Stabilizer of axonemal microtubules 2

Overview
NameStabilizer of axonemal microtubules 2
Smed IDSMED30035584
Length (bp)1737
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Stabilizer of axonemal microtubules 2 (SMED30035584) t-SNE clustered cells

Violin plots show distribution of expression levels for Stabilizer of axonemal microtubules 2 (SMED30035584) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Stabilizer of axonemal microtubules 2 (SMED30035584) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Stabilizer of axonemal microtubules 2 (SMED30035584) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035584

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035584SMESG000009389.1 SmedASXL_013822SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30035584SMESG000009389.1 dd_Smed_v4_3695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30035584SMESG000009389.1 dd_Smed_v4_3695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035584SMESG000009389.1 dd_Smed_v4_3695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035584SMESG000009389.1 dd_Smed_v4_3695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035584SMESG000009389.1 dd_Smed_v4_3695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30035584SMESG000009389.1 dd_Smed_v4_3695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30035584SMESG000009389.1 Contig51045uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035584SMESG000009389.1 Contig51045newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30035584SMESG000009389.1 dd_Smed_v6_3695_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035584SMESG000009389.1 OX_Smed_1.0.13607ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30035584SMESG000009389.1 dd_Smed_v4_3695_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035584SMESG000009389.1 dd_Smed_v4_3695_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Human
Match: SAXO1 (stabilizer of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:28566])

HSP 1 Score: 198.364 bits (503), Expect = 2.249e-56
Identity = 139/446 (31.17%), Postives = 207/446 (46.41%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPA--VRQTAGPCTLSEYTNKY-TPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLG-KFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPIS 1531
            CICE+C+CGRH CPH P     +T  PC LSEYT  Y   H ++P  S KP         P+   TT+R D+ PH +  VKVH  + + P E  MD  + Y  +Y    V + +PIK +  +     K E  PTY+ DY  W   R +  +    + P   RF+   T+  DY         SCKP         P ED+T+Y+ SYV HP+E +    +   +    +PF+ LTT K+ +    G    S KPLA+      P  + T  R  Y+ W + R        Y  P+  MD+ TT    Y       + + +P  + +    F+G++  +D YK+W+  +   V P  Q   P+ P +  +T  AH++ H     KSCKP       +   +  T Y + +T K +  C A+  E P   + + E D  GH+ Y+P+S
Sbjct:    5 CICELCSCGRHHCPHLPTKIYDKTEKPCLLSEYTENYPFYHSYLPRESFKPRREYQKGPIPMEGLTTSRRDFGPHKVAPVKVHQYDQFVPSEENMDLLTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQPRREPLRLEHKYQPASVRFDNRTTHQDDYPIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFV-HEAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPRGNVPVESQTTYTISFTPKEMGRCLASYPEPP--GYTFEEVDALGHRIYKPVS 447          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Human
Match: SAXO2 (stabilizer of axonemal microtubules 2 [Source:HGNC Symbol;Acc:HGNC:33727])

HSP 1 Score: 177.948 bits (450), Expect = 1.794e-49
Identity = 115/382 (30.10%), Postives = 190/382 (49.74%), Query Frame = 2
Query:  407 DYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYN---SEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLE-PFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPISSTV 1540
            DY P+ + +   H  E Y+P +G++D  + Y    + Y  + V    P++ Q+ +   GK +  PTY++DYR W+L + +  +   T+ PP  +F    T+  D+V  +  P+ S KP      S APF  +T +R  Y+ H LE K + + + ++  +   F+ LTT + DF    G     C+P+       A  +  T  R  ++PWE+  P       Y  P G M +++T   DY  +     + I+P ++ RS   PFQG +  ++ +  W   ++  +    Q   PS  F+G ST  +H++ H L P +SCKP   A+ +S  FDD T+Y +EYT K  + CPA+    P   +I+   ++ GHKF+  I   V
Sbjct:   20 DYCPYEIVKQPRHVPEEYKPKQGKIDLGTTYKRDLNSYKVQPVAIVRPLERQVKK---GKLDTVPTYKDDYRAWDLHKSELYKPEQTYHPPTVKFGNSTTFQDDFVPQEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLELKFE-RPKEVYKPTDQRFEDLTTHRCDFQGLIGETAKLCRPVHTRVTQNALFEGSTEFRESFQPWEIPPPEVKKVPEYVPPTGSMLLNSTSHLDYVPYQANHVVPIRPVSQKRSNNFPFQGKSIMKEDFPAWESCRQGLIKKQQQIPNPSGKFDGLSTFRSHYVPHELIPTESCKPLNIAFKSSVPFDDVTMYSVEYTPKRQEICPASYPSPP--GYIFDNTNSQGHKFFRKIIPAV 395          

HSP 2 Score: 89.7373 bits (221), Expect = 1.310e-18
Identity = 63/248 (25.40%), Postives = 112/248 (45.16%), Query Frame = 2
Query:  290 SEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEY---TEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKP 1024
            + + + + P    P  S KP++V   S+ P +  T+ R+DY+PH L+       E+Y+P + R +D + +  ++     +      P+  ++ +  L  FEG   +R  ++ WE+  P+  + V  + PP        T   DYV Y+A      +P      +  PF+  +  ++ +       +   K +      +  FDGL+TF+  + P E   T SCKPL  AF+S  P    T   ++Y P
Sbjct:  115 TTFQDDFVPQEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLELKFERPKEVYKPTDQRFEDLTTHRCDFQGLIGETAKLCRPVHTRVTQNAL--FEGSTEFRESFQPWEIPPPE-VKKVPEYVPPTGSMLLNSTSHLDYVPYQANHVVPIRPVSQKRSNNFPFQGKSIMKEDFPAWESCRQGLIKKQQQIPNPSGKFDGLSTFRSHYVPHELIPTESCKPLNIAFKSSVPFDDVTMYSVEYTP 359          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Human
Match: SAXO1 (stabilizer of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:28566])

HSP 1 Score: 151.754 bits (382), Expect = 7.670e-40
Identity = 111/381 (29.13%), Postives = 173/381 (45.41%), Query Frame = 2
Query:  392 TTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLG-KFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPIS 1531
            TT+R D+ PH +  VKVH  + + P E  MD  + Y  +Y    V + +PIK +  +     K E  PTY+ DY  W   R +  +    + P   RF+   T+  DY         SCKP         P ED+T+Y+ SYV HP+E +    +   +    +PF+ LTT K+ +    G    S KPLA+      P  + T  R  Y+ W + R        Y  P+  MD+ TT    Y       + + +P  + +    F+G++  +D YK+W+  +   V P  Q   P+ P +  +T  AH++ H     KSCKP       +   +  T Y + +T K +  C A+  E P   + + E D  GH+ Y+P+S
Sbjct:    5 TTSRRDFGPHKVAPVKVHQYDQFVPSEENMDLLTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQPRREPLRLEHKYQPASVRFDNRTTHQDDYPIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFV-HEAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPRGNVPVESQTTYTISFTPKEMGRCLASYPEPP--GYTFEEVDALGHRIYKPVS 382          

HSP 2 Score: 78.1814 bits (191), Expect = 8.007e-15
Identity = 67/241 (27.80%), Postives = 103/241 (42.74%), Query Frame = 2
Query:  338 SCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGK-------FEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKR 1039
            SCKP A+    + PL D T  ++ YV HP+++  VH  E +RP E   +  +     Y   R    EP K     K L +       F     +R+ Y+ W + R   ++  +T+ PP++R + L T  + Y   K AP  SC+P +  +     FE  +  +  Y +         K          P D LTT +  + P     T SCKP     +   P++S TT  I + P E+ R
Sbjct:  122 SCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVHEAEKFRPCEIPFESLTTQKQSY---RGLMGEPAKS---LKPLARPPGLDMPFCNTTEFRDKYQAWPMPR-MFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQ-IKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPRGNVPVESQTTYTISFTPKEMGR 354          

HSP 3 Score: 69.3218 bits (168), Expect = 5.918e-12
Identity = 84/335 (25.07%), Postives = 130/335 (38.81%), Query Frame = 2
Query:  287 LSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQR---VKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGK-FEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPF-------DGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYK------IPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARG-RSLEPFQGTTDYRDSYKKWNMGQ 1237
            L+ Y   Y P+P   V   KP       SD +    T + DY+P    R   +++ H   Y+P   R D+ + +  +Y  K + KT   K   M K      E    Y+  Y    + +         + P +  FE L T    Y G    P  S KP       + PF + T++R  Y   P+          M++K+ + +       D LTT +  +T  +G    SC+P  Q  + G   +  +T + DYK W   R      +P K      +P   +D  TT    Y  H  + + + KP   G R   P +  T Y  S+    MG+
Sbjct:   37 LTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQPRREPLRLEHK--YQPASVRFDNRTTHQDDYPIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEK-RFVHEAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMP--------RMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGR-FEGSSTTKDDYKQWSSMR-----TEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPRGNVPVESQTTYTISFTPKEMGR 354          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Human
Match: SAXO1 (stabilizer of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:28566])

HSP 1 Score: 151.754 bits (382), Expect = 7.670e-40
Identity = 111/381 (29.13%), Postives = 173/381 (45.41%), Query Frame = 2
Query:  392 TTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLG-KFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPIS 1531
            TT+R D+ PH +  VKVH  + + P E  MD  + Y  +Y    V + +PIK +  +     K E  PTY+ DY  W   R +  +    + P   RF+   T+  DY         SCKP         P ED+T+Y+ SYV HP+E +    +   +    +PF+ LTT K+ +    G    S KPLA+      P  + T  R  Y+ W + R        Y  P+  MD+ TT    Y       + + +P  + +    F+G++  +D YK+W+  +   V P  Q   P+ P +  +T  AH++ H     KSCKP       +   +  T Y + +T K +  C A+  E P   + + E D  GH+ Y+P+S
Sbjct:    5 TTSRRDFGPHKVAPVKVHQYDQFVPSEENMDLLTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQPRREPLRLEHKYQPASVRFDNRTTHQDDYPIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFV-HEAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPRGNVPVESQTTYTISFTPKEMGRCLASYPEPP--GYTFEEVDALGHRIYKPVS 382          

HSP 2 Score: 78.1814 bits (191), Expect = 8.007e-15
Identity = 67/241 (27.80%), Postives = 103/241 (42.74%), Query Frame = 2
Query:  338 SCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGK-------FEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKR 1039
            SCKP A+    + PL D T  ++ YV HP+++  VH  E +RP E   +  +     Y   R    EP K     K L +       F     +R+ Y+ W + R   ++  +T+ PP++R + L T  + Y   K AP  SC+P +  +     FE  +  +  Y +         K          P D LTT +  + P     T SCKP     +   P++S TT  I + P E+ R
Sbjct:  122 SCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVHEAEKFRPCEIPFESLTTQKQSY---RGLMGEPAKS---LKPLARPPGLDMPFCNTTEFRDKYQAWPMPR-MFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQ-IKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPRGNVPVESQTTYTISFTPKEMGR 354          

HSP 3 Score: 69.3218 bits (168), Expect = 5.918e-12
Identity = 84/335 (25.07%), Postives = 130/335 (38.81%), Query Frame = 2
Query:  287 LSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQR---VKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGK-FEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPF-------DGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYK------IPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARG-RSLEPFQGTTDYRDSYKKWNMGQ 1237
            L+ Y   Y P+P   V   KP       SD +    T + DY+P    R   +++ H   Y+P   R D+ + +  +Y  K + KT   K   M K      E    Y+  Y    + +         + P +  FE L T    Y G    P  S KP       + PF + T++R  Y   P+          M++K+ + +       D LTT +  +T  +G    SC+P  Q  + G   +  +T + DYK W   R      +P K      +P   +D  TT    Y  H  + + + KP   G R   P +  T Y  S+    MG+
Sbjct:   37 LTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQPRREPLRLEHK--YQPASVRFDNRTTHQDDYPIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEK-RFVHEAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMP--------RMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGR-FEGSSTTKDDYKQWSSMR-----TEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPRGNVPVESQTTYTISFTPKEMGR 354          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Human
Match: SAXO1 (stabilizer of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:28566])

HSP 1 Score: 53.1434 bits (126), Expect = 1.486e-8
Identity = 30/68 (44.12%), Postives = 37/68 (54.41%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPA--VRQTAGPCTLSEYTNKY-TPHPFMPVSSCKPAAVAMHSSDPLSDQTTT 400
            CICE+C+CGRH CPH P     +T  PC LSEYT  Y   H ++P  S KP         P+   TT+
Sbjct:    5 CICELCSCGRHHCPHLPTKIYDKTEKPCLLSEYTENYPFYHSYLPRESFKPRREYQKGPIPMEGLTTS 72          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Celegans
Match: T08G11.3 (pep chromosome:WBcel235:I:8921190:8925327:1 gene:WBGene00011630.1 transcript:T08G11.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T08G11.3)

HSP 1 Score: 79.337 bits (194), Expect = 2.498e-15
Identity = 117/461 (25.38%), Postives = 171/461 (37.09%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPAVRQTAGPC--TLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMR-KDLGKFEGEPTYRNDYRKWELSR--PDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASC--KPDVSALHSEAPFEDMTDYRQSYVKHPLE--GKLK-PKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRK---SCKPDPRAYANSGEFDDGTIYRMEYTQKHVD---PCPAA------------LLESPRARFIYREQDNS 1504
            CIC+IC CGRHKC H  A            +EY  +Y            PA  A                  P   Q    + T +    +G  D T++   +Y EK+V +  P K       D G+F  + T R D++   ++R  P R  T    S     FEG  T+ SD+  YK  P+      P  + L S  PF   T  R  + K   E  G L+ P    M+      F+G TT K D+  K+  + G  +  A A     P    TTN+ DY   + +R                      LR  P +  M S             PF G T  +  Y +  +G+   +         S PF+G +T+ A F +   D ++     + D R  A  G F D T  R ++ +K      P  AA            +L + RA ++ ++ D S
Sbjct:    9 CICQICQCGRHKCDHVDADLGFGNGIEENQTEYGMQY------------PAKQA------------------PRERQAKSRNATFL---SDGDFDGTTINRQDYGEKKVARNAPFKFVNTGPLDSGEFLADTTQRVDFQGKSINRQAPLRPTTNGLQSG---EFEGYTTHKSDF-DYKGDPRTGVIRGPQDAQLFS-GPFNSTTTNRADFDKKQAERSGILRGPTSTNMFGGQ---FNGTTTNKTDYDQKQAERNGIIRGAADAQLFSGPFNGQTTNKSDYDQKQAERSG-------------------ILRG-PTNTEMFS------------GPFNGQTTNKSDYDQKQVGRSEILKGPANTEMFSGPFDGITTNKADFDKKQADRQQRYPRAQNDDRLSA--GSFYDTTTNRADFDRKQASRPMPFKAADDSQLTSSGPFLVLSTNRADYVKKQGDRS 394          

HSP 2 Score: 69.707 bits (169), Expect = 2.837e-12
Identity = 95/407 (23.34%), Postives = 158/407 (38.82%), Query Frame = 2
Query:  341 CKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKV----HHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDL-GKFEGEPTYRNDYRKWELSRPDR---AQTVLTWSPPKERFEGLPTYTSDYVGYKAA-PQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAV--PFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRS--LEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYE 1522
             + AA A   S P + QTT + DY     +R  +     +TEM+  P    +  +   S+Y +K+V ++E +K     +   G F+G  T + D+ K +  R  R   AQ     S     F    T  +D+   +A+ P      D S L S  PF  ++  R  YVK   +  L  ++    +  ++  PF+G +T   DF  K+  K+   +P +                           S +L  P        D  TT   D+ + P+++ + +KPK    S  +  F   T Y D +++ +  + P      + H     F GE+T H+ FI+                                  KHVD CPA  + + R R    ++  +GH++YE
Sbjct:  225 IRGAADAQLFSGPFNGQTTNKSDYDQKQAERSGILRGPTNTEMFSGP---FNGQTTNKSDYDQKQVGRSEILKGPANTEMFSGPFDGITTNKADFDKKQADRQQRYPRAQNDDRLSAGS--FYDTTTNRADFDRKQASRPMPFKAADDSQLTSSGPFLVLSTNRADYVKKQGDRSLPIRNTNDTSTHSINAPFEGESTNHADFQRKQAEKSKLTRPHS---------------------------SSNLLSPNASK---FDATTTTRADFIQKPHVRVINVKPKDDSFSGHVSRFDANTTYHDGFQEKSAEKLPMQRTKDELHVGEGKFYGETTQHSDFIE----------------------------------KHVDICPAEKVLTRRDRSFEFKRTANGHRYYE 562          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Zebrafish
Match: saxo2 (stabilizer of axonemal microtubules 2 [Source:ZFIN;Acc:ZDB-GENE-051127-27])

HSP 1 Score: 224.942 bits (572), Expect = 1.470e-66
Identity = 146/453 (32.23%), Postives = 219/453 (48.34%), Query Frame = 2
Query:  197 TKLCICEICNCGRHKCPHHPAVRQTAGPCT--LSEYTNKYTPHP-FMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIK-HQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGK-LKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKAR-GRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPISST 1537
            T+LCICE+C+CGRH+C H P       P T  LSEY  KY P+       S KP        D +   TT R DY+P+P+          Y+P  G +D  + Y  ++    V    P++  + +     K +  PTY+ D+R+WE+ R +  +   T+ PP  +F    T+  D+V     P+ S KP   A  S+ PFE  T  + SYV HPLE + +KP +   +  S+ PF  +TT ++D+       T SCKP      S  P QS T  R  Y+ W V  P    +  Y  P  +MD+ TT   DY +H     ++ KP +   +S  PFQG T  RD ++ W   ++  +    +   PS   E  +T  AHF+QH   P  S KP              T+YR ++T K +  CPA+  E+P   F++  +D+ GH+F+  ++S+
Sbjct:    4 TRLCICEMCSCGRHRCTHRPTTLYKKDPQTNVLSEYIEKYPPYKGHTRPKSLKPQLKYKAHQDTMDATTTFRTDYIPYPVTHRPEKQQLEYKPKSGEIDLGTTYKQDFNPYEVQPFTPLRPKERVHVVNAKLDTVPTYKEDFRQWEIIRRELTKPDTTYQPPATKFGNSTTFQDDFVHRGLVPRESYKPSNVAKLSDTPFEKNTSNKLSYVPHPLEARYVKPPEE--YKPSSHPFHDVTTHRQDYQGLPSQSTKSCKPEPVKVASNKPFQSSTEFRDQYQHWPVSLPQMQKSVEYTSPTANMDLTTTSHSDYIKHQIQPFVSSKPFSLPAKSSRPFQGNTTMRDDFQPWVAQRQSIIRKQAELQRPSGKMEDLTTFRAHFVQHEAQPSFSFKPQNSPLHTDIPLQADTMYRTDFTPKKISMCPAS-FETPPG-FVFENRDDQGHRFFRKMTSS 452          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Xenopus
Match: vcam1 (vascular cell adhesion molecule 1 [Source:Xenbase;Acc:XB-GENE-492444])

HSP 1 Score: 223.402 bits (568), Expect = 8.079e-66
Identity = 146/470 (31.06%), Postives = 225/470 (47.87%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPA--VRQTAGPCTLSEYTNKYTPH-PFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIK-HQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGR-SLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPISSTVTDLKTGKTFSTRESAYVPIA 1600
            CICEIC CGRH+CPH+P     ++   C L+EY  KY  +    P  S KP          +   TT + DYVP+ +    V   E Y+P  G ++  + YN +Y   R+    PI+     + + G+F+  PTY++D+R WE  + + A+    +  P E+F    T+  D+   +  P+ S KP   A + + PFE  T +R SYV H +E +   + +  +  S+ PF+ LTT + +F    G  T SCKP      S A  +  T  R  ++PW +  P  H +  Y  P   M+  TT   DY  H       I+P   GR S  PFQG++  +D ++ W  G++  +  +     PS  FEG +T  +H+  H ++P +S KP       S  F+  T+YR EYT K  + CPA     P   +++   DN GHK +  I +      T +  +T   A   ++
Sbjct:    5 CICEICTCGRHRCPHNPTHITEKSGKQCVLTEYVEKYPQYDNVQPPKSMKPKQEYSGEHGRMEGITTFKSDYVPYEILNRPVRAHEEYQPKPGSIELGTTYNRDYNPHRLEPVAPIRPVDKGQANPGRFDTNPTYKDDFRPWEFQKRELAKQERVYQAPTEKFGNSTTFQDDFFPKQIMPRESFKPLGVAKNRDIPFEGTTSHRISYVPHEVEPRFV-RQKEEYKPSSQPFEDLTTHRLNFKGAIGEITKSCKPEHGKVGSNAQFEGATEFRDSFQPWSIPAPYVHKSYEYVPPKSHMECDTTTHLDYVPHQLKLVAPIRPVTHGRRSNVPFQGSSTMKDDFRAWEGGRQEMIKRDHLIPKPSGKFEGLTTFKSHYQPHEINPTQSFKPLNMPLRTSVPFEGATMYRSEYTPKKSELCPANYPSPP--GYVFESIDNRGHKIFRKILTPEIKAFTNQNGNTMAKAIAVMS 471          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Xenopus
Match: vcam1 (vascular cell adhesion molecule 1 [Source:Xenbase;Acc:XB-GENE-492444])

HSP 1 Score: 195.282 bits (495), Expect = 2.325e-55
Identity = 137/446 (30.72%), Postives = 209/446 (46.86%), Query Frame = 2
Query:  200 KLCICEICNCGRHKCPHHPAVRQTAGPCTLSEYTNKYTPH-PFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIK-HQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGR-SLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPI 1528
            KL IC  C C R K        ++   C L+EY  KY  +    P  S KP          +   TT + DYVP+ +    V   E Y+P  G ++  + YN +Y   R+    PI+     + + G+F+  PTY++D+R WE  + + A+    +  P E+F    T+  D+   +  P+ S KP   A + + PFE  T +R SYV H +E +   + +  +  S+ PF+ LTT + +F    G  T SCKP      S A  +  T  R  ++PW +  P  H +  Y  P   M+  TT   DY  H       I+P   GR S  PFQG++  +D ++ W  G++  +  +     PS  FEG +T  +H+  H ++P +S KP       S  F+  T+YR EYT K  + CPA     P   +++   DN GHK +  I
Sbjct:    6 KLTIC-TCACKRIKV-------KSGKQCVLTEYVEKYPQYDNVQPPKSMKPKQEYSGEHGRMEGITTFKSDYVPYEILNRPVRAHEEYQPKPGSIELGTTYNRDYNPHRLEPVAPIRPVDKGQANPGRFDTNPTYKDDFRPWEFQKRELAKQERVYQAPTEKFGNSTTFQDDFFPKQIMPRESFKPLGVAKNRDIPFEGTTSHRISYVPHEVEPRFV-RQKEEYKPSSQPFEDLTTHRLNFKGAIGEITKSCKPEHGKVGSNAQFEGATEFRDSFQPWSIPAPYVHKSYEYVPPKSHMECDTTTHLDYVPHQLKLVAPIRPVTHGRRSNVPFQGSSTMKDDFRAWEGGRQEMIKRDHLIPKPSGKFEGLTTFKSHYQPHEINPTQSFKPLNMPLRTSVPFEGATMYRSEYTPKKSELCPANYPSPP--GYVFESIDNRGHKIFRKI 440          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Mouse
Match: Saxo2 (stabilizer of axonemal microtubules 2 [Source:MGI Symbol;Acc:MGI:1914618])

HSP 1 Score: 183.726 bits (465), Expect = 5.910e-52
Identity = 119/392 (30.36%), Postives = 193/392 (49.23%), Query Frame = 2
Query:  380 LSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVP---KTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKL-KPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKA-RGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPISSTV 1540
            L    T   DY P+ + +   H  E Y+P +G++D  + Y  ++   +V    K  P++ Q ++K  GK +  PTY++DYR W++ + +  +    + PP  +F    T+  DYV  +  P+ S KP      S  PF   T +R+ YV H LE K  +PK+  ++  +  PF+ LTT + DF    G     C+P           +  T  R  ++PWE+  P       Y  P G M +++T   DY  +   + +AI+P + R +S  PFQG +  ++ +  W + ++  +    Q   PS  FEG ST  +HF+ H L P +SCKP   A  +S   DD T+Y +++T K  + CPA+    P   +I+   ++ GHKF+  I   V
Sbjct:    6 LCQICTCGSDYRPYEIVKQPRHIPEEYKPKQGKIDLGTTYKRDFNPYKVQPLIKVRPVERQQVKK--GKLDTVPTYKDDYRSWDIQKCELCKPEQAYHPPDVKFGNSTTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKE--IYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQNIQFKGSTEFRDSFQPWEIPPPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQFTPKKQEICPASYPSPP--GYIFENTNSQGHKFFRKIIPAV 391          

HSP 2 Score: 91.2781 bits (225), Expect = 2.843e-19
Identity = 69/272 (25.37%), Postives = 121/272 (44.49%), Query Frame = 2
Query:  212 CEICNCGRHKCPHHPAVRQTAGPCTLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLG-KFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKP 1024
            CE+C   + +  +HP   +     T   + + Y P    P  S KP +V   S  P +  T+ R DYVPH L+       E+Y+P +   +D + + +++        +  +    R     +F+G   +R+ ++ WE+  P + + V  + PP    +   T   DYV Y+A+   + +P      S  PF+  +  ++ +    +  +   K +      +  F+GL+TF+  F P E   T SCKPL +A +S  PL   T   I + P
Sbjct:   91 CELC---KPEQAYHPPDVKFGNSTT---FQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKEIYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQNIQFKGSTEFRDSFQPWEIP-PPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQFTP 355          

HSP 3 Score: 79.337 bits (194), Expect = 2.299e-15
Identity = 83/394 (21.07%), Postives = 160/394 (40.61%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPAVRQ----------TAGPCTL-SEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEM-YRPPEGRMDDTSVYNSEYTEKRVPKTEPIK-HQLMRKDLGKFEGEPTYRNDYRKWEL----SRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEG-KLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPD--GDMDMHTTYLRDYPEHPYMKSLAIKPKARG-RSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQ 1324
            C+C+IC CG    P+   V+Q            G   L + Y   + P+   P+   +P          L    T + DY    +Q+ ++   E  Y PP+ +  +++ +  +Y  + +   +  K   +++  +G F G+ ++R DY   +L    +RP        + P  + FE L T+ +D+ G        C+P  + +     F+  T++R S+   P E    K K  A +   +      +T   D+ P +  +  + +P++   QS  P Q  +T + D+  WE+ R    +    +IP+  G  +  +T+   +  H  + + + KP     +S  P    T Y   +      ++  + P     PP   FE  ++    F +
Sbjct:    5 CLCQICTCGSDYRPYE-IVKQPRHIPEEYKPKQGKIDLGTTYKRDFNPYKVQPLIKVRPVERQQVKKGKLDTVPTYKDDYRSWDIQKCELCKPEQAYHPPDVKFGNSTTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKE-----IYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQNIQFKGSTEFRDSF--QPWEIPPPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEICR-QGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQF----TPKKQEICPASYPSPPGYIFENTNSQGHKFFR 385          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Mouse
Match: Saxo1 (stabilizer of axonemal microtubules 1 [Source:MGI Symbol;Acc:MGI:1923061])

HSP 1 Score: 172.94 bits (437), Expect = 4.100e-47
Identity = 127/453 (28.04%), Postives = 200/453 (44.15%), Query Frame = 2
Query:  194 GTKLCICEICNCGRHKCPHHPA--VRQTAGPCTLSEYTNKYTPH-PFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGK--FEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPISST 1537
            G + CIC +C+CGRH+CPH P     +T     LSEYT  Y  +  ++P +S KP       S P+   TT R D+  H +  V  H  + Y P +  MD  + Y  ++          IK +  +   G    +  PTY+ DY  W   R +  +    + P   +FE   T+  DY         SCKP   +     P ED+T+Y+ SYV HP+E +   K+   +    +PF+ LTT K  +    G    S KP A+     AP  + T  +  ++ W   +        Y  P+  MD+ TT    Y       ++  +P    +  + F+ +T  +D +K+W       + P L    P+ P + ++T    F+ HP    ++ KP       +   +  T Y + +T K +  CPA+ +E P   +I+ E D+ GHK Y  IS T
Sbjct:    2 GKRTCICNLCSCGRHRCPHLPTKIYDKTEKTRLLSEYTENYPIYQSYLPRNSFKPEWCYRKPSAPMEGLTTCRRDFGLHKMLPVTFHQPDTYVPSQETMDLLTTYKHDFNYLPTCPVGLIKPRDSKFPNGDKIMQYLPTYKVDYLPWNQPRRELLRPPHKYRPESSKFENRTTHQDDYTMKGLVTTVSCKPPSKSKIYNIPLEDLTNYKMSYVPHPVEKRFV-KEAEKYIPCDIPFENLTTHKESYRGLLGEPAKSTKPPAKFPVHDAPFTNTTEVQEKFQAWPTPQMVPKAPVVYVPPEEKMDLLTTVQTHYKYLKGSPAITCRPVPSIKKSKCFESSTTTKDDFKQWAAVNTKPIRPTLHLSLPAEPLDCQTTTKTCFVAHPPIITENYKPPWVGLRRNIPVEGQTTYSINFTPKDLGKCPASYMEPP--GYIFEEVDSMGHKIYRSISQT 451          
BLAST of Stabilizer of axonemal microtubules 2 vs. UniProt/SwissProt
Match: sp|Q4R7D3|SAXO1_MACFA (Stabilizer of axonemal microtubules 1 OS=Macaca fascicularis OX=9541 GN=SAXO1 PE=2 SV=2)

HSP 1 Score: 202.986 bits (515), Expect = 2.213e-57
Identity = 140/446 (31.39%), Postives = 207/446 (46.41%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPA--VRQTAGPCTLSEYTNKY-TPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDL-GKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPIS 1531
            CICE+C+CGRH CPH P     +T  PC LSEYT  Y   H ++P  S KP       S P+   TT+R D+ PH +  VK H  + + P E  MD  + Y  +Y    V + +PIK +  +     K E  PTY+ DY  W   R    +    + P   RF+   T+  DY         SCKP         P ED+T+Y+ SYV HP+E +    +   +    +PF+ LTT K+ +    G    S KPLA+      P  + T  R  Y+ W   +        Y  P+  MD+ TT    Y     + + + +P  + R    F+G++  +D YK+W+  +   V P  Q   P+ P +  +T  AH++ HP    KSCKP       +   +  T Y + +T K +  C A+  E P   + + E D  GH+ Y+P+S
Sbjct:    5 CICELCSCGRHHCPHLPTKIYDKTEKPCLLSEYTENYPCYHSYLPRESFKPRREYQKGSIPMEGLTTSRRDFGPHKVAPVKAHQYDQFVPSEENMDLLTTYKKDYNPYTVCRVDPIKPRDSKYPYSNKMEYLPTYKADYLPWNQPRRQPLRLEHKYQPASVRFDNRTTHQDDYPIKGLVKTVSCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFV-HEAEKFRPCEIPFESLTTHKQSYRGLMGEPAKSLKPLARPPGLDMPFSNTTEFRDKYQAWPTPQMFSKAPITYVPPEDSMDLLTTVQAHYTYPKGVPARSCRPAPQIRKSGRFEGSSTTKDDYKQWSSMRTEPVKPIPQLDFPTEPLDCLTTTRAHYVPHPPINTKSCKPHWSGPRGNVPVEGQTTYTISFTPKEMSKCLASYPEPP--GYTFEEVDALGHRIYKPVS 447          
BLAST of Stabilizer of axonemal microtubules 2 vs. UniProt/SwissProt
Match: sp|Q8IYX7|SAXO1_HUMAN (Stabilizer of axonemal microtubules 1 OS=Homo sapiens OX=9606 GN=SAXO1 PE=1 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 1.080e-55
Identity = 139/446 (31.17%), Postives = 207/446 (46.41%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPA--VRQTAGPCTLSEYTNKY-TPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLG-KFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPIS 1531
            CICE+C+CGRH CPH P     +T  PC LSEYT  Y   H ++P  S KP         P+   TT+R D+ PH +  VKVH  + + P E  MD  + Y  +Y    V + +PIK +  +     K E  PTY+ DY  W   R +  +    + P   RF+   T+  DY         SCKP         P ED+T+Y+ SYV HP+E +    +   +    +PF+ LTT K+ +    G    S KPLA+      P  + T  R  Y+ W + R        Y  P+  MD+ TT    Y       + + +P  + +    F+G++  +D YK+W+  +   V P  Q   P+ P +  +T  AH++ H     KSCKP       +   +  T Y + +T K +  C A+  E P   + + E D  GH+ Y+P+S
Sbjct:    5 CICELCSCGRHHCPHLPTKIYDKTEKPCLLSEYTENYPFYHSYLPRESFKPRREYQKGPIPMEGLTTSRRDFGPHKVAPVKVHQYDQFVPSEENMDLLTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQPRREPLRLEHKYQPASVRFDNRTTHQDDYPIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFV-HEAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPRGNVPVESQTTYTISFTPKEMGRCLASYPEPP--GYTFEEVDALGHRIYKPVS 447          
BLAST of Stabilizer of axonemal microtubules 2 vs. UniProt/SwissProt
Match: sp|Q8BQB6|SAXO2_MOUSE (Stabilizer of axonemal microtubules 2 OS=Mus musculus OX=10090 GN=Saxo2 PE=2 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 4.134e-51
Identity = 119/392 (30.36%), Postives = 193/392 (49.23%), Query Frame = 2
Query:  380 LSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVP---KTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKL-KPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKA-RGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPISSTV 1540
            L    T   DY P+ + +   H  E Y+P +G++D  + Y  ++   +V    K  P++ Q ++K  GK +  PTY++DYR W++ + +  +    + PP  +F    T+  DYV  +  P+ S KP      S  PF   T +R+ YV H LE K  +PK+  ++  +  PF+ LTT + DF    G     C+P           +  T  R  ++PWE+  P       Y  P G M +++T   DY  +   + +AI+P + R +S  PFQG +  ++ +  W + ++  +    Q   PS  FEG ST  +HF+ H L P +SCKP   A  +S   DD T+Y +++T K  + CPA+    P   +I+   ++ GHKF+  I   V
Sbjct:    6 LCQICTCGSDYRPYEIVKQPRHIPEEYKPKQGKIDLGTTYKRDFNPYKVQPLIKVRPVERQQVKK--GKLDTVPTYKDDYRSWDIQKCELCKPEQAYHPPDVKFGNSTTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKE--IYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQNIQFKGSTEFRDSFQPWEIPPPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQFTPKKQEICPASYPSPP--GYIFENTNSQGHKFFRKIIPAV 391          

HSP 2 Score: 91.2781 bits (225), Expect = 1.989e-18
Identity = 69/272 (25.37%), Postives = 121/272 (44.49%), Query Frame = 2
Query:  212 CEICNCGRHKCPHHPAVRQTAGPCTLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLG-KFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKP 1024
            CE+C   + +  +HP   +     T   + + Y P    P  S KP +V   S  P +  T+ R DYVPH L+       E+Y+P +   +D + + +++        +  +    R     +F+G   +R+ ++ WE+  P + + V  + PP    +   T   DYV Y+A+   + +P      S  PF+  +  ++ +    +  +   K +      +  F+GL+TF+  F P E   T SCKPL +A +S  PL   T   I + P
Sbjct:   91 CELC---KPEQAYHPPDVKFGNSTT---FQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKEIYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQNIQFKGSTEFRDSFQPWEIP-PPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQFTP 355          

HSP 3 Score: 79.337 bits (194), Expect = 1.608e-14
Identity = 83/394 (21.07%), Postives = 160/394 (40.61%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPAVRQ----------TAGPCTL-SEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEM-YRPPEGRMDDTSVYNSEYTEKRVPKTEPIK-HQLMRKDLGKFEGEPTYRNDYRKWEL----SRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEG-KLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPD--GDMDMHTTYLRDYPEHPYMKSLAIKPKARG-RSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQ 1324
            C+C+IC CG    P+   V+Q            G   L + Y   + P+   P+   +P          L    T + DY    +Q+ ++   E  Y PP+ +  +++ +  +Y  + +   +  K   +++  +G F G+ ++R DY   +L    +RP        + P  + FE L T+ +D+ G        C+P  + +     F+  T++R S+   P E    K K  A +   +      +T   D+ P +  +  + +P++   QS  P Q  +T + D+  WE+ R    +    +IP+  G  +  +T+   +  H  + + + KP     +S  P    T Y   +      ++  + P     PP   FE  ++    F +
Sbjct:    5 CLCQICTCGSDYRPYE-IVKQPRHIPEEYKPKQGKIDLGTTYKRDFNPYKVQPLIKVRPVERQQVKKGKLDTVPTYKDDYRSWDIQKCELCKPEQAYHPPDVKFGNSTTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKE-----IYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQNIQFKGSTEFRDSF--QPWEIPPPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEICR-QGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQF----TPKKQEICPASYPSPPGYIFENTNSQGHKFFR 385          
BLAST of Stabilizer of axonemal microtubules 2 vs. UniProt/SwissProt
Match: sp|Q6AYP6|SAXO1_RAT (Stabilizer of axonemal microtubules 1 OS=Rattus norvegicus OX=10116 GN=Saxo1 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.139e-49
Identity = 136/450 (30.22%), Postives = 199/450 (44.22%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPA--VRQTAGPCTLSEYTNKY-TPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLG-KFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPISSTVT 1543
            CIC++C+CG+H CPH P     +T  PC  SEYT KY T   ++P  S KP       + P+   +TT+ D+    +  VK H  E   P +  MD  + YN  Y      +  PIK +  +     K E  PTY+ DY  W   +    +   ++ P   RF+   T+  DY         S KP         P E MT Y+ SYV HP+E +    +   +  S VPFD LTT K  +    G    + KP         P  S+T  R  ++PW   +     +  Y  P+G MD+ TT   DY     + + + +P    +  + F+ +T  R+ +K W   +R  V PN Q      P E  +T+ AH++ H     KSCKP       +   +  T Y   +T K +  CPA+  E P   +I+ E D  GH+ Y P S   +
Sbjct:    5 CICDLCSCGKHHCPHLPTKIYEKTEKPCFFSEYTEKYPTYLSYVPRESFKPKLEYQKVNIPMEGLSTTKRDFGTFNIVPVKHHLPEKATPIQDEMDFLTTYNQHYNYCPANRVNPIKPRDNKHQCNDKMECVPTYKADYLPWNQQKRSSIRPPQSYRPASCRFDHRTTHQDDYPIKNPVDTVSYKPPHGPKLCNIPLESMTSYKSSYVAHPMEKRCV-YEGEKYKPSEVPFDSLTTHKDSYRGLIGEPAKTWKPAPNHPGLDIPFPSNTEFREKFQPWPTPKIVPKESIAYIPPEGKMDLLTTVQADYKCPNGVPAQSCRPVIHLKKSDRFESSTTNREDFKHWANIRREPVKPNHQLKFSDEPMEYMTTNRAHYVPHAPANTKSCKPTWSGPRVNIPLEGQTTYSTSFTPKEIQRCPASYPEPP--GYIFDEVDAVGHRLYRPASGATS 451          
BLAST of Stabilizer of axonemal microtubules 2 vs. UniProt/SwissProt
Match: sp|Q658L1|SAXO2_HUMAN (Stabilizer of axonemal microtubules 2 OS=Homo sapiens OX=9606 GN=SAXO2 PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 8.617e-49
Identity = 115/382 (30.10%), Postives = 190/382 (49.74%), Query Frame = 2
Query:  407 DYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYN---SEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLE-PFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPISSTV 1540
            DY P+ + +   H  E Y+P +G++D  + Y    + Y  + V    P++ Q+ +   GK +  PTY++DYR W+L + +  +   T+ PP  +F    T+  D+V  +  P+ S KP      S APF  +T +R  Y+ H LE K + + + ++  +   F+ LTT + DF    G     C+P+       A  +  T  R  ++PWE+  P       Y  P G M +++T   DY  +     + I+P ++ RS   PFQG +  ++ +  W   ++  +    Q   PS  F+G ST  +H++ H L P +SCKP   A+ +S  FDD T+Y +EYT K  + CPA+    P   +I+   ++ GHKF+  I   V
Sbjct:   20 DYCPYEIVKQPRHVPEEYKPKQGKIDLGTTYKRDLNSYKVQPVAIVRPLERQVKK---GKLDTVPTYKDDYRAWDLHKSELYKPEQTYHPPTVKFGNSTTFQDDFVPQEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLELKFE-RPKEVYKPTDQRFEDLTTHRCDFQGLIGETAKLCRPVHTRVTQNALFEGSTEFRESFQPWEIPPPEVKKVPEYVPPTGSMLLNSTSHLDYVPYQANHVVPIRPVSQKRSNNFPFQGKSIMKEDFPAWESCRQGLIKKQQQIPNPSGKFDGLSTFRSHYVPHELIPTESCKPLNIAFKSSVPFDDVTMYSVEYTPKRQEICPASYPSPP--GYIFDNTNSQGHKFFRKIIPAV 395          

HSP 2 Score: 89.7373 bits (221), Expect = 6.291e-18
Identity = 63/248 (25.40%), Postives = 112/248 (45.16%), Query Frame = 2
Query:  290 SEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEY---TEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKP 1024
            + + + + P    P  S KP++V   S+ P +  T+ R+DY+PH L+       E+Y+P + R +D + +  ++     +      P+  ++ +  L  FEG   +R  ++ WE+  P+  + V  + PP        T   DYV Y+A      +P      +  PF+  +  ++ +       +   K +      +  FDGL+TF+  + P E   T SCKPL  AF+S  P    T   ++Y P
Sbjct:  115 TTFQDDFVPQEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLELKFERPKEVYKPTDQRFEDLTTHRCDFQGLIGETAKLCRPVHTRVTQNAL--FEGSTEFRESFQPWEIPPPE-VKKVPEYVPPTGSMLLNSTSHLDYVPYQANHVVPIRPVSQKRSNNFPFQGKSIMKEDFPAWESCRQGLIKKQQQIPNPSGKFDGLSTFRSHYVPHELIPTESCKPLNIAFKSSVPFDDVTMYSVEYTP 359          
BLAST of Stabilizer of axonemal microtubules 2 vs. TrEMBL
Match: A0A1I8HXT3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028915g2 PE=4 SV=1)

HSP 1 Score: 476.863 bits (1226), Expect = 7.375e-161
Identity = 236/460 (51.30%), Postives = 302/460 (65.65%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPAVRQTAGPCTLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEP----ISSTVTDLKTGKTFST 1573
            CICEICNCGRH+C  HP    + GPCTLSEY NKY  HP  PVSS KPAA       PLSDQTT RVDYVPHPL+R   H  + YR PEG  +DT++Y  +YT+K+  + +PIK ++ R  LG+F+GEPTY++DYR+WEL++PDR     TW PP++ F G+PTY +DYV Y   P AS KP+ +A  S+AP EDMTDYRQSYV HPLE + + ++R  W++ AVPFDG++TF RD+T K        KP A+   S AP   DTT+R+DYKPWE+ RP  H +D Y  P+G +D  TTY++DYP HP ++    K   RG    PF   TDY+D+Y++W MG R   GPN QY P   PFEG+ST  +H++ HPLD R+S KP   A      FD  T+YRMEY  KH +PCPAA LE+  +RF Y+  D  GH+ Y P    + +TVTDL  G+  S 
Sbjct:    9 CICEICNCGRHRCKVHPNRPVSDGPCTLSEYNNKYIQHPMQPVSSYKPAARPAAGDGPLSDQTTNRVDYVPHPLERPHFHQPDQYRQPEGSFEDTTMYKKDYTQKQGDRAQPIKREVKRGALGEFQGEPTYKHDYRQWELTKPDRGGPQNTWQPPRDPFGGIPTYQTDYVPYAVRPTASFKPNEAAKLSQAPLEDMTDYRQSYVPHPLE-RRQERERLGWSRPAVPFDGMSTFTRDYTAKGTAVRAPMKPDARPHASDAPFHDDTTHRVDYKPWELSRPFVHQSDTYVPPEGTIDDTTTYVKDYPAHPLVRQTYSKKPDRGLPSGPFDDATDYKDNYRQWQMGSRVRAGPNQQYQPNPAPFEGQSTTSSHYVPHPLDLRRSFKPTQGAARGEEPFDGTTLYRMEYVPKHTEPCPAAFLETNSSRFRYQGNDERGHQVYVPKDLSVGTTVTDLSNGRVVSV 467          
BLAST of Stabilizer of axonemal microtubules 2 vs. TrEMBL
Match: A0A267F5A9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028915g1 PE=4 SV=1)

HSP 1 Score: 475.322 bits (1222), Expect = 3.307e-160
Identity = 236/460 (51.30%), Postives = 301/460 (65.43%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPAVRQTAGPCTLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEP----ISSTVTDLKTGKTFST 1573
            CICEICNCGRH+C  HP    + GPCTLSEY NKY  HP  PVSS KPAA       PLSDQTT RVDYVPHPL+R   H  + YR PEG  +DT++Y  +YT+K+  + +PIK ++ R  LG+F+GEPTY++DYR+WEL++PDR     TW PP++ F G+PTY +DYV Y   P AS KP+ +A  S+AP EDMTDYRQSYV HPLE + + ++R  W++ AVPFDG++TF RD+T K        KP A+   S AP   DTT+R+DYKPWE+ RP  H +D Y  P+G +D  TTY +DYP HP ++    K   RG    PF   TDY+D+Y++W MG R   GPN QY P   PFEG+ST  +H++ HPLD R+S KP   A      FD  T+YRMEY  KH +PCPAA LE+  +RF Y+  D  GH+ Y P    + +TVTDL  G+  S 
Sbjct:    9 CICEICNCGRHRCKVHPNRPVSDGPCTLSEYNNKYIQHPMQPVSSYKPAARPAAGDGPLSDQTTNRVDYVPHPLERPHFHQPDQYRQPEGSFEDTTMYKKDYTQKQGDRAQPIKREVKRGALGEFQGEPTYKHDYRQWELTKPDRGGPQNTWQPPRDPFGGIPTYQTDYVPYAVRPTASFKPNEAAKLSQAPLEDMTDYRQSYVPHPLE-RRQERERLGWSRPAVPFDGMSTFTRDYTAKGTAVRAPMKPDARPHASDAPFHDDTTHRVDYKPWELSRPFVHQSDTYVPPEGTIDDTTTYGKDYPAHPLVRQTYSKKPDRGLPSGPFDDATDYKDNYRQWQMGSRVRAGPNQQYQPNPAPFEGQSTTSSHYVPHPLDLRRSFKPTQGAARGEEPFDGTTLYRMEYVPKHTEPCPAAFLETNSSRFRYQGNDERGHQVYVPKDLSVGTTVTDLSNGRVVSV 467          
BLAST of Stabilizer of axonemal microtubules 2 vs. TrEMBL
Match: A0A1I8J1J1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030940g1 PE=4 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 1.788e-157
Identity = 226/439 (51.48%), Postives = 295/439 (67.20%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPAVRQTAGPCTLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYE 1522
            CIC+ICNCGRH+C  HP      GPC LSEYTNK+ PH  +PV S KP   A  S  PLSD+TT RVD+VPHPL R K H  E YRPP G+ D  ++Y+ EYTEKR  +  P K ++ R   G+F GEPTY++DYRKW++ + +R++T   W P K  F GLPTYT+DYV +   P  SCKP+  A  S AP E+ TDYRQS+V HPLE + K K+R +WA+ + PFDGL+TF RDFTPK      S KP A AF S AP + DTT+R+D+KPWE++R + H A+PY  P+G +D  TTY++DYP H  ++    +   RG     F   TDY+D++KKW +  R  VGPN  Y P S PFEG+ST  +HF+ HP+D R+S KP   A    G FD  T+YRMEY  KH++PCPAALL++  +R++Y+E D++GHKFY+
Sbjct:    8 CICQICNCGRHRCKLHPNRPIRDGPCQLSEYTNKFIPHAIVPVGSFKPTVRAAGSEGPLSDKTTHRVDFVPHPLDRPKQHQAEQYRPPSGQFDGITMYSKEYTEKRADRAVPAKREVKRGVAGEFRGEPTYKHDYRKWDMPKLERSRTNPQWEPSKTPFGGLPTYTTDYVAHPGRPSTSCKPNEVARMSSAPLENQTDYRQSFVPHPLE-RRKEKERQVWARPSAPFDGLSTFTRDFTPKSAMVRSSMKPDATAFASNAPFKDDTTHRLDFKPWELQRHAVHKAEPYVPPEGHVDGTTTYVKDYPAHKVVRETYTRRPERGLPSGEFNDATDYKDNFKKWALTGREKVGPNQTYQPNSAPFEGQSTTASHFVPHPMDVRRSFKPSQDAARTEGPFDGTTLYRMEYVPKHIEPCPAALLDTETSRYLYKETDDTGHKFYQ 445          
BLAST of Stabilizer of axonemal microtubules 2 vs. TrEMBL
Match: A0A267EE51 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004954g1 PE=4 SV=1)

HSP 1 Score: 443.351 bits (1139), Expect = 5.087e-148
Identity = 222/437 (50.80%), Postives = 286/437 (65.45%), Query Frame = 2
Query:  275 GPCTLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEP----ISSTVTDLKTGKTFST 1573
            GPCTLSEY NKY  HP  PVSS KPAA       PLSDQTT RVDYVPHPL+R   H  + YR PEG  +DT++Y  +YT+K+  + +PIK ++ R  LG+F+GEPTY++DYR+WEL++PDR     TW PP++ F G+PTY +DYV Y   P AS KP+ +A  S+AP EDMTDYRQSYV HPLE + + ++R  W++ AVPFDG++TF RD+T K        KP A+   S AP   DTT+R+DYKPWE+ RP  H +D Y  P+G +D  TTY++DYP HP ++    K   RG    PF   TDY+D+Y++W MG R   GPN QY P   PFEG+ST  +H++ HPLD R+S KP   A      FD  T+YRMEY  KH +PCPAA LE+  +RF Y+  D  GH+ Y P    + +TVTDL  G+  S 
Sbjct:   12 GPCTLSEYNNKYIQHPMQPVSSYKPAARPAAGDGPLSDQTTNRVDYVPHPLERPHFHQPDQYRQPEGSFEDTTMYKKDYTQKQGDRAQPIKREVKRGALGEFQGEPTYKHDYRQWELTKPDRGGPQNTWQPPRDPFGGIPTYQTDYVPYAVRPTASFKPNEAAKLSQAPLEDMTDYRQSYVPHPLE-RRQERERLGWSRPAVPFDGMSTFTRDYTAKGTAVRAPMKPDARPHASDAPFHDDTTHRVDYKPWELSRPFVHQSDTYVPPEGTIDDTTTYVKDYPAHPLVRQTYSKKPDRGLPSGPFDDATDYKDNYRQWQMGSRVRAGPNQQYQPNPAPFEGQSTTSSHYVPHPLDLRRSFKPTQGAARGEEPFDGTTLYRMEYVPKHTEPCPAAFLETNSSRFRYQGNDERGHQVYVPKDLSVGTTVTDLSNGRVVSV 447          
BLAST of Stabilizer of axonemal microtubules 2 vs. TrEMBL
Match: A0A267GHI9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030145g1 PE=4 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 5.638e-140
Identity = 209/402 (51.99%), Postives = 267/402 (66.42%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPAVRQTAGPCTLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYR 1411
            CICEICNCGRH+C  HP    + GPCTLSEY NKY  HP  PVSS KPAA       PLSDQTT RVDYVPHPL+R   H  + YR PEG  +DT++Y  +YT+K+  + +PIK ++ R  LG+F+GEPTY++DYR+WEL++PDR     TW PP++ F G+PTY +DYV Y   P AS KP+ +A  S+AP EDMTDYRQSYV HPLE + + ++R  W++ AVPFDG++TF RD+T K        KP A+   S AP   DTT+R+DYKPWE+ RP  H +D Y  P+G +D  TTY++DYP HP ++    K   RG    PF   TDY+D+Y++W MG R   GPN QY P   PFEG+ST  +H++ HPLD R+S KP   A      FD  T+YR
Sbjct:    9 CICEICNCGRHRCKVHPNRPVSDGPCTLSEYNNKYIQHPMQPVSSYKPAARPAAGDGPLSDQTTNRVDYVPHPLERPHFHQPDQYRQPEGSFEDTTMYKKDYTQKQGDRAQPIKREVKRGALGEFQGEPTYKHDYRQWELTKPDRGGPQNTWQPPRDPFGGIPTYQTDYVPYAVRPTASFKPNEAAKLSQAPLEDMTDYRQSYVPHPLE-RRQERERLGWSRPAVPFDGMSTFTRDYTAKGTAVRAPMKPDARPHASDAPFHDDTTHRVDYKPWELSRPFVHQSDTYVPPEGTIDDTTTYVKDYPAHPLVRQTYSKKPDRGLPSGPFDDATDYKDNYRQWQMGSRVRAGPNQQYQPNPAPFEGQSTTSSHYVPHPLDLRRSFKPTQGAARGEEPFDGTTLYR 409          

HSP 2 Score: 88.9669 bits (219), Expect = 4.667e-15
Identity = 51/162 (31.48%), Postives = 79/162 (48.77%), Query Frame = 2
Query:  938 TGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYT 1423
              S KP A+      PL   TTNR+DY P  ++RP  H  D Y+ P+G  +  T Y +DY +    ++  IK + +  +L  FQG   Y+  Y++W + +    GP   + PP  PF G  T+   ++ + + P  S KP+  A  +    +D T YR  Y 
Sbjct:   51 VSSYKPAARPAAGDGPLSDQTTNRVDYVPHPLERPHFHQPDQYRQPEGSFEDTTMYKKDYTQKQGDRAQPIKREVKRGALGEFQGEPTYKHDYRQWELTKPDRGGPQNTWQPPRDPFGGIPTYQTDYVPYAVRPTASFKPNEAAKLSQAPLEDMTDYRQSYV 212          

HSP 3 Score: 82.4185 bits (202), Expect = 5.763e-13
Identity = 71/251 (28.29%), Postives = 113/251 (45.02%), Query Frame = 2
Query:  689 LPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGA--PLQSDTTNRIDYKPWEVKRPS----HHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGR-SLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEY 1420
            L  Y + Y+ +   P +S KP       + P  D T  R  YV HPLE +        + +    F+  T +K+D+T K+G +    +P+ +  + GA    Q + T + DY+ WE+ +P      +   P + P G +    TY  DY  +    + + KP    + S  P +  TDYR SY    + +R      L +  P+VPF+G ST    +       R   KPD R +A+   F D T +R++Y
Sbjct:   36 LSEYNNKYIQHPMQPVSSYKPAARPAAGDGPLSDQTTNRVDYVPHPLE-RPHFHQPDQYRQPEGSFEDTTMYKKDYTQKQGDR---AQPIKREVKRGALGEFQGEPTYKHDYRQWELTKPDRGGPQNTWQPPRDPFGGI---PTYQTDYVPYAVRPTASFKPNEAAKLSQAPLEDMTDYRQSYVPHPLERR-QERERLGWSRPAVPFDGMSTFTRDYTAKGTAVRAPMKPDARPHASDAPFHDDTTHRVDY 278          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Cavefish
Match: saxo2 (stabilizer of axonemal microtubules 2 [Source:NCBI gene;Acc:103022203])

HSP 1 Score: 219.55 bits (558), Expect = 1.422e-64
Identity = 148/455 (32.53%), Postives = 219/455 (48.13%), Query Frame = 2
Query:  200 KLCICEICNCGRHKCPHHPAV--RQTAGPCTLSEYTNKYTPHPF-MPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLM-RKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKAR-GRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPP------SVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPIS 1531
            +LC+CEICNCGRH+CPH P V  R+ +    ++EY  K+  H    P    KP          +   TT + D++P+ + R        Y+P  G +D  + Y  ++   ++    P+K ++M R   GK    PTY+ D+R WE+ + + ++   T+ PP  +F    T+  D+V      + S KP   A  ++APFE +T  + SY+ HP+E +   K    +  S+ PF  LTT ++D+    G    S KP      S AP QS T  R  ++ W V  P  H +  Y  P  DMD+ TT    Y +H     ++IKP  +  RS  PF   T  +D +K W   +R        +H P      S   E  +T  AHFIQHPL P  S KP           ++ T YR ++T K V  CPA+  ESP   FI++  D  GH+F+  +S
Sbjct:    3 RLCVCEICNCGRHRCPHQPTVLYRKGSEGYAVTEYVEKFPAHESRQPPKILKPKYEYTADRGKMEGTTTFKSDFIPYEVSRRPGKQQAEYQPNPGEIDLGTTYKQDFNPYQLQPVTPLKPKVMIRPTSGKLNAVPTYKEDFRAWEIPKRELSKPDETYHPPPGKFGNTTTFQDDFVPRGPVLRESFKPLNVAKQNDAPFEGVTSNQLSYIPHPVEARFI-KAPEEYKPSSQPFQDLTTHRKDYQGISGPMPKSFKPERVKISSEAPFQSSTEFRERFQQWPVSLPQVHKSVEYVSPTADMDLTTTTKTTYIKHKVQPFISIKPFPKPNRSPAPFHSNTTMKDDFKPWVTARRLST-----FHKPEEIQRASGKMEDLTTFRAHFIQHPLQPNISYKPAAAPPRTDVPLEESTSYRTDFTPKKVSVCPAS-FESPPG-FIFQNSDERGHRFFRRVS 449          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Cavefish
Match: ENSAMXT00000002606.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:25802480:25804640:1 gene:ENSAMXG00000002546.2 transcript:ENSAMXT00000002606.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 1.818e-14
Identity = 75/302 (24.83%), Postives = 133/302 (44.04%), Query Frame = 2
Query:  380 LSDQTTTRVDYVP-HPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPT--------YRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKA-APQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKP--KARGRSLEPFQGTTDYRDSYKKWNMGQRPHV 1249
            + ++TT R+DYVP H ++R      ++Y PP+G M  TS Y  +Y E +V K       L+ K   K+   PT        Y+  ++ W + R    +        + +F    T+  DY    + +P+ + KP ++ +    PF+  T+Y+ +Y+ HP++ + KPK +     SA  F G +T+K+DF   +G +T + KP+                                      P G+MD  +T   DY  H   +   ++P   A  +  +PFQGT+  ++ Y+ W+   +  +
Sbjct:    1 MENKTTFRLDYVPHHVIRRSPKAGKQLYIPPDGTMMLTSTYTEDYREHQVQKL------LVNKKTEKY-CNPTAKMAPMSLYKEQFKPWCVERLRPFKITDNLQLNQGKFVNTTTFQDDYSAKGSTSPRKNFKP-ITQIVESLPFDGTTNYKLNYITHPVQSR-KPKTKKYRPPSA-SFHGESTYKQDF---KGLRTEAPKPIK-------------------------------------PVGNMDFLSTTHADYVAHKCQRIQRVEPLIHAWEKVKKPFQGTSVMKEDYQPWDAAHQTSI 252          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Sea Lamprey
Match: saxo2 (stabilizer of axonemal microtubules 2 [Source:ZFIN;Acc:ZDB-GENE-051127-27])

HSP 1 Score: 179.489 bits (454), Expect = 1.812e-50
Identity = 139/441 (31.52%), Postives = 207/441 (46.94%), Query Frame = 2
Query:  233 RHKCPHHPA--VRQTAGPCTLSEYTNKYTPHPFM-PVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIK-HQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFT---PKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLE-PFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPIS 1531
            RH+CPH P     QT  PC ++EY ++Y  +    P  S +P  +       +   TT R DY+P+   +  V   E Y+P  G M   + Y +++ E  +    P +  +   +  GK +  PTY+NDYR+WE+ + + A+   T+ P   ++  + T+  DY   +  P  S KP      SE  FED T +R +YV H LE +   ++   +  S   FD LTTF+RDF    P+E  K  S KP      S       T     +K W +  P       Y  P G MD  TT   DY +H   + L  +P +R R L  PF G T  R++YK W   + P +    Q       F+  +T   H++  PL P  S KP   A  +S  F+ GT+YR EYT K V  CPA+  +     + ++E+D  GH ++  +S
Sbjct:    1 RHRCPHQPTGIYTQTEKPCLITEYVDRYHEYGLGGPRESFRPQHMYQGPQGKMDGITTFRADYIPYEAGKRPVRPVEAYKPVPGTMSMDTTYKTDFNEMPIHLVLPARPMENQHQAHGKMDTIPTYQNDYRQWEILKRENAKPNYTYVPSTNKYGYMTTFQDDYHAKQGGPSTSFKPANVMKPSEGAFEDRTTHRSAYVPHQLEARFA-REPERYKPSTQQFDSLTTFRRDFQSLGPQEPVK--SFKPEHVKVGSDDKFNDSTEFNDKFKVWPLSPPPVRKQAMYHPPTGTMDTTTTSHDDYVQHRQERILLARPISRDRRLSLPFDGHTTMREAYKPWAAQREPMIKHVEQMQRSLGKFDDMTTFREHYVPLPLIPMHSYKPKGGAVRSSAPFESGTMYRSEYTPKKVAVCPASYPQP--LGYAFQEKDTRGHLYFRRLS 436          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Nematostella
Match: EDO43170 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN3])

HSP 1 Score: 160.614 bits (405), Expect = 1.096e-43
Identity = 126/419 (30.07%), Postives = 184/419 (43.91%), Query Frame = 2
Query:  233 RHKCPHHPAVRQTAGPCTLSEYTNKYTPHPFMPVSS-CKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGK-FEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKE------RFEGLPTYTSDYVGYKAAPQASCKPDVSALHSE-APFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARG-RSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALL 1459
            RH+C H P  R     C  +EY ++Y  HPF   +   KP      S  PL D+T  R+DYV H     K    + +  P+GR++D S Y  +Y  + V   E  K     +   K F+G   +++ +R W+L+       V +  P  +      R +G   + +D+ G+    + + +P  S L +   P E+ T  R  Y K  +      K       +  PF G+TT + DF  K G    S KP   A QS AP +  TT R  Y  W + +      + Y+ P G     TT+  DYPE     + + +P  +   S +PFQ +T + D+YKKW +   P       Y PPS  FEGEST  +HF        K  + +    A SG  D  T Y   +   H  PCPAA +
Sbjct:    2 RHRCAHRPETRGPTHKCLFTEYQDRYKDHPFGERTKPIKPDRSVRISDAPLEDRTHYRLDYVSHKYAPPKKREKDRWIKPDGRVEDESTYKHDYPGRMVAPAESAKPACTYQPHDKPFQGSTVHQDTFRPWDLN----LSRVKSMKPDTQSMARDGRMDGRTIHQTDFPGHSVPRRPAIRPPNSDLRANCGPMENDTTTRLDYTKKQILPAQSAKPVYRRPSTGPPFQGITTCQHDFGYKTGRPAASFKPQQGAQQSNAPFEDSTTTRESYPKWAIPKRQMREKEAYRPPSGKFKDDTTFRHDYPEWNVGPAQSARPPVQSFASNQPFQDSTTHSDTYKKWAVQAVPKSTKPEGYRPPSRKFEGESTMQSHFRGQYGPRSKPVRQEMNRPATSGPMDLHTTYDDTFKGLHPPPCPAATI 416          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Nematostella
Match: EDO36385 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIR4])

HSP 1 Score: 92.4337 bits (228), Expect = 7.160e-20
Identity = 100/452 (22.12%), Postives = 180/452 (39.82%), Query Frame = 2
Query:  233 RHKCPHHPA------VRQTAGPCTLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVP--KTEP-IKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCK-PDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTP-KEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGP-----------NLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYE 1522
            RH+CPH  +       ++    C+++EY   Y           +P  + +H    + D TT++  Y+ H +   K    E Y P   R +  S     Y   R P  +  P +K   MR    + +   T   DYR W+    ++     T++PP++ F     +  D+V +   P+ + + PD   +      +  T     +    +  K++ K R  +     PF   + FK D+   +   K    +P++  F +  P+Q +TT   D++ W V+       + Y+ PDG+++  TT + DY    + ++     K R R+   F G  D  D    + M  R    P           N  +  PS  F   S     + +  + P K  K +   +  + +    T+Y  ++    V  CP   L+   A F ++ +  +GHK +E
Sbjct:   69 RHRCPHGSSDPNRVINKEREDKCSVTEYKGNYHRKSAQRGPFHRPRDL-LHPEGDIPDNTTSKTSYITHEVSPPKKKEPEKYVPNPNRFETVSENKDHYRGSRAPPARMNPYLKGITMRVPSAQIQYMSTSHGDYRTWKPEPLEKISRSKTYAPPEQPFNETSIHRQDFVRFNQPPRPTARQPD--KIRMSGSMDKTTTNLTYFTPKEIPPKME-KKRDEYVAPEQPFSSTSIFKTDYQDFRNAPKAAMYRPISDLFATDKPMQRETTKNADFQQWRVEARKQKSPERYQRPDGEVECKTTTM-DYGS--FGRNAQPAKKTRPRTKLRF-GREDALDDSTNYGMSFRWVANPVAHHSKGPAVINEIFPKPSTSFNETSEFVDRYKRFNVVPSKMYKDNSTLFKTNDKLAKDTVYNGDFDWPDVK-CPCDRLQKGSAEFTFQHETEAGHKIFE 511          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Nematostella
Match: EDO48878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM3])

HSP 1 Score: 56.6102 bits (135), Expect = 1.619e-8
Identity = 106/473 (22.41%), Postives = 177/473 (37.42%), Query Frame = 2
Query:  206 CICEICNCGRH----KCPHHPAVRQTA----GPCTL-SEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSD-QTTTRVDYVPHPLQRVK-VHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKH--QLMRKDLGKFEGEPTYRNDYRK----------------WELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQA-SCKP--DVSALHSEAPFEDMTDYRQSYVKHPLEGK--LKPKDRAMWAKSAVPFDGLTTFKRDFTPKEG-----GKTGSCKPLAQAFQSGAPLQSDTTN----RIDYKPWEVKRPSHHLADP----YKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGR-SLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQ----YHPPSVPFEGESTHHAHFIQHPLD--------PRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPC 1444
            C+CE+C+CGR+     C  +    Q      G   + ++Y   Y  H   P    +P     +   P  D +T  R+ +V   L   K     E Y     ++D  + YN EY ++  P    +     +  K   KF+GE T+   +                    +  PD+   + TW+  +E ++G           K AP A +C P  D   +  E      T ++ +Y     EG+  L+ +   +       F G T F+ DF    G      K+    P   + +       +TTN    +I + P  + R    +  P    +  PD  M++ T  + DY +   +K   I+P  R   S   F+G T Y+  +K       PH     +    +H  +V  +  S  H        D        PR + KP+ +     G+  D T+Y+ ++ QK+ D C
Sbjct:   22 CVCELCDCGRYHRHEGCTRNVQKMQQVFKRPGMGQVETDYQATYKSHNAAPRHLRRPLPKLRNPHPPPMDFRTEQRLQFVERELPFTKPCKMMESYTISSSKLDGATEYNQEYKDRGPPSIVHLSRPKTVTSKPEAKFQGETTHNATFTAKKPLPQATYGELPTFTGSILFPDKTSAMKTWN--QEVYKG-----------KYAPVAKTCVPGADQVDIGVEGDHYHTTTHQDTYKTPAHEGRQELQKRKAVISMGKRAKFQGDTQFRSDFPGYHGRMPKPAKSVQPPPATLSLKMNNDQNFETTNNDTFKITWDPKTIGRT--QMMKPEMSTHVNPDLKMEVMTQTMVDYTQKAPVKVPVIRPPTRTEPSNIKFEGETAYQSQFK-------PHENVPFKRYGDFHESAVYLKPISKFHQDGSVTTQDFKGAIGGRPRTTFKPEQQLQMTDGKILDKTVYKADFIQKNQDEC 472          
BLAST of Stabilizer of axonemal microtubules 2 vs. Planmine SMEST
Match: SMESG000009389.1 (SMESG000009389.1)

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 471/476 (98.95%), Postives = 474/476 (99.58%), Query Frame = 2
Query:  179 MPFKNGTKLCICEICNCGRHKCPHHPAVRQTAGPCTLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPISSTVTDLKTGKTFSTRESAYVPIAAS 1606
            MPFKNGTKLCICEICNCGRHKCPHHPAVRQTAGPCT SEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEM+RPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGK GSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYT+KHVDPCPAALLESPRARFIYREQDNSGHKFYEP+SSTVTDLKTGKTFSTRESAYVPIAAS
Sbjct:    1 MPFKNGTKLCICEICNCGRHKCPHHPAVRQTAGPCTFSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMHRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKAGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTKKHVDPCPAALLESPRARFIYREQDNSGHKFYEPVSSTVTDLKTGKTFSTRESAYVPIAAS 476          
BLAST of Stabilizer of axonemal microtubules 2 vs. Planmine SMEST
Match: SMESG000042230.1 (SMESG000042230.1)

HSP 1 Score: 369.777 bits (948), Expect = 1.510e-122
Identity = 196/447 (43.85%), Postives = 258/447 (57.72%), Query Frame = 2
Query:  191 NGTKLCICEICNCGRHKCPHHPAVRQTAGPCTLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAA-PQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYR-EQDNSGHKFYEP 1525
            N + LCIC+IC CGRH CPH P     +GPC LSEYTNKYTPH   PV S KP A    + +PL D+T  R+DYVPH L++  VH  E Y+P EG  +  + Y SE+  K   K    K    R++LGKFEG PTY+ DY  W  S  +       W PP E F G+PTY+SDYV YK+  P+ S +P         PF+DMT+ R+SY++HP+E + K KD++ W +  VPF G +TF  DF  K  G   S KP A A  S  PLQ++TT+  DYKPW V++P  H ++ Y  P+G M   TTYLRD+      + LA +PK    S+  F   T Y D ++KWN+  R   GPN +Y P  +PFE  +TH  HF+  PL  R+S K   + + ++  F+  +IYR EY  K VD CP   + SPRA + +  E DN GH    P
Sbjct:    3 NKSDLCICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQR-KIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSP 448          
BLAST of Stabilizer of axonemal microtubules 2 vs. Planmine SMEST
Match: SMESG000072576.1 (SMESG000072576.1)

HSP 1 Score: 254.988 bits (650), Expect = 3.212e-78
Identity = 162/444 (36.49%), Postives = 231/444 (52.03%), Query Frame = 2
Query:  206 CICEICNCGRHKCPHHPAVRQTAGPCTLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQ-YHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLES-PRA----RFIYREQDNSGHKFY 1519
            CIC+ICNCG+HKCPH        GP   SEY  +Y   P     SCKP    + S  PLS  TT R D+V H +  V     + Y PP   M+D SVY  E+TEK       I+     +D GKFE   T R  Y   ++  P+  ++   + PP E F+   TY SD++ Y  A  +SCKP V++L S+APF  +++ R SYV+H +E + +  ++  + KS  PF+ +TT ++DF P E  K+   KP     +   P  SDTTNR DY     + P     + Y  P+G MDM TTY  ++   P  KS+ I+P     + EPF   T YR +Y+ WN  Q P++  + + Y P + PF+G++T    ++ H +D  +SCKP P        FD  T +R +Y  K    CPAA L + PR+     + Y  +DN GH  +
Sbjct:    8 CICKICNCGKHKCPHKSHPVAGWGPEICSEYGGQYHARPSERPESCKPPYNPILSDCPLSTVTTNRADFVAHDVHPVLKREHQKYEPPCTPMNDQSVYRHEFTEKPHCANRMIRPPATTQDNGKFESATTNRTTYVAHDVCPPE-LRSREQYKPPTEPFDATNTYRSDFIPYDQAKMSSCKPPVTSLKSDAPFNSVSEQRHSYVQHNVEPR-QIAEKIPYVKSDEPFESMTTNRQDFVPMENCKSQLMKPPGHRVECDKPFASDTTNRTDYVAHPSQIPEKFEHEKYVKPEGQMDMRTTYNDNFINQPNCKSMPIRPPITPGNSEPFSSETSYRQNYQNWN--QPPNIVQHREKYTPLTAPFDGQTTSGTSYVAHSIDKPQSCKP-PVTAMEKLPFDGQTTHRTDYVAKCPHVCPAASLSTNPRSISPDGYCYNGEDNDGHLHF 446          
BLAST of Stabilizer of axonemal microtubules 2 vs. Planmine SMEST
Match: SMESG000067500.1 (SMESG000067500.1)

HSP 1 Score: 257.684 bits (657), Expect = 6.436e-77
Identity = 167/449 (37.19%), Postives = 234/449 (52.12%), Query Frame = 2
Query:  233 RHKCPHHPAVRQTAGPCTLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPP-------------KERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQ--YHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLES-PRAR----FIYREQDNSGHKFY 1519
            RH+CPH          C LSEY  +Y PH   P  S KP    M    PLS +TT RVDY+P   +  +      Y  PEG MDDT++Y  E+  K +  T   K    R    KFEGE T R+ Y  + +         + W  P              ++F+G+P+Y  DY+ +  AP  S KP VS + S  P    TDYRQSYV HPLE ++K K+   + ++ VPFD LTT ++++TPKE     S KP     Q+  PL  +TT+R+D+K  +V +P  +  + Y+ P+GD+D+ TTY +DY   P  K++++K K   +   PFQ  T+YRD +K W++   P V P  +  Y PP+ PFE  +T  + F+ H L    S KP P   +    FDD T+YR EYT K    CPA+ L + PR+     +IY  +D  GH  Y
Sbjct:  215 RHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRSCYLLFLILNNCSIGDYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKE-PCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDV---PPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHMLSQEP-FDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHY 658          
BLAST of Stabilizer of axonemal microtubules 2 vs. Planmine SMEST
Match: SMESG000067510.1 (SMESG000067510.1)

HSP 1 Score: 243.047 bits (619), Expect = 7.735e-74
Identity = 158/429 (36.83%), Postives = 225/429 (52.45%), Query Frame = 2
Query:  281 CTLSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPP-------------KERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQ--YHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTQKHVDPCPAALLES-PRAR----FIYREQDNSG 1507
            C LSEY  +Y PH   P  S KP    M    PLS +TT RVDY+P   +  +      Y  PEG M+DT++Y  E+  K +  T   K    R    KFEGE T R+ Y  + +         + W  P              ++F+G+P+Y  DY+ +  AP  S KP VS + S  P    TDYRQSYV HPLE ++K K+   + ++ VPFD LTT ++++TPKE     S KP     Q+  PL  +TT+R+D+K  +V +P  +  + Y+ P+GD+D+ TTY +DY   P  K++++K K   +   PFQ  T+YRD +K W++   P V P  +  Y PP+ PFE  +T  + F+ H L    S K  P   +    FDD T+YR EYT K    CPA+ L + PR+     +IY  +D  G
Sbjct:   10 CNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMEDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRSCYLLFVILNNCSIGDYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKE-PCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDV---PPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKTAPHMLSQEP-FDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARG 433          
The following BLAST results are available for this feature:
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SAXO12.249e-5631.17stabilizer of axonemal microtubules 1 [Source:HGNC... [more]
SAXO21.794e-4930.10stabilizer of axonemal microtubules 2 [Source:HGNC... [more]
SAXO17.670e-4029.13stabilizer of axonemal microtubules 1 [Source:HGNC... [more]
SAXO17.670e-4029.13stabilizer of axonemal microtubules 1 [Source:HGNC... [more]
SAXO11.486e-844.12stabilizer of axonemal microtubules 1 [Source:HGNC... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T08G11.32.498e-1525.38pep chromosome:WBcel235:I:8921190:8925327:1 gene:W... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
saxo21.470e-6632.23stabilizer of axonemal microtubules 2 [Source:ZFIN... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vcam18.079e-6631.06vascular cell adhesion molecule 1 [Source:Xenbase;... [more]
vcam12.325e-5530.72vascular cell adhesion molecule 1 [Source:Xenbase;... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Saxo25.910e-5230.36stabilizer of axonemal microtubules 2 [Source:MGI ... [more]
Saxo14.100e-4728.04stabilizer of axonemal microtubules 1 [Source:MGI ... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4R7D3|SAXO1_MACFA2.213e-5731.39Stabilizer of axonemal microtubules 1 OS=Macaca fa... [more]
sp|Q8IYX7|SAXO1_HUMAN1.080e-5531.17Stabilizer of axonemal microtubules 1 OS=Homo sapi... [more]
sp|Q8BQB6|SAXO2_MOUSE4.134e-5130.36Stabilizer of axonemal microtubules 2 OS=Mus muscu... [more]
sp|Q6AYP6|SAXO1_RAT1.139e-4930.22Stabilizer of axonemal microtubules 1 OS=Rattus no... [more]
sp|Q658L1|SAXO2_HUMAN8.617e-4930.10Stabilizer of axonemal microtubules 2 OS=Homo sapi... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HXT37.375e-16151.30Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F5A93.307e-16051.30Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J1J11.788e-15751.48Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EE515.087e-14850.80Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GHI95.638e-14051.99Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
saxo21.422e-6432.53stabilizer of axonemal microtubules 2 [Source:NCBI... [more]
ENSAMXT00000002606.21.818e-1424.83pep primary_assembly:Astyanax_mexicanus-2.0:16:258... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
saxo21.812e-5031.52stabilizer of axonemal microtubules 2 [Source:ZFIN... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO431701.096e-4330.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363857.160e-2022.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488781.619e-822.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009389.10.000e+098.95SMESG000009389.1[more]
SMESG000042230.11.510e-12243.85SMESG000042230.1[more]
SMESG000072576.13.212e-7836.49SMESG000072576.1[more]
SMESG000067500.16.436e-7737.19SMESG000067500.1[more]
SMESG000067510.17.735e-7436.83SMESG000067510.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035584 ID=SMED30035584|Name=Stabilizer of axonemal microtubules 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1737bp
AACAATATTTGCTTTGATATACTCACATCAACTATACAGCTCAACAACAA
CAACTGATCAATCAAAGCTATTGTTTCAAATGCACATTAATTTCATTGAT
TTGTTATTTAAATTATGAGATTTGTTTAATTGAGCTATTGCTAAGAGACG
AGCTTGACAACAGAATTAGATTTGGAAAATGCCATTCAAAAACGGGACAA
AATTATGCATTTGTGAAATTTGTAATTGTGGACGTCACAAATGTCCTCAT
CATCCGGCTGTGAGACAAACTGCTGGTCCTTGCACGTTGTCAGAATACAC
GAACAAATACACTCCTCATCCATTTATGCCGGTTTCGTCATGCAAGCCGG
CAGCAGTGGCGATGCATTCGAGCGACCCGTTATCGGATCAAACGACAACC
AGGGTTGATTATGTGCCTCATCCGTTGCAGCGTGTCAAGGTGCATCACAC
GGAAATGTACAGGCCACCAGAGGGTAGAATGGATGATACTTCAGTTTACA
ATTCCGAATACACAGAGAAGAGGGTACCGAAAACAGAGCCAATAAAGCAC
CAATTAATGAGAAAAGATCTCGGAAAATTTGAAGGTGAACCAACTTATAG
AAATGACTATAGGAAATGGGAGCTTTCAAGGCCAGATCGTGCTCAAACTG
TGCTGACTTGGTCACCACCGAAAGAAAGGTTCGAAGGCTTACCGACGTAC
ACCTCAGATTATGTTGGATATAAAGCCGCTCCTCAAGCAAGCTGCAAGCC
AGATGTATCTGCGCTACATTCAGAAGCTCCGTTTGAAGATATGACAGATT
ATAGGCAATCTTATGTTAAGCACCCTCTAGAAGGTAAACTCAAACCTAAG
GATAGAGCAATGTGGGCCAAATCAGCCGTTCCTTTTGATGGCTTGACGAC
TTTTAAAAGAGATTTCACTCCAAAAGAAGGAGGAAAGACTGGAAGTTGTA
AGCCTTTAGCACAGGCATTTCAATCAGGCGCTCCTCTTCAATCAGACACT
ACTAATCGGATTGATTACAAACCTTGGGAAGTTAAGAGACCTTCACATCA
TTTGGCAGATCCTTATAAAATTCCTGATGGTGACATGGATATGCATACAA
CCTATCTCAGAGACTATCCTGAACATCCATATATGAAAAGCTTAGCGATA
AAACCAAAAGCTAGAGGCCGAAGTTTAGAACCTTTTCAAGGAACTACCGA
TTACAGAGACAGTTACAAGAAATGGAATATGGGCCAGAGACCACACGTTG
GACCAAATTTACAATATCATCCACCATCAGTTCCATTTGAAGGGGAAAGT
ACTCATCACGCACATTTTATTCAGCATCCTCTGGATCCGAGAAAGTCCTG
TAAACCTGACCCCAGAGCTTACGCCAATTCTGGTGAATTTGACGACGGAA
CCATTTATCGAATGGAATACACTCAAAAACATGTTGACCCATGCCCGGCA
GCACTTCTTGAAAGTCCAAGAGCTAGATTTATTTACAGAGAGCAGGATAA
CAGCGGGCACAAGTTCTATGAGCCTATATCAAGTACGGTCACAGATCTGA
AAACTGGAAAGACTTTTTCCACAAGAGAGTCAGCATATGTCCCCATTGCA
GCATCATGAAAGGGCATCTTTGATGATTACTGGACCATGAATATTTGAAT
GTAGCTGAGCTCTTATACATTTATATCGGATTAGATATTCTTTGATATTG
TTTATTATAATTATATTTATTTATTGATGAAAAAAAA
back to top

protein sequence of SMED30035584-orf-1

>SMED30035584-orf-1 ID=SMED30035584-orf-1|Name=SMED30035584-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=477bp
MPFKNGTKLCICEICNCGRHKCPHHPAVRQTAGPCTLSEYTNKYTPHPFM
PVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMYRPPEGR
MDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELS
RPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEA
PFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKE
GGKTGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPD
GDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWN
MGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYAN
SGEFDDGTIYRMEYTQKHVDPCPAALLESPRARFIYREQDNSGHKFYEPI
SSTVTDLKTGKTFSTRESAYVPIAAS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR033336SAXO1/2
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005814centriole
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005879axonemal microtubule
GO:0031514motile cilium
GO:0036064ciliary basal body
GO:0036126sperm flagellum
GO:0042995cell projection
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
Vocabulary: biological process
TermDefinition
GO:0009631cold acclimation
GO:0030030cell projection organization
GO:0045724positive regulation of cilium assembly
GO:0070417cellular response to cold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR31516:SF13STABILIZER OF AXONEMAL MICROTUBULES 2coord: 5..447
IPR033336Stabilizer of axonemal microtubules 1/2PANTHERPTHR31516FAMILY NOT NAMEDcoord: 5..447