KIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEM 685
            +CSC         C H+ +++L+ F+++  D + W+ +L   E+  L      K  +   +     + N  +  VS+                     K E + +CPIC   +L+ ++ +T C  GC N +H  CM++W E  ++      ++ + CP+CR ++ +     VE+
Sbjct:  218 ACSCG----RGTFCIHLLFVMLRVFQLEPSDTMLWRKALKNFEVESLF----QKYHSRRSSRIKAPSRNTIQKFVSRMSSSHTLSSSTTSTSSSDTSMKDEEEQMCPICLLGMLD-EESLTVCEEGCRNKLHHHCMSIWAEECRRN-----REPLICPLCRAKWRSQDFNSVEL 377          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Xenopus
Match: rnf181 (ring finger protein 181 [Source:NCBI gene;Acc:496625])

HSP 1 Score: 55.0694 bits (131), Expect = 2.808e-8
Identity = 40/132 (30.30%), Postives = 68/132 (51.52%), Query Frame = 2
Query:  860 QHEFS----FREHSNGRWLSAPNSR-----GLPLSLVNGLQNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPI 1228
            QH+FS    F EH+    +     R      L  SL++G+ + DL ++D+T   Q   P     + +      S   +T   + +    +C +C + ++ G++VR+LP C+H+FH+ CI PW L +T SCP+
Sbjct:    9 QHQFSMASYFDEHNCEPTVPEEQYRQNALLELARSLLSGM-DIDLGALDFTEWDQRLPPPAAKKVVE------SLPKVTVTPEQADAALKCPVCLLEFEEGETVRQLP-CEHLFHSSCILPW-LGKTNSCPL 131          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Xenopus
Match: rnf149 (ring finger protein 149 [Source:NCBI gene;Acc:780151])

HSP 1 Score: 53.5286 bits (127), Expect = 5.843e-7
Identity = 27/50 (54.00%), Postives = 35/50 (70.00%), Query Frame = 2
Query: 1103 CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLL-HRTASCPIDEIEVCK 1249
            C +C  +YK  D VR LP C+HIFH  CIDPWL+ HRT  CP+ +++V K
Sbjct:  258 CAVCIENYKTKDLVRILP-CKHIFHRLCIDPWLIEHRT--CPMCKLDVIK 304          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Xenopus
Match: rnf149 (ring finger protein 149 [Source:NCBI gene;Acc:780151])

HSP 1 Score: 53.5286 bits (127), Expect = 6.218e-7
Identity = 27/50 (54.00%), Postives = 35/50 (70.00%), Query Frame = 2
Query: 1103 CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLL-HRTASCPIDEIEVCK 1249
            C +C  +YK  D VR LP C+HIFH  CIDPWL+ HRT  CP+ +++V K
Sbjct:  265 CAVCIENYKTKDLVRILP-CKHIFHRLCIDPWLIEHRT--CPMCKLDVIK 311          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Mouse
Match: Zswim2 (zinc finger SWIM-type containing 2 [Source:MGI Symbol;Acc:MGI:1919111])

HSP 1 Score: 283.108 bits (723), Expect = 4.223e-87
Identity = 157/397 (39.55%), Postives = 223/397 (56.17%), Query Frame = 2
Query:   74 RRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEK-KYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFREHSNGRWLSAPNSRGLPLSLVNGLQNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFST----------WSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPID 1231
            RR ++E ++W Q +A + + ++LR+IGP GF+++EE  EK  ++V LG+PH CSC  F K  +LCKHICW+LLK+F++ ++   ++Q  L E EINDL+     +        +   A+ + +  + Q+ I   DICPICQ+ LL ++ PVTFCR GCGNN+HI+CM +   ++    +  +   + CP+CR EF  L +++ E  NS  +     K  L  K +G+ C+NCN  PI G+ YKC  C +++LC  CF++C HS H F+ RE  N RW S         S V    N++ E           KPG      Q+   QF T            IT KSKL  PG+QCR+C  S+  G   R LP C H FH  CID WLLH+  SCPID
Sbjct:   12 RRHLSESLSWQQDQALSSSIYLLRQIGPTGFLLKEEEPEKGDFRVLLGNPHECSCPTFLKRGELCKHICWVLLKKFKLPRNHESAFQLGLTEGEINDLL-RGIHQVQAPQLRASDETAQVEEDGYLKQKDINAGDICPICQEVLLEKKLPVTFCRFGCGNNVHIKCMRILANYQDTGSDSSV---LRCPLCREEFAPLKVILEEFKNSNKLITISEKERLD-KHLGIPCNNCNQLPIEGRCYKCTECVEYHLCQECFDSCCHSSHAFASREKRNQRWRSVEKR-----SEVMKYLNTENEGE--------AKPG----CFQEKQGQFYTPKHVVKSLPLLMITKKSKLLAPGYQCRLCLKSFSFGQYTRLLP-CTHKFHRKCIDNWLLHKCNSCPID 385          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Mouse
Match: Zswim2 (zinc finger SWIM-type containing 2 [Source:MGI Symbol;Acc:MGI:1919111])

HSP 1 Score: 251.906 bits (642), Expect = 5.704e-78
Identity = 144/380 (37.89%), Postives = 209/380 (55.00%), Query Frame = 2
Query:   74 RRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEK-KYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFREHSNGRWLSAPNSRGLPLSLVNGLQNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFST----------WSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHA 1180
            RR ++E ++W Q +A + + ++LR+IGP GF+++EE  EK  ++V LG+PH CSC  F K  +LCKHICW+LLK+F++ ++   ++Q  L E EINDL+     +        +   A+ + +  + Q+ I   DICPICQ+ LL ++ PVTFCR GCGNN+HI+CM +   ++    +  +   + CP+CR EF  L +++ E  NS  +     K  L  K +G+ C+NCN  PI G+ YKC  C +++LC  CF++C HS H F+ RE  N RW S         S V    N++ E           KPG      Q+   QF T            IT KSKL  PG+QCR+C  S+  G   R LP C H   A
Sbjct:   12 RRHLSESLSWQQDQALSSSIYLLRQIGPTGFLLKEEEPEKGDFRVLLGNPHECSCPTFLKRGELCKHICWVLLKKFKLPRNHESAFQLGLTEGEINDLL-RGIHQVQAPQLRASDETAQVEEDGYLKQKDINAGDICPICQEVLLEKKLPVTFCRFGCGNNVHIKCMRILANYQDTGSDSSV---LRCPLCREEFAPLKVILEEFKNSNKLITISEKERLD-KHLGIPCNNCNQLPIEGRCYKCTECVEYHLCQECFDSCCHSSHAFASREKRNQRWRSVEKR-----SEVMKYLNTENEGE--------AKPG----CFQEKQGQFYTPKHVVKSLPLLMITKKSKLLAPGYQCRLCLKSFSFGQYTRLLP-CTHKVKA 368          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Mouse
Match: Map3k1 (mitogen-activated protein kinase kinase kinase 1 [Source:MGI Symbol;Acc:MGI:1346872])

HSP 1 Score: 82.0333 bits (201), Expect = 9.552e-16
Identity = 49/201 (24.38%), Postives = 96/201 (47.76%), Query Frame = 2
Query:  113 KAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQR--------------------KIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEF 655
            K      ++L++IGP  F++  +  + KY+V +G P +CSC         C H+ +++L+ F+++  DP+ W+ +L   E+  L      K  +   +     + N  +  VS+                     K E + +CPIC   +L+ ++ +T C +GC N +H  CM++W E  ++      ++ + CP+CR ++
Sbjct:  305 KVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIG-PQNCSCG----RGAFCIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLF----QKYHSRRSSRIKAPSRNTIQKFVSRMSNCHTLSSSSTSTSSSENSIKDEEEQMCPICLLGMLD-EESLTVCEDGCRNKLHHHCMSIWAEECRRN-----REPLICPLCRSKW 490          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Mouse
Match: Map3k1 (mitogen-activated protein kinase kinase kinase 1 [Source:MGI Symbol;Acc:MGI:1346872])

HSP 1 Score: 53.5286 bits (127), Expect = 2.471e-7
Identity = 24/85 (28.24%), Postives = 47/85 (55.29%), Query Frame = 2
Query:  113 KAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLI 367
            K      ++L++IGP  F++  +  + KY+V +G P +CSC         C H+ +++L+ F+++  DP+ W+ +L   E+  L 
Sbjct:  147 KVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIG-PQNCSCG----RGAFCIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLF 226          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Mouse
Match: Rnf126 (ring finger protein 126 [Source:MGI Symbol;Acc:MGI:1917544])

HSP 1 Score: 53.1434 bits (126), Expect = 4.428e-7
Identity = 36/108 (33.33%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  965 LESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSLNSSGHHHKPP 1288
            L+++   LL Q +  G     +++ +    T  +T +   S  G +C +C+  Y  G+SVR+LP C H+FH  CI PW L +  SCP     VC+ SL        PP
Sbjct:  188 LDTIITQLLNQFENTGPPPADKEK-IQALPTVPVTEEHVGS--GLECPVCKEDYALGESVRQLP-CNHLFHDSCIVPW-LEQHDSCP-----VCRKSLTGQNTATNPP 285          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. UniProt/SwissProt
Match: sp|Q9D9X6|ZSWM2_MOUSE (E3 ubiquitin-protein ligase Zswim2 OS=Mus musculus OX=10090 GN=Zswim2 PE=1 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 2.954e-86
Identity = 157/397 (39.55%), Postives = 223/397 (56.17%), Query Frame = 2
Query:   74 RRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEK-KYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFREHSNGRWLSAPNSRGLPLSLVNGLQNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFST----------WSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPID 1231
            RR ++E ++W Q +A + + ++LR+IGP GF+++EE  EK  ++V LG+PH CSC  F K  +LCKHICW+LLK+F++ ++   ++Q  L E EINDL+     +        +   A+ + +  + Q+ I   DICPICQ+ LL ++ PVTFCR GCGNN+HI+CM +   ++    +  +   + CP+CR EF  L +++ E  NS  +     K  L  K +G+ C+NCN  PI G+ YKC  C +++LC  CF++C HS H F+ RE  N RW S         S V    N++ E           KPG      Q+   QF T            IT KSKL  PG+QCR+C  S+  G   R LP C H FH  CID WLLH+  SCPID
Sbjct:   12 RRHLSESLSWQQDQALSSSIYLLRQIGPTGFLLKEEEPEKGDFRVLLGNPHECSCPTFLKRGELCKHICWVLLKKFKLPRNHESAFQLGLTEGEINDLL-RGIHQVQAPQLRASDETAQVEEDGYLKQKDINAGDICPICQEVLLEKKLPVTFCRFGCGNNVHIKCMRILANYQDTGSDSSV---LRCPLCREEFAPLKVILEEFKNSNKLITISEKERLD-KHLGIPCNNCNQLPIEGRCYKCTECVEYHLCQECFDSCCHSSHAFASREKRNQRWRSVEKR-----SEVMKYLNTENEGE--------AKPG----CFQEKQGQFYTPKHVVKSLPLLMITKKSKLLAPGYQCRLCLKSFSFGQYTRLLP-CTHKFHRKCIDNWLLHKCNSCPID 385          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. UniProt/SwissProt
Match: sp|Q8NEG5|ZSWM2_HUMAN (E3 ubiquitin-protein ligase ZSWIM2 OS=Homo sapiens OX=9606 GN=ZSWIM2 PE=1 SV=2)

HSP 1 Score: 266.544 bits (680), Expect = 6.022e-80
Identity = 147/387 (37.98%), Postives = 220/387 (56.85%), Query Frame = 2
Query:   74 RRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHE-KKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFREHSNGRWLSAPNSRGLPLSLVNGLQNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPID 1231
            RR ++E ++W+Q +A + + ++LRE+GP GF+++EE  E   ++V LG+PH C+C  F K  +LCKHICW+LLK+F++ ++   + Q  L EREI+DL+     +  T        N   + +  + Q++I+++DIC ICQ+ LL ++ PVTFCR GCGN+IHI+CM +   ++    N  M   + CP+CR EF  L L++ E  NS  +     K  L  K +G+ C+NC   PI GK YKC  C +++LC  CF++C H  H F+FRE  N +W S        +  ++  +N   E + +   +Q         +R   L       IT  SKL  PG+QC +C  ++  G   R LP C H FH  CID WL H+  SCPID
Sbjct:   12 RRHLSERLSWHQDQALSSSIYLLREMGPTGFLLREEEPEYMDFRVFLGNPHVCNCSTFPKGGELCKHICWVLLKKFKLPRNHESALQLGLGEREISDLL-RGIHRVQTPQPGTNDENEHVEEDGYIKQKEIDSEDICSICQELLLEKKLPVTFCRFGCGNSIHIKCMKILANYQSTS-NTSM---LKCPLCRKEFAPLKLILEEFKNSSKLVAAAEKERLD-KHLGIPCNNCKQFPIEGKCYKCTECIEYHLCQECFDSCCHLSHTFTFREKRNQKWRSLEKRADEVVKYIDT-KNEIEEKMSHFQEKQGQVYTPKHIVRSLPLQL-----ITKNSKLLAPGYQCLLCLKAFHLGQHTRLLP-CTHKFHRKCIDNWLFHKCNSCPID 385          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. UniProt/SwissProt
Match: sp|Q13233|M3K1_HUMAN (Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP3K1 PE=1 SV=4)

HSP 1 Score: 82.8037 bits (203), Expect = 3.653e-15
Identity = 54/217 (24.88%), Postives = 102/217 (47.00%), Query Frame = 2
Query:   68 PYR-RQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQR--------------------KIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEF 655
            PY   + N  VN    K      ++L++IGP  F++  +  + KY+V +G P +CSC         C H+ +++L+ F+++  DP+ W+ +L   E+  L      K  +   +     + N  +  VS+                     K E + +CPIC   +L+ ++ +T C +GC N +H  CM++W E  ++      ++ + CP+CR ++
Sbjct:  298 PYSPEETNRRVN----KVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIG-PQNCSCA----RGTFCIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLF----QKYHSRRSSRIKAPSRNTIQKFVSRMSNSHTLSSSSTSTSSSENSIKDEEEQMCPICLLGMLD-EESLTVCEDGCRNKLHHHCMSIWAEECRRN-----REPLICPLCRSKW 495          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. UniProt/SwissProt
Match: sp|Q62925|M3K1_RAT (Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus OX=10116 GN=Map3k1 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 3.672e-15
Identity = 49/201 (24.38%), Postives = 96/201 (47.76%), Query Frame = 2
Query:  113 KAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQR--------------------KIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEF 655
            K      ++L++IGP  F++  +  + KY+V +G P +CSC         C H+ +++L+ F+++  DP+ W+ +L   E+  L      K  +   +     + N  +  VS+                     K E + +CPIC   +L+ ++ +T C +GC N +H  CM++W E  ++      ++ + CP+CR ++
Sbjct:  300 KVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIG-PQNCSCG----RGTFCIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLF----QKYHSRRSSRIKAPSRNTIQKFVSRMSNCHTLSSSSTSTSSSENSIKDEEEQMCPICLLGMLD-EESLTVCEDGCRNKLHHHCMSIWAEECRRN-----REPLICPLCRSKW 485          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. UniProt/SwissProt
Match: sp|P53349|M3K1_MOUSE (Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus OX=10090 GN=Map3k1 PE=1 SV=3)

HSP 1 Score: 82.4185 bits (202), Expect = 4.847e-15
Identity = 49/201 (24.38%), Postives = 96/201 (47.76%), Query Frame = 2
Query:  113 KAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQR--------------------KIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEF 655
            K      ++L++IGP  F++  +  + KY+V +G P +CSC         C H+ +++L+ F+++  DP+ W+ +L   E+  L      K  +   +     + N  +  VS+                     K E + +CPIC   +L+ ++ +T C +GC N +H  CM++W E  ++      ++ + CP+CR ++
Sbjct:  305 KVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIG-PQNCSCG----RGAFCIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLF----QKYHSRRSSRIKAPSRNTIQKFVSRMSNSHTLSSSSTSTSSSENSIKDEEEQMCPICLLGMLD-EESLTVCEDGCRNKLHHHCMSIWAEECRRN-----REPLICPLCRSKW 490          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. TrEMBL
Match: V3ZDQ8 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_237091 PE=4 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 1.222e-111
Identity = 171/386 (44.30%), Postives = 242/386 (62.69%), Query Frame = 2
Query:   71 YRRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAEN---TVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFREHSNGRW--LSAPNSRGLPLSLVNGLQNSDLESVDYTLLQQLDKPGE--GSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLH 1207
            +RR IN+IV W Q +A N T +ILRE GP GF+++EEG  K  KV LGDPHSC+C  FKK+KDLCKHI W+LLK+FR+ K++P++WQ  L EREIN+++     ++    +      +  QA +      QR+I  DD+CPICQD+LL +  PVT+C+ GCGN+IHI+CM +W EH+K     K  + V CP+CR +FG  +LL  EM N+         ++ Q + +G NC +C+  PI GK Y+C  C+ F LC  CFN+ IH+ H+F +R+  N RW  +S  ++  LP ++VN L   D+   DY  L QLD   E  GS+L ++++N      +    +L  PG QCRIC  +Y+ G  +R+LP C+H FH  C+D WLLH
Sbjct:    7 WRRNINDIVCWRQAEAGNATIYILRERGPTGFLLKEEGEPKNVKVFLGDPHSCTCAQFKKDKDLCKHISWLLLKKFRIPKENPLTWQLGLVEREINEVLRGVVQQQQRRQQEKKTHRSVIQASDGREVKGQREISEDDVCPICQDELLAKHLPVTYCKFGCGNSIHIKCMKIWAEHQKG----KGDNFVKCPMCREDFGPFNLLKEEMRNANGGLTQTRNVVRQDRHLGTNCQSCHTAPIEGKCYRCVVCADFMLCQSCFNSPIHTHHQFEYRQKRNQRWQRVSRRDNGVLPEAVVNNLMARDITDDDYDYLLQLDSHQEIQGSDLTEEEINTLPQERVREGGQLLAPGMQCRICLRAYEVGQLIRRLP-CRHKFHKDCVDNWLLH 387          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. TrEMBL
Match: A0A3S0ZX32 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_014830 PE=4 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 5.443e-111
Identity = 174/417 (41.73%), Postives = 255/417 (61.15%), Query Frame = 2
Query:   68 PYRRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQ---AENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFREHSNGRWLSAPNS--RGLPLSLVNGLQNSDLESVDYTLLQQLDK--PGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKL----SLNSSGHHHKP 1285
            P+RR+++E  NW+Q +A   T +ILR+ GP GF+++EEG  K  KV +GDPH+C+C  FKKE+DLCKHICW+LL++FR+  +DP+SWQ  L EREIN+++  +   +     +    +  +Q       V QR+I  +D+CPICQ++LL ++ PVT+C+  CGN+IHI+CM VW +H+KK      +  + CP+CR +FG + LL  E  N+     P   I +  + +G+ CSNC+  PI GK Y+C  C  ++LC  CFN  IH+ H F FR+  N RW SAP +   GLP +LVN L + ++   DY LL Q+++    E S L ++D+N      +     L   G QCRIC   +  G +VR+LP C+H FH  C+D WL+H   +CP+D + V       +L SSG  H+P
Sbjct:    6 PWRREVSEACNWHQSQALESTIYILRQTGPTGFLLKEEGERKNVKVFMGDPHTCTCPVFKKERDLCKHICWLLLRKFRLSVNDPLSWQLGLVEREINEILRGRVTAERPQRVSQAKKSVTDQTIDGRTVVEQREIAEEDVCPICQEELLAKKLPVTYCKFACGNSIHIKCMTVWADHQKK---TTPEGVIKCPMCREDFGPIDLLKTESRNAGCKANPPPGIRMD-RHLGVMCSNCSKAPIEGKCYRCMVCPTYHLCQRCFNFPIHTNHSFQFRQKRNQRWRSAPRTLGSGLPDALVNDLMHREITENDYDLLLQMERNQQEELSQLTEEDVNNLPLEKVREGGSLLSLGAQCRICLRGFCVGQAVRRLP-CRHKFHKDCVDSWLVHSHPTCPVDGLPVFTRVHADALTSSGQSHQP 417          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. TrEMBL
Match: A0A1S3JZY7 (E3 ubiquitin-protein ligase ZSWIM2-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106177655 PE=4 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 5.186e-110
Identity = 166/395 (42.03%), Postives = 236/395 (59.75%), Query Frame = 2
Query:   71 YRRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAEN----QAENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFREHSNGRWLSAPNSRG--LPLSLVNGLQNSDLESVDYTLLQQLDKPG--EGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPID 1231
            +RR I+++V+W Q +A N T +ILRE+GP GF+++EEG  KK+K  LGDPH C+C  F K+KDLCKHICW+LLK+FR+ + +P++WQ  L EREIN+L+      +                       + QR+I  +D+CPICQ++LL + +PVT+C+ GC N+IHI+CM VW EH+K       +  + CP CR +FG   LL  E  NS   +    ++ L    +G  C  C   PI GK Y C  C  +YLC  CFN  IH++H F FR+    RW  A    G  LP ++VN L N ++   DY +L QLD     + SN+ ++ +  F T  + + SKL  PG QCR+C  +++AG  +R+LP C+H FH  CID WL+H+  +CPID
Sbjct:    7 WRRTISDLVSWRQDQALNATIYILREMGPTGFLLKEEGESKKFKAFLGDPHKCTCSTFMKDKDLCKHICWLLLKKFRIPRTNPVTWQMGLVEREINELLRGLMAHQDPRRGPPAKKVTATTTVVDGRPVLEQREIGKEDVCPICQEELLAKHEPVTYCKFGCANSIHIKCMKVWAEHQKSS----GETVIKCPFCREDFGPFDLLRQEYANSSVRQTRAERLDL---HLGSVCGGCRVCPIQGKCYNCTVCVTYYLCQECFNTQIHTEHSFQFRQKPTQRWRPAQRGSGTALPSAVVNNLMNREIREEDYDMLLQLDSTAANQVSNIPEEVVKGFPTERVRDGSKLLAPGEQCRVCLRAFQAGQQIRRLPVCKHKFHIDCIDNWLIHQRPTCPID 394          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. TrEMBL
Match: A0A267FMM8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001619g4 PE=4 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 6.553e-110
Identity = 176/429 (41.03%), Postives = 247/429 (57.58%), Query Frame = 2
Query:   68 PYRRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXX--------XXAEN-------QAENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSV--PCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNC-IHSQHE-------------FSFREHSNGRWLSAPNSR----GLPLSLVNGLQN--SDLESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEV 1243
            PYRR I++ VNW Q +A   T FILREIGP GF++QE+G  K  KV +GDPH CSC +F++++DLC+HICW+LL+RFR+D+DDP+SWQ  L EREIN L+     ++       +           AE+        A    +QR I  +D+CPICQ++LL  + PVT+CR  CGN+IH+RCM VWT H+KK+       +V   CP+CRG+F    LLM E+ N+   K    + ++   +I   CS C    ++GK Y+C+ C  F++C  CFN+  +H Q               F FRE    +W   P  R    G+PLS+   LQ+   D    DY  L  LD P  GS+L +  L +   W++     L++PG QC +C M++  G  VR+L  C+H+ H+ CIDP LLHR+  CP+D IEV
Sbjct:    5 PYRRTISDTVNWRQEQALGATIFILREIGPTGFLLQEDGSPKHIKVLIGDPHHCSCSEFRRDRDLCRHICWLLLRRFRIDRDDPLSWQAGLVEREINGLLTGARRRRSAAAAAASTAAASGSSNGGAEDGSKRPNPAASAEAAQRPISEEDVCPICQEELLASRLPVTYCRLTCGNSIHMRCMHVWTTHQKKQQQGGAAANVNIACPMCRGDFAPYALLMQELGNASAAK----QAVVTAHKIA--CSGCGEAAVLGKLYRCSVCRDFHMCQRCFNSPQVHPQQHNSQRPAGGASVSVFQFRERPGQQW--RPVDRLAGIGVPLSVAGLLQSRPGDFGEADYEALMALDAPAAGSHLTESALGRLRHWTVQRGHTLTRPGRQCPLCLMAFLPGQQVRQLAPCRHVMHSGCIDPLLLHRSCLCPLDSIEV 425          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. TrEMBL
Match: A0A1I8JFZ6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 7.121e-110
Identity = 176/429 (41.03%), Postives = 247/429 (57.58%), Query Frame = 2
Query:   68 PYRRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXX--------XXAEN-------QAENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSV--PCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNC-IHSQHE-------------FSFREHSNGRWLSAPNSR----GLPLSLVNGLQN--SDLESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEV 1243
            PYRR I++ VNW Q +A   T FILREIGP GF++QE+G  K  KV +GDPH CSC +F++++DLC+HICW+LL+RFR+D+DDP+SWQ  L EREIN L+     ++       +           AE+        A    +QR I  +D+CPICQ++LL  + PVT+CR  CGN+IH+RCM VWT H+KK+       +V   CP+CRG+F    LLM E+ N+   K    + ++   +I   CS C    ++GK Y+C+ C  F++C  CFN+  +H Q               F FRE    +W   P  R    G+PLS+   LQ+   D    DY  L  LD P  GS+L +  L +   W++     L++PG QC +C M++  G  VR+L  C+H+ H+ CIDP LLHR+  CP+D IEV
Sbjct:    6 PYRRTISDTVNWRQEQALGATIFILREIGPTGFLLQEDGSPKHIKVLIGDPHHCSCSEFRRDRDLCRHICWLLLRRFRIDRDDPLSWQAGLVEREINGLLTGARRRRSAAAAAASTAAASGSSNGGAEDGSKRPNPAASAEAAQRPISEEDVCPICQEELLASRLPVTYCRLTCGNSIHMRCMHVWTTHQKKQQQGGAAANVNIACPMCRGDFAPYALLMQELGNASAAK----QAVVTAHKIA--CSGCGEAAVLGKLYRCSVCRDFHMCQRCFNSPQVHPQQHNSQRPAGGASVSVFQFRERPGQQW--RPVDRLAGIGVPLSVAGLLQSRPGDFGEADYEALMALDAPAAGSHLTESALGRLRHWTVQRGHTLTRPGRQCPLCLMAFLPGQQVRQLAPCRHVMHSGCIDPLLLHRSCLCPLDSIEV 426          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Cavefish
Match: map3k1 (mitogen-activated protein kinase kinase kinase 1 [Source:NCBI gene;Acc:103042517])

HSP 1 Score: 86.6557 bits (213), Expect = 3.248e-17
Identity = 56/213 (26.29%), Postives = 98/213 (46.01%), Query Frame = 2
Query:   68 PYR-RQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLI-------FSXXXXXXXXXXXXXXXXAENQAENTVSQR---------KIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEF 655
            PY   + N  VN    K      ++L++IGP  F++  +  + KY+V +G P +CSC         C H+ +++L+ F+++  DP+ W+ +L   E+  L         S+            V    N   N  S           K E + +CPIC  D+L+ ++ +T C  GC N +H  CM++W E  ++       + + CP+CR ++
Sbjct:  312 PYSPEETNRRVN----KVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIG-PQTCSCG----RGAFCIHVLFVMLRVFQLESSDPLLWRKTLKNFEVESLFQKYHNRRSSRIKAPSRNTIQKFVSRMSNSHTNCTSSSSPSSNESSMKDEEEQMCPICLLDMLD-EESLTVCEEGCRNKLHHHCMSIWAEECRRN-----HEPLICPLCRAKW 509          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Cavefish
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 56.225 bits (134), Expect = 2.927e-8
Identity = 38/111 (34.23%), Postives = 57/111 (51.35%), Query Frame = 2
Query:  965 LESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSLNSSGHHHKPPHAS 1297
            L+++   LL Q +  G     R++ +    T  IT +   +  G +C +C+  Y AG+SVR+LP C H+FH  CI PW L +  +CP     VC+ SL+       PP  S
Sbjct:  180 LDAIITQLLNQFENTGPPPADREK-IKSLPTVQITEEHVGA--GLECPVCKEDYSAGESVRQLP-CNHLFHNDCIVPW-LEQHDTCP-----VCRKSLSGQNTATDPPGLS 280          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Cavefish
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 56.225 bits (134), Expect = 3.657e-8
Identity = 38/111 (34.23%), Postives = 57/111 (51.35%), Query Frame = 2
Query:  965 LESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSLNSSGHHHKPPHAS 1297
            L+++   LL Q +  G     R++ +    T  IT +   +  G +C +C+  Y AG+SVR+LP C H+FH  CI PW L +  +CP     VC+ SL+       PP  S
Sbjct:  233 LDAIITQLLNQFENTGPPPADREK-IKSLPTVQITEEHVGA--GLECPVCKEDYSAGESVRQLP-CNHLFHNDCIVPW-LEQHDTCP-----VCRKSLSGQNTATDPPGLS 333          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Cavefish
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 55.4546 bits (132), Expect = 6.848e-8
Identity = 38/111 (34.23%), Postives = 57/111 (51.35%), Query Frame = 2
Query:  965 LESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSLNSSGHHHKPPHAS 1297
            L+++   LL Q +  G     R++ +    T  IT +   +  G +C +C+  Y AG+SVR+LP C H+FH  CI PW L +  +CP     VC+ SL+       PP  S
Sbjct:  247 LDAIITQLLNQFENTGPPPADREK-IKSLPTVQITEEHVGA--GLECPVCKEDYSAGESVRQLP-CNHLFHNDCIVPW-LEQHDTCP-----VCRKSLSGQNTATDPPGLS 347          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Cavefish
Match: si:ch211-81a5.1 (si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-608])

HSP 1 Score: 51.6026 bits (122), Expect = 7.403e-7
Identity = 29/59 (49.15%), Postives = 36/59 (61.02%), Query Frame = 2
Query: 1100 QCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWL-LHRTASCPIDEIEVCKLSLNSSGH 1273
            +C +C+  Y  G+SVR+LP C H FH+ CI PWL LH T  CP     VC+ SLN   H
Sbjct:  208 ECPVCREEYSVGESVRQLP-CLHCFHSDCIVPWLQLHDT--CP-----VCRKSLNGEDH 258          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Sea Lamprey
Match: zswim2 (zinc finger, SWIM-type containing 2 [Source:ZFIN;Acc:ZDB-GENE-070719-8])

HSP 1 Score: 288.886 bits (738), Expect = 7.443e-93
Identity = 149/400 (37.25%), Postives = 227/400 (56.75%), Query Frame = 2
Query:   71 YRRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQA----ENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFREHSNGRWLSAPNSRGLPLSLVNGLQNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSL 1258
            +RR+ +++V+W+Q +A N T +ILR+ GP GF++QEEG     KV LGDPH CSC+ F KEKDLCKHICW+LLK+FR+ ++   ++Q  L  REI +L+   + K+          +  N A      +++Q+ I  +DICPICQ+ L  R+ PVT+CR+GCGN++HI CM +W +H+ +E +     ++ CP+CR  FGT  LL  E NN++ +     ++ L +   G+ C +C   PI G  Y+C  C   +LC  CF    H  H F FR+  +  W       G  L  V   Q ++      T   ++ + G      +  L       +   S+L  PG QCR+C  S++ G  VR LP C+H+FH  CID WLL+ + +CP+D++ + + +L
Sbjct:    9 WRREASDLVSWSQDQALNTTMYILRQFGPTGFMLQEEGQRSTVKVLLGDPHHCSCQTFCKEKDLCKHICWLLLKKFRLPREHEYAFQVGLVAREIVELLSGFHHKQAARPANTQPTHLSNVAHAGSHASMAQKDIGINDICPICQEKLFKRRLPVTYCRHGCGNSVHISCMKMWADHQTREGD-DGSMTLSCPLCRECFGTYALLQEEANNAEQLITAAERVRLHINS-GIACHHCQMRPIQGTCYRCAECMDIHLCQECFLARNHFHHMFVFRKTRSSSWCPVQTESGQLLPSVKN-QGTNAREQGCT---KMSRGGYSYYTSESALASLPILLVGPLSRLMAPGRQCRVCLRSFRQGQHVRPLP-CRHMFHKDCIDRWLLNVSGTCPVDDLPLTQPAL 401          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003252.1 (pep scaffold:Pmarinus_7.0:GL477130:148294:159282:-1 gene:ENSPMAG00000002970.1 transcript:ENSPMAT00000003252.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 7.641e-16
Identity = 51/197 (25.89%), Postives = 100/197 (50.76%), Query Frame = 2
Query:  113 KAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLI---------------FSXXXXXXXXXXXXXXXXAENQAENTVSQR-KIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEF 655
            K      ++L++IGP  F++  +  + K++V +G P +CSC         C H+ +++L+ F+ +  DP+ W+ +L   E+  L                 S   K V+ +  + +P A++ A +   Q  K E + +CPIC   +L+ +  +T C +GC N +H  CM++W E  ++      ++++ CP+CR ++
Sbjct:  158 KVMRARLYLLQQIGPNSFLIGGDSPDNKFRVFIG-PQTCSCG----RGTFCIHVMFVMLRVFQNEPSDPMLWRKTLKNFEVESLFQKYHTKRSSRIKAPSRSTITKFVSRLSNSHLPAAQSTASSHPEQSGKDEEEQVCPICLLGMLDEES-LTVCEDGCRNKLHHHCMSIWAEECRRN-----REALICPLCRAKW 343          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Sea Lamprey
Match: rnf150a (ring finger protein 150a [Source:ZFIN;Acc:ZDB-GENE-060213-1])

HSP 1 Score: 51.6026 bits (122), Expect = 2.472e-7
Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 2
Query: 1103 CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLL-HRTASCPIDEIEVCKLSL 1258
            C +C   YK  D VR LP C+H+FH  C+DPWLL HRT  CP+     CKL++
Sbjct:  289 CAVCIEGYKPNDVVRILP-CKHLFHKACVDPWLLDHRT--CPM-----CKLNI 333          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003771.1 (pep scaffold:Pmarinus_7.0:GL488469:4:5386:-1 gene:ENSPMAG00000003449.1 transcript:ENSPMAT00000003771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 3.028e-7
Identity = 20/49 (40.82%), Postives = 30/49 (61.22%), Query Frame = 2
Query: 1103 CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCK 1249
            C IC   Y+ G+ +R LP C H FH  C+DPWL  +  +CP+ + +V +
Sbjct:    7 CAICLEEYEEGERLRVLP-CAHAFHCKCVDPWLTQQRKNCPVCKRKVVR 54          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Sea Lamprey
Match: RNF115 (ring finger protein 115 [Source:HGNC Symbol;Acc:HGNC:18154])

HSP 1 Score: 50.0618 bits (118), Expect = 4.857e-7
Identity = 37/101 (36.63%), Postives = 52/101 (51.49%), Query Frame = 2
Query:  965 LESVDYTLLQQLDKPGEGSNLRQQDLNQFSTW-SITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSLNS 1264
            L+++   LL QLD  G        D  + S+   IT   +      +C +C+  Y  G+SVR+LP C H+FH++CI PW L    SCP     VC+  LNS
Sbjct:  161 LDAIITQLLGQLDNTGPPP----ADKEKISSLPRITIAQEHLNCSMECAVCKEDYSVGESVRQLP-CLHLFHSNCIVPW-LEMHDSCP-----VCRKGLNS 250          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Nematostella
Match: EDO43623 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY29])

HSP 1 Score: 137.117 bits (344), Expect = 8.044e-38
Identity = 74/194 (38.14%), Postives = 109/194 (56.19%), Query Frame = 2
Query:  329 QPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENT-------VSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNS--KNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFRE 883
            Q SL EREIN+++                  AE ++ENT       + Q++I  +D+CPICQD+LL++ +P+T+C+ GCGN++HI+CM VW EH++       +    CP+CR +FGT   LM E N S  KN +  +  +      +G +C+ C   PI GK Y+C  CS ++LC  CF    H QH F FR+
Sbjct:    1 QLSLVEREINEVM--------RGAYVPAQRAAEPKSENTHTDNRDKMKQKEISEEDVCPICQDELLDKCEPLTYCKYGCGNSVHIKCMKVWAEHQRS----TGEKITKCPLCRVDFGTFQELMDEFNKSSRKNTRSERHDV-----HLGASCNKCRVCPITGKCYRCVICSDYHLCHPCFLTDHHMQHSFQFRQ 177          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Nematostella
Match: EDO44243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWD9])

HSP 1 Score: 58.5362 bits (140), Expect = 2.136e-9
Identity = 33/105 (31.43%), Postives = 53/105 (50.48%), Query Frame = 2
Query:  932 LSLVNGLQNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVC 1246
            +S +  LQ+ ++   D+ LL QLD   E   + +  ++     ++            C IC   Y  GDS++ LP C+H FH+ CI  WL + +  CP+D +EVC
Sbjct:  205 ISQLMTLQDREITPNDFDLLLQLDNFVEVKTVPKHIIDGLQCVTVN-----EGIDDVCLICMEEYAVGDSMKYLP-CRHNFHSACIRTWLTYTSCKCPLDGLEVC 303          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Nematostella
Match: EDO49283 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH29])

HSP 1 Score: 48.1358 bits (113), Expect = 3.097e-7
Identity = 27/80 (33.75%), Postives = 44/80 (55.00%), Query Frame = 2
Query:  983 TLLQQLDKPGEGS--NLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWL-LHRT 1213
            TLL   ++ GE     L + +++Q  T+ +T +SK      +C +C + ++    VR LP C H +H  CID WL +H+T
Sbjct:    8 TLLNLAEQIGEAKPKGLTRAEIDQLPTYRVTAESKKQNDDARCVVCLVDFEEKQLVRTLP-CLHEYHTRCIDKWLKVHKT 86          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Nematostella
Match: EDO31118 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYV5])

HSP 1 Score: 47.7506 bits (112), Expect = 4.128e-7
Identity = 27/86 (31.40%), Postives = 46/86 (53.49%), Query Frame = 2
Query:  953 QNSDLESVDYTLLQQLDK---PGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWL 1201
            QN + E+ D+ +L  L +   P +   L ++ +++  ++  +  +K    G  C +C M Y   + +RKLP C H FH+ CID WL
Sbjct:   10 QNQNNENEDFEVLWNLSERIGPAKSRGLSKEVIDRIPSFRFSASNKDMSNG-SCVVCMMDYTNREKLRKLP-CNHDFHSKCIDRWL 93          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Nematostella
Match: EDO36379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIX4])

HSP 1 Score: 51.6026 bits (122), Expect = 4.510e-7
Identity = 30/91 (32.97%), Postives = 39/91 (42.86%), Query Frame = 2
Query: 1103 CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSLNSS---------------GHHHKPPHASISLLNQNNSHS 1330
            C IC   YK GD +R LP C H +H  C+DPWL     +CP     VCK  + +S               GHH   P  +  L+  +   S
Sbjct:  266 CAICLDEYKEGDKLRILP-CDHAYHCKCVDPWLTEGKRTCP-----VCKRPVETSKKKKQGIQGSADAEQGHHEHEPSETTPLIRPSTQTS 350          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Medaka
Match: rnf11a (RING finger protein 11 [Source:NCBI gene;Acc:101174724])

HSP 1 Score: 53.1434 bits (126), Expect = 4.124e-8
Identity = 22/42 (52.38%), Postives = 30/42 (71.43%), Query Frame = 2
Query: 1100 QCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCP 1225
            +C IC M ++ GD +R LP C HI+H  CIDPWL+ R+ +CP
Sbjct:   89 ECVICMMDFEYGDPIRFLP-CLHIYHVSCIDPWLM-RSFTCP 128          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Medaka
Match: rnf150a (RING finger protein 150 [Source:NCBI gene;Acc:101170247])

HSP 1 Score: 55.8398 bits (133), Expect = 7.043e-8
Identity = 33/97 (34.02%), Postives = 52/97 (53.61%), Query Frame = 2
Query: 1031 QQDLNQFSTWSITNKSKLSQPGHQ-CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLL-HRTASCPIDEIEVCK---LSLNSSGHHHKPPHASISL 1306
            +Q +++    ++    K  +P  + C +C   Y+  D VR LP C+H FH HC+DPWL  HRT  CP+ +I + K   ++ N+      PP   +SL
Sbjct:  241 KQAISKLQVRTLKKGDKEIEPDFENCAVCIECYQPNDVVRILP-CRHAFHKHCVDPWLQDHRT--CPMCKINILKALGIAFNADCTDDIPPDYEVSL 334          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Medaka
Match: rnf150b (RING finger protein 150 [Source:NCBI gene;Acc:101169977])

HSP 1 Score: 54.299 bits (129), Expect = 1.873e-7
Identity = 28/58 (48.28%), Postives = 39/58 (67.24%), Query Frame = 2
Query: 1103 CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLL-HRTASCPIDEIEVCK---LSLNS 1264
            C +C   YKA D VR LP C+H+FH  C+DPWLL HRT  CP+ ++ + K   ++LN+
Sbjct:  269 CAVCIEGYKANDVVRVLP-CRHLFHKSCVDPWLLDHRT--CPMCKMNILKALGIALNA 323          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Medaka
Match: rnf181 (ring finger protein 181 [Source:NCBI gene;Acc:101167798])

HSP 1 Score: 51.6026 bits (122), Expect = 2.189e-7
Identity = 32/106 (30.19%), Postives = 56/106 (52.83%), Query Frame = 2
Query:  926 LPLSLVNGLQNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEV 1243
            L  SL+ GL   D  S+D +   Q   P     + Q      S   +   ++ +  G +C +C + ++  ++VR++P C+H+FH+ CI PW L +T SCP+  +E+
Sbjct:   27 LARSLMQGLDLFDSGSLDLSDWDQRLPPPAAKTVVQ------SLTVVIISAEQADKGVKCPVCLLEFEEQETVREMP-CKHLFHSGCILPW-LGKTNSCPLCRLEL 124          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Medaka
Match: RNF126 (ring finger protein 126 [Source:NCBI gene;Acc:101169433])

HSP 1 Score: 52.373 bits (124), Expect = 6.686e-7
Identity = 36/111 (32.43%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  965 LESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSLNSSGHHHKPPHAS 1297
            L+++   LL Q +  G     R + +    T  +T++   S  G +C +C+  Y  G++VR+LP C H+FH  CI PW L +  +CP     VC+ SL+       PP  S
Sbjct:  186 LDAIITQLLNQFENTGPPPADRDK-IKSLPTVQVTDEHVAS--GLECPVCKEDYCVGENVRQLP-CNHMFHNDCIVPW-LEQHDTCP-----VCRKSLSGQNTATNPPDLS 286          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Planmine SMEST
Match: SMESG000064366.1 (SMESG000064366.1)

HSP 1 Score: 995.342 bits (2572), Expect = 0.000e+0
Identity = 512/512 (100.00%), Postives = 512/512 (100.00%), Query Frame = 2
Query:   68 PYRRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSXXXXXXXXXXXXXXXXAENQAENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFREHSNGRWLSAPNSRGLPLSLVNGLQNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSLNSSGHHHKPPHASISLLNQNNSHSFSNQIHNENSRRQNIIPTXXXXXXXXXXXXNCRPSSTSDLQKYNLTSPGNLIRSAIHKPSHLPPLSKPTNHQFDSSFSVTSFKPQKHSSQD 1603
            PYRRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSKNLKKVTTVKTNTVPNAENQAENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFREHSNGRWLSAPNSRGLPLSLVNGLQNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSLNSSGHHHKPPHASISLLNQNNSHSFSNQIHNENSRRQNIIPTSDLSSALSIASLNCRPSSTSDLQKYNLTSPGNLIRSAIHKPSHLPPLSKPTNHQFDSSFSVTSFKPQKHSSQD
Sbjct:    6 PYRRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYKVCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNEREINDLIFSKNLKKVTTVKTNTVPNAENQAENTVSQRKIETDDICPICQDDLLNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGEFGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKCNTCSQFYLCGICFNNCIHSQHEFSFREHSNGRWLSAPNSRGLPLSLVNGLQNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSLNSSGHHHKPPHASISLLNQNNSHSFSNQIHNENSRRQNIIPTSDLSSALSIASLNCRPSSTSDLQKYNLTSPGNLIRSAIHKPSHLPPLSKPTNHQFDSSFSVTSFKPQKHSSQD 517          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Planmine SMEST
Match: SMESG000013169.1 (SMESG000013169.1)

HSP 1 Score: 56.225 bits (134), Expect = 2.658e-8
Identity = 28/65 (43.08%), Postives = 35/65 (53.85%), Query Frame = 2
Query: 1079 KLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSLNSSGH 1273
            K   P   C IC   +K GD +R LP C H +HA+CIDPWLL +  +CPI     CK  +   G 
Sbjct:  201 KGRDPFETCAICLDDFKDGDKLRILP-CNHAYHANCIDPWLLKQKRNCPI-----CKYRIKIPGR 259          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Planmine SMEST
Match: SMESG000046062.1 (SMESG000046062.1)

HSP 1 Score: 55.0694 bits (131), Expect = 2.732e-8
Identity = 34/97 (35.05%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 1025 LRQQDLNQFSTWSITNKSKLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCP---IDEIEVCKLSLNSSGHHHKPPHASISL 1306
            L + DLN+F T    N    ++    C IC  SY++GD ++ +P C H FH+ CID WLL ++ SCP   ++ I   K  ++      + P+++ISL
Sbjct:    7 LTRDDLNKFPTKIFENSVCSNEQSTVCDICLESYQSGDQIKSIP-CLHSFHSSCIDIWLL-KSPSCPNCRLNVIRFLKTEVD------EKPNSTISL 95          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Planmine SMEST
Match: SMESG000013169.1 (SMESG000013169.1)

HSP 1 Score: 56.225 bits (134), Expect = 3.151e-8
Identity = 28/65 (43.08%), Postives = 35/65 (53.85%), Query Frame = 2
Query: 1079 KLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSLNSSGH 1273
            K   P   C IC   +K GD +R LP C H +HA+CIDPWLL +  +CPI     CK  +   G 
Sbjct:  216 KGRDPFETCAICLDDFKDGDKLRILP-CNHAYHANCIDPWLLKQKRNCPI-----CKYRIKIPGR 274          
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Planmine SMEST
Match: SMESG000013169.1 (SMESG000013169.1)

HSP 1 Score: 55.8398 bits (133), Expect = 3.381e-8
Identity = 28/65 (43.08%), Postives = 35/65 (53.85%), Query Frame = 2
Query: 1079 KLSQPGHQCRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKLSLNSSGH 1273
            K   P   C IC   +K GD +R LP C H +HA+CIDPWLL +  +CPI     CK  +   G 
Sbjct:  182 KGRDPFETCAICLDDFKDGDKLRILP-CNHAYHANCIDPWLLKQKRNCPI-----CKYRIKIPGR 240          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZSWIM21.254e-8037.98zinc finger SWIM-type containing 2 [Source:HGNC Sy... [more]
MAP3K17.606e-1624.88mitogen-activated protein kinase kinase kinase 1 [... [more]
RNF1501.648e-650.00ring finger protein 150 [Source:HGNC Symbol;Acc:HG... [more]
RNF1501.934e-650.00ring finger protein 150 [Source:HGNC Symbol;Acc:HG... [more]
RNF1492.419e-652.00ring finger protein 149 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C18B12.48.227e-638.89pep chromosome:WBcel235:X:15036662:15040602:-1 gen... [more]
back to top
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gol2.571e-742.67gene:FBgn0004919 transcript:FBtr0300178[more]
gol2.571e-742.67gene:FBgn0004919 transcript:FBtr0306330[more]
gol4.227e-750.98gene:FBgn0004919 transcript:FBtr0072459[more]
gol4.336e-750.98gene:FBgn0004919 transcript:FBtr0300179[more]
Iru1.473e-635.58gene:FBgn0037653 transcript:FBtr0081965[more]
back to top
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zswim21.179e-8135.81zinc finger, SWIM-type containing 2 [Source:ZFIN;A... [more]
map3k15.177e-1827.07mitogen-activated protein kinase kinase kinase 1, ... [more]
map3k11.325e-1624.37mitogen-activated protein kinase kinase kinase 1, ... [more]
map3k11.335e-1624.37mitogen-activated protein kinase kinase kinase 1, ... [more]
rnf11a3.684e-750.00ring finger protein 11a [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a16.376e-1523.70solute carrier family 2 (facilitated glucose trans... [more]
slc2a12.283e-822.41solute carrier family 2 (facilitated glucose trans... [more]
rnf1812.808e-830.30ring finger protein 181 [Source:NCBI gene;Acc:4966... [more]
rnf1495.843e-754.00ring finger protein 149 [Source:NCBI gene;Acc:7801... [more]
rnf1496.218e-754.00ring finger protein 149 [Source:NCBI gene;Acc:7801... [more]
back to top
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zswim24.223e-8739.55zinc finger SWIM-type containing 2 [Source:MGI Sym... [more]
Zswim25.704e-7837.89zinc finger SWIM-type containing 2 [Source:MGI Sym... [more]
Map3k19.552e-1624.38mitogen-activated protein kinase kinase kinase 1 [... [more]
Map3k12.471e-728.24mitogen-activated protein kinase kinase kinase 1 [... [more]
Rnf1264.428e-733.33ring finger protein 126 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D9X6|ZSWM2_MOUSE2.954e-8639.55E3 ubiquitin-protein ligase Zswim2 OS=Mus musculus... [more]
sp|Q8NEG5|ZSWM2_HUMAN6.022e-8037.98E3 ubiquitin-protein ligase ZSWIM2 OS=Homo sapiens... [more]
sp|Q13233|M3K1_HUMAN3.653e-1524.88Mitogen-activated protein kinase kinase kinase 1 O... [more]
sp|Q62925|M3K1_RAT3.672e-1524.38Mitogen-activated protein kinase kinase kinase 1 O... [more]
sp|P53349|M3K1_MOUSE4.847e-1524.38Mitogen-activated protein kinase kinase kinase 1 O... [more]
back to top
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZDQ81.222e-11144.30Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A3S0ZX325.443e-11141.73Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1S3JZY75.186e-11042.03E3 ubiquitin-protein ligase ZSWIM2-like isoform X2... [more]
A0A267FMM86.553e-11041.03Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8JFZ67.121e-11041.03Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k13.248e-1726.29mitogen-activated protein kinase kinase kinase 1 [... [more]
rnf1262.927e-834.23ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf1263.657e-834.23ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf1266.848e-834.23ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
si:ch211-81a5.17.403e-749.15si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-6... [more]
back to top
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zswim27.443e-9337.25zinc finger, SWIM-type containing 2 [Source:ZFIN;A... [more]
ENSPMAT00000003252.17.641e-1625.89pep scaffold:Pmarinus_7.0:GL477130:148294:159282:-... [more]
rnf150a2.472e-750.94ring finger protein 150a [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000003771.13.028e-740.82pep scaffold:Pmarinus_7.0:GL488469:4:5386:-1 gene:... [more]
RNF1154.857e-736.63ring finger protein 115 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO436238.044e-3838.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442432.136e-931.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492833.097e-733.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311184.128e-731.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363794.510e-732.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf11a4.124e-852.38RING finger protein 11 [Source:NCBI gene;Acc:10117... [more]
rnf150a7.043e-834.02RING finger protein 150 [Source:NCBI gene;Acc:1011... [more]
rnf150b1.873e-748.28RING finger protein 150 [Source:NCBI gene;Acc:1011... [more]
rnf1812.189e-730.19ring finger protein 181 [Source:NCBI gene;Acc:1011... [more]
RNF1266.686e-732.43ring finger protein 126 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of E3 ubiquitin-protein ligase ZSWIM2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064366.10.000e+0100.00SMESG000064366.1[more]
SMESG000013169.12.658e-843.08SMESG000013169.1[more]
SMESG000046062.12.732e-835.05SMESG000046062.1[more]
SMESG000013169.13.151e-843.08SMESG000013169.1[more]
SMESG000013169.13.381e-843.08SMESG000013169.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035586 ID=SMED30035586|Name=E3 ubiquitin-protein ligase ZSWIM2|organism=Schmidtea mediterranea sexual|type=transcript|length=1668bp
TCATGTTTAGTAACAAACTTGGTTAATAATCATTTCCTGATCTCTAGTTT
TAATGTCTCGTTCTATTCCATATCGACGTCAAATAAATGAAATAGTTAAT
TGGAATCAAATAAAAGCTGCTAATGAGACATTTTTCATTCTTCGAGAAAT
AGGCCCAGTGGGTTTTATAGTGCAAGAAGAAGGACATGAAAAAAAATACA
AAGTATGTTTGGGCGACCCTCATAGTTGCTCTTGCAAAGATTTTAAAAAG
GAAAAAGATTTATGTAAACATATCTGTTGGATTTTATTGAAACGATTTCG
AGTGGACAAAGATGATCCGATCAGTTGGCAACCAAGTTTAAATGAACGGG
AAATCAATGATTTGATATTCTCCAAGAACTTGAAGAAAGTTACAACGGTT
AAAACAAATACCGTTCCAAATGCAGAAAATCAAGCGGAAAACACTGTTTC
ACAAAGAAAAATTGAAACTGACGATATTTGTCCAATTTGTCAGGACGATT
TGTTGAATAGACAAAAACCGGTTACCTTTTGCCGAAATGGATGTGGAAAT
AATATACATATCAGATGTATGGCAGTATGGACTGAACACAAAAAGAAGGA
ATTAAATATGAAAATGCAAGATTCTGTTCCTTGCCCGATTTGCAGAGGAG
AATTTGGAACTTTGCATTTGTTAATGGTGGAAATGAATAATTCCAAAAAT
ATAAAAGTTCCAAAATCTAAAATAATTCTTCAGGTGAAGCAAATAGGCCT
GAACTGTTCCAATTGTAATGCTACCCCCATAATCGGTAAAGCATACAAAT
GTAACACTTGTTCCCAATTCTATTTATGTGGAATTTGCTTTAATAATTGC
ATTCACAGTCAGCATGAGTTTTCATTTAGAGAACATTCAAATGGAAGGTG
GTTAAGTGCTCCAAATTCAAGAGGGTTGCCATTATCTTTGGTTAATGGAT
TACAGAATAGTGACCTGGAATCAGTGGATTACACTCTATTACAGCAGCTC
GATAAACCTGGGGAAGGCAGCAATCTTCGACAACAAGACCTAAATCAATT
TTCGACCTGGTCTATAACAAACAAAAGCAAACTGTCTCAACCTGGACATC
AGTGTCGTATCTGTCAAATGTCTTACAAAGCAGGAGATTCAGTTCGTAAA
CTACCTCGATGTCAACATATATTTCATGCTCACTGCATTGATCCTTGGCT
GTTACATCGCACCGCAAGTTGCCCAATTGACGAGATAGAAGTTTGTAAAT
TGTCCCTGAACTCCTCTGGTCACCACCATAAACCACCTCACGCTTCGATC
TCATTGCTAAATCAAAATAATTCACATAGTTTTTCCAATCAAATTCACAA
TGAGAACAGTCGAAGACAGAATATAATTCCAACCAGTGATTTGTCTTCCG
CCTTATCAATTGCTTCACTTAATTGCCGGCCATCATCTACTTCTGATCTA
CAGAAATATAACCTAACCTCACCAGGAAATCTCATTCGAAGTGCCATTCA
CAAGCCTTCCCATTTGCCACCACTTTCAAAGCCGACAAATCATCAATTTG
ACTCATCATTCTCGGTAACATCTTTCAAACCACAAAAACACTCTAGCCAA
GACTAAAATCAAATCAAGAATAATATTTATTCTGCATGATTGTTAAATTA
TGGAATATTTGTTGGAAT
back to top

protein sequence of SMED30035586-orf-1

>SMED30035586-orf-1 ID=SMED30035586-orf-1|Name=SMED30035586-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=518bp
MSRSIPYRRQINEIVNWNQIKAANETFFILREIGPVGFIVQEEGHEKKYK
VCLGDPHSCSCKDFKKEKDLCKHICWILLKRFRVDKDDPISWQPSLNERE
INDLIFSKNLKKVTTVKTNTVPNAENQAENTVSQRKIETDDICPICQDDL
LNRQKPVTFCRNGCGNNIHIRCMAVWTEHKKKELNMKMQDSVPCPICRGE
FGTLHLLMVEMNNSKNIKVPKSKIILQVKQIGLNCSNCNATPIIGKAYKC
NTCSQFYLCGICFNNCIHSQHEFSFREHSNGRWLSAPNSRGLPLSLVNGL
QNSDLESVDYTLLQQLDKPGEGSNLRQQDLNQFSTWSITNKSKLSQPGHQ
CRICQMSYKAGDSVRKLPRCQHIFHAHCIDPWLLHRTASCPIDEIEVCKL
SLNSSGHHHKPPHASISLLNQNNSHSFSNQIHNENSRRQNIIPTSDLSSA
LSIASLNCRPSSTSDLQKYNLTSPGNLIRSAIHKPSHLPPLSKPTNHQFD
SSFSVTSFKPQKHSSQD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
GO:0000209protein polyubiquitination
GO:0006915apoptotic process
GO:1902043positive regulation of extrinsic apoptotic signaling pathway via death domain receptors
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR043145Znf_ZZ_sf
IPR039903Zswim2
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
IPR007527Znf_SWIM
IPR000433Znf_ZZ
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0016740transferase activity
GO:0043621protein self-association
GO:0046872metal ion binding
GO:0061630ubiquitin protein ligase activity
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 351..393
e-value: 1.4E-4
score: 31.2
coord: 143..197
e-value: 0.027
score: 23.6
IPR001841Zinc finger, RING-typePFAMPF13639zf-RING_2coord: 142..198
e-value: 3.0E-6
score: 27.5
coord: 350..392
e-value: 3.2E-10
score: 40.2
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 351..394
score: 10.586
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 143..198
score: 9.863
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 97..222
e-value: 1.3E-8
score: 36.3
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 314..399
e-value: 2.0E-15
score: 58.2
IPR043145Zinc finger, ZZ-type superfamilyGENE3DG3DSA:3.30.60.90coord: 245..286
e-value: 1.2E-8
score: 36.9
IPR007527Zinc finger, SWIM-typePFAMPF04434SWIMcoord: 53..80
e-value: 8.5E-6
score: 25.3
IPR007527Zinc finger, SWIM-typePROSITEPS50966ZF_SWIMcoord: 49..82
score: 9.668
IPR000433Zinc finger, ZZ-typePFAMPF00569ZZcoord: 233..272
e-value: 1.2E-4
score: 21.8
IPR000433Zinc finger, ZZ-typePROSITEPS50135ZF_ZZ_2coord: 229..275
score: 10.171
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 492..517
NoneNo IPR availablePANTHERPTHR21540:SF0E3 UBIQUITIN-PROTEIN LIGASE ZSWIM2coord: 1..425
NoneNo IPR availableCDDcd16486mRING-H2-C3H2C2D_ZSWM2coord: 350..393
e-value: 1.65677E-15
score: 68.4073
NoneNo IPR availableCDDcd16494RING-CH-C4HC3_ZSWM2coord: 140..201
e-value: 5.00817E-24
score: 92.7503
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 230..286
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 129..203
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 332..398
IPR039903E3 ubiquitin-protein ligase Zswim2PANTHERPTHR21540RING FINGER AND SWIM DOMAIN-CONTAINING PROTEIN 2coord: 1..425