Leucine-rich repeat-containing protein 56

Overview
NameLeucine-rich repeat-containing protein 56
Smed IDSMED30035576
Length (bp)1876
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine-rich repeat-containing protein 56 (SMED30035576) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine-rich repeat-containing protein 56 (SMED30035576) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine-rich repeat-containing protein 56 (SMED30035576) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine-rich repeat-containing protein 56 (SMED30035576) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035576

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035576SMESG000036659.1 SmedASXL_011345SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30035576SMESG000036659.1 dd_Smed_v4_10834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30035576SMESG000036659.1 dd_Smed_v4_10834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30035576SMESG000036659.1 dd_Smed_v4_10834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035576SMESG000036659.1 dd_Smed_v6_10834_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30035576SMESG000036659.1 OX_Smed_1.0.01211ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30035576SMESG000036659.1 Contig34620newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035576SMESG000036659.1 Contig34620uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30035576SMESG000036659.1 dd_Smed_v4_10834_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Human
Match: LRRC56 (leucine rich repeat containing 56 [Source:HGNC Symbol;Acc:HGNC:25430])

HSP 1 Score: 184.882 bits (468), Expect = 1.866e-50
Identity = 95/191 (49.74%), Postives = 133/191 (69.63%), Query Frame = 1
Query:  259 ELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLC-----NP-NKYEAPMTYKQNVIESIPQLEYLDDLPINYCN 813
            +L+EE+LSP +LQAL  VD+L  V  LEM V+T + SLGNFG++LPNL Q+KL+GS++ ++RDLGTSL +LQVLW+ +C L  LDG+ ++  LKELY +YN I+D+S   +LE LE+LDLEGN ++D   + YL +C  L+ LTLEGN +C      P NK      Y+  V + IPQL+ LD++P  +  
Sbjct:   48 QLVEEYLSPARLQALARVDDLRLVRTLEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWLARCGLADLDGIASLPALKELYASYNNISDLSPLCLLEQLEVLDLEGNSVEDLGQVRYLQLCPRLAMLTLEGNLVCLQPAPGPTNKVPRGYNYRAEVRKLIPQLQVLDEVPAAHTG 238          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Human
Match: LRRC56 (leucine rich repeat containing 56 [Source:HGNC Symbol;Acc:HGNC:25430])

HSP 1 Score: 184.496 bits (467), Expect = 2.169e-50
Identity = 95/191 (49.74%), Postives = 133/191 (69.63%), Query Frame = 1
Query:  259 ELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLC-----NP-NKYEAPMTYKQNVIESIPQLEYLDDLPINYCN 813
            +L+EE+LSP +LQAL  VD+L  V  LEM V+T + SLGNFG++LPNL Q+KL+GS++ ++RDLGTSL +LQVLW+ +C L  LDG+ ++  LKELY +YN I+D+S   +LE LE+LDLEGN ++D   + YL +C  L+ LTLEGN +C      P NK      Y+  V + IPQL+ LD++P  +  
Sbjct:   48 QLVEEYLSPARLQALARVDDLRLVRTLEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWLARCGLADLDGIASLPALKELYASYNNISDLSPLCLLEQLEVLDLEGNSVEDLGQVRYLQLCPRLAMLTLEGNLVCLQPAPGPTNKVPRGYNYRAEVRKLIPQLQVLDEVPAAHTG 238          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Human
Match: DRC3 (dynein regulatory complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:25384])

HSP 1 Score: 53.9138 bits (128), Expect = 6.263e-7
Identity = 47/158 (29.75%), Postives = 74/158 (46.84%), Query Frame = 1
Query:  391 LPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSN 864
              NL +++L  + I  I  L  +L +L  L +    +  ++GL T+ NL++L L  N I+ I S   L  L++L L  N ID+  N+ YL     L  L+L  NP+           YK  +   +P L YLD   I+   K  +   H+  I +L +
Sbjct:   64 FENLRKLQLDNNIIEKIEGL-ENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAE------DYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKH 214          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Human
Match: DRC3 (dynein regulatory complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:25384])

HSP 1 Score: 53.9138 bits (128), Expect = 6.263e-7
Identity = 47/158 (29.75%), Postives = 74/158 (46.84%), Query Frame = 1
Query:  391 LPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSN 864
              NL +++L  + I  I  L  +L +L  L +    +  ++GL T+ NL++L L  N I+ I S   L  L++L L  N ID+  N+ YL     L  L+L  NP+           YK  +   +P L YLD   I+   K  +   H+  I +L +
Sbjct:   64 FENLRKLQLDNNIIEKIEGL-ENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAE------DYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKH 214          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Human
Match: DRC3 (dynein regulatory complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:25384])

HSP 1 Score: 53.5286 bits (127), Expect = 8.801e-7
Identity = 47/158 (29.75%), Postives = 74/158 (46.84%), Query Frame = 1
Query:  391 LPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSN 864
              NL +++L  + I  I  L  +L +L  L +    +  ++GL T+ NL++L L  N I+ I S   L  L++L L  N ID+  N+ YL     L  L+L  NP+           YK  +   +P L YLD   I+   K  +   H+  I +L +
Sbjct:   64 FENLRKLQLDNNIIEKIEGL-ENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAE------DYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKH 214          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Celegans
Match: K10D2.8 (pep chromosome:WBcel235:III:5188726:5190175:1 gene:WBGene00189952.1 transcript:K10D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D2.8)

HSP 1 Score: 61.2326 bits (147), Expect = 7.375e-10
Identity = 69/237 (29.11%), Postives = 105/237 (44.30%), Query Frame = 1
Query:  187 INVKVTDYSYGNVNPSPIKLPKDSEL--LEEF-LSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSN----------------------LHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLP 822
            +N+   D SY  +     K+   SEL  LEE  L   K+  + G++    ++YLE   N  Q  + N   +L NL ++ L  + I  I  L   +  L+ L +P   L+ ++GL T++ LK + LA N I  I     L +L+ LDL  N I+   N                      +  L    NL+ LT+E NPL     Y +  TY+  V E +P ++ LD  PI +    P
Sbjct:   93 VNLVFLDVSYNRIT----KIEGLSELINLEELHLVHNKIITIEGLETNTAMKYLEFGDNRIQ-KMENLS-HLVNLERLFLGANQIRKIEGL-DGMAQLKELSLPGNALQIIEGLDTLSGLKSISLAQNGIRKIDGLSGLTNLKSLDLNDNIIEKLENVEQFKGISSLMIRKNKLNCWQDVRQLKKLENLTVLTMEMNPL-----YSSDYTYRNRVKEILPDVKLLDGFPIFWVQGDP 317          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Celegans
Match: C06A8.6 (pep chromosome:WBcel235:II:7772499:7773914:1 gene:WBGene00015516.1 transcript:C06A8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A8.6)

HSP 1 Score: 55.4546 bits (132), Expect = 5.077e-8
Identity = 62/242 (25.62%), Postives = 106/242 (43.80%), Query Frame = 1
Query:  136 FSFNDSNLSGININSQGINVKVTDYSYGNVNPSPIKLPKDSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLES--LEILDLEGNHIDDPSNLHYLAMCSN----------------------LSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLD 789
              F D+ ++ +      +N++  D S+  +      L K ++L   F    K+  + G+D L  +EYLE+  N     + N    L  L ++ L  + I  I ++   L  L VL +P   +  +D +  + NLKE+YLA N I  +  CG+ E   LEILD   N ++   N+H L   ++                      L+ + L+ NP+ + +      TY+  VI  + Q+  LD
Sbjct:   81 LEFYDNQITKVENLDSLVNLESLDLSFNRITKIE-NLEKLTKLKTLFFVHNKITKIEGLDTLTELEYLELGDNR-IAKIENLDNNLK-LDRLFLGANQIRLIENVD-HLKKLTVLSLPANAITVVDNISGLHNLKEIYLAQNGIKYV--CGIDEHLPLEILDFNQNRLEKVENIHQLKTLTDFWARGNKLDNWSIMDELVELPQLNSVYLDFNPIASVD------TYRGKVIHLLQQITRLD 310          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Fly
Match: CG14185 (gene:FBgn0036936 transcript:FBtr0074818)

HSP 1 Score: 86.2705 bits (212), Expect = 9.357e-18
Identity = 54/171 (31.58%), Postives = 84/171 (49.12%), Query Frame = 1
Query:  292 LQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPIN 804
            L+ +T   +LE VE + +RV +  +SL    ++LP L  + LSGS + ++RDLG  L  L  L +  C L   DG   +  ++ L    N I  +     L  L +L    N I +   L +L MC  L  + L+GNP+C       P+ Y+  +  S+P L+ LD   +N
Sbjct:  110 LRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRLQSLDLSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCR-----LPL-YRSLLARSVPTLQLLDGRVLN 274          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Fly
Match: CG10839 (gene:FBgn0028858 transcript:FBtr0343725)

HSP 1 Score: 51.6026 bits (122), Expect = 3.135e-7
Identity = 37/133 (27.82%), Postives = 72/133 (54.14%), Query Frame = 1
Query:  406 QIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMAN-LKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPI 801
            ++ LS + I  I  + + + NL+VL + +  L+ L+G+  +A+ L+EL+++YN I        +++L +  +  N I D +    + +  NLS +T  GNPL N N  ++  T +   +  +P ++ LD  P+
Sbjct:   52 KLSLSSNMIEKITGI-SGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPL-NENMDQSAFTAE--AVRRLPNMKKLDGEPV 180          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Fly
Match: CG10839 (gene:FBgn0028858 transcript:FBtr0305563)

HSP 1 Score: 51.6026 bits (122), Expect = 3.135e-7
Identity = 37/133 (27.82%), Postives = 72/133 (54.14%), Query Frame = 1
Query:  406 QIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMAN-LKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPI 801
            ++ LS + I  I  + + + NL+VL + +  L+ L+G+  +A+ L+EL+++YN I        +++L +  +  N I D +    + +  NLS +T  GNPL N N  ++  T +   +  +P ++ LD  P+
Sbjct:   52 KLSLSSNMIEKITGI-SGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPL-NENMDQSAFTAE--AVRRLPNMKKLDGEPV 180          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Fly
Match: CG10839 (gene:FBgn0028858 transcript:FBtr0080800)

HSP 1 Score: 51.6026 bits (122), Expect = 3.135e-7
Identity = 37/133 (27.82%), Postives = 72/133 (54.14%), Query Frame = 1
Query:  406 QIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMAN-LKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPI 801
            ++ LS + I  I  + + + NL+VL + +  L+ L+G+  +A+ L+EL+++YN I        +++L +  +  N I D +    + +  NLS +T  GNPL N N  ++  T +   +  +P ++ LD  P+
Sbjct:   52 KLSLSSNMIEKITGI-SGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPL-NENMDQSAFTAE--AVRRLPNMKKLDGEPV 180          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Fly
Match: sds22 (gene:FBgn0028992 transcript:FBtr0083436)

HSP 1 Score: 51.2174 bits (121), Expect = 1.479e-6
Identity = 52/197 (26.40%), Postives = 87/197 (44.16%), Query Frame = 1
Query:  289 KLQALTGVDN-LETVEYLEMRVNTDQMSLGNFGM-------YLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNH----------------------IDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLD 789
            KL+ +  V N +  +E L+M  N   + LG+  +        L NL Q+ L  + I  I +L T L NL++L +    +  ++ L  +ANL+ELY++ N +  I +      LE LDL  N                       +DD  ++  L +   L  + LE NPL    +Y + +       + +PQL+ +D
Sbjct:  128 KLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDT-LVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLR------DILPQLQKID 317          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Zebrafish
Match: LRRC56 (si:ch211-103e16.5 [Source:ZFIN;Acc:ZDB-GENE-110913-104])

HSP 1 Score: 170.244 bits (430), Expect = 6.051e-45
Identity = 137/428 (32.01%), Postives = 228/428 (53.27%), Query Frame = 1
Query:  214 YGNVNPSPIKLPKDSE-LLEEF-LSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLC---NPNKYEAP-MTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLAESARSKCSTNXXXXXXXXXXXXXXXXXXXXXXXXXIRPMSS-------QKRAITPGI--SRPGT-SINQRPSTANTLEPEEKADDSNLT--AGKIVCGNITKSLRRHSEENSVNSAPKIKSSDMRPKTCIIKKLQNNT---DPNVDESCEIVLKELGKWRRDYEKSKARIEKQKEPQILTI 1434
            +  +N  P   P  S+ ++++  LS   L+ L+G D+L+ V  LEM V+T Q +L NFG+YLP L Q+K++ S I ++RDLGTSL +LQ+LW+ +C L  L+GL  +++LKELY+AYN I+D+S   MLE+LE+LDLEGN++D+ + L YL  C  L  L+LEGNP+C   +  K EA   +Y+  V E IPQL  LDD+P+            E   S  + +S+L+    W  +   + +S ++ +      +                     +   S IRP S+         R+++  +  +RP T     RP +A ++      + S+LT   G ++CGN  +++R   ++  + ++     S ++P T +   +  +T   + +  +    V  EL  WR ++ K    IEK ++PQ+++I
Sbjct:   22 FCTLNLKPTAEPDHSDKMMDQLCLSLEILKILSGSDDLQEVTSLEMCVDTRQDTLDNFGVYLPKLTQLKMNNSLISSVRDLGTSLSHLQILWLARCSLTDLEGLPALSSLKELYVAYNSISDLSPVSMLENLELLDLEGNNVDELAQLWYLGCCEKLRTLSLEGNPVCTCPDSGKLEASHYSYRSVVRELIPQLNILDDVPV------------ELEKSQCNGSSLLD----WTLLKESIKDSSVIVDLDHRDAAIE-----------------ERSVSESGIRPASALPLDLRNSPRSLSNHLDSARPSTFCTGSRPGSAGSVLAILNHEASDLTNGVGTVLCGNPLQAVRARRQKIKLQNS----QSQIQPSTQLSSYIPEHTYDFEQSSSQDRSDVFAELRSWRIEHNKHLLAIEKDQQPQVMSI 412          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Zebrafish
Match: LRRC56 (si:ch211-103e16.5 [Source:ZFIN;Acc:ZDB-GENE-110913-104])

HSP 1 Score: 157.532 bits (397), Expect = 8.386e-42
Identity = 131/412 (31.80%), Postives = 217/412 (52.67%), Query Frame = 1
Query:  214 YGNVNPSPIKLPKDSE-LLEEF-LSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLC---NPNKYEAP-MTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLAESARSKCSTNXXXXXXXXXXXXXXXXXXXXXXXXXIRPMSS-------QKRAITPGI--SRPGT-SINQRPSTANTLEPEEKADDSNLT--AGKIVCGNITKSLRRHSEENSVNSAPKIKSSDMRPKTCIIKKLQNNT---DPNVDESCEIVLKELGKWRRDYEK 1386
            +  +N  P   P  S+ ++++  LS   L+ L+G D+L+ V  LEM V+T Q +L NFG+YLP L Q+K++ S I ++RDLGTSL +LQ+LW+ +C L  L+GL  +++LKELY+AYN I+D+S   MLE+LE+LDLEGN++D+ + L YL  C  L  L+LEGNP+C   +  K EA   +Y+  V E IPQL  LDD+P+            E   S  + +S+L+    W  +   + +S ++ +      +                     +   S IRP S+         R+++  +  +RP T     RP +A ++      + S+LT   G ++CGN  +++R   ++  + ++     S ++P T +   +  +T   + +  +    V  EL  WR ++ K
Sbjct:   22 FCTLNLKPTAEPDHSDKMMDQLCLSLEILKILSGSDDLQEVTSLEMCVDTRQDTLDNFGVYLPKLTQLKMNNSLISSVRDLGTSLSHLQILWLARCSLTDLEGLPALSSLKELYVAYNSISDLSPVSMLENLELLDLEGNNVDELAQLWYLGCCEKLRTLSLEGNPVCTCPDSGKLEASHYSYRSVVRELIPQLNILDDVPV------------ELEKSQCNGSSLLD----WTLLKESIKDSSVIVDLDHRDAAIE-----------------ERSVSESGIRPASALPLDLRNSPRSLSNHLDSARPSTFCTGSRPGSAGSVLAILNHEASDLTNGVGTVLCGNPLQAVRARRQKIKLQNS----QSQIQPSTQLSSYIPEHTYDFEQSSSQDRSDVFAELRSWRIEHNK 396          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Zebrafish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 60.4622 bits (145), Expect = 3.895e-9
Identity = 56/210 (26.67%), Postives = 104/210 (49.52%), Query Frame = 1
Query:  253 DSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMY-LPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLE 879
            D ++L+  +  ++ +   G+  LE V  LE+R++   + L  + ++   +L +++L  + I  I  L  +L NL  L +    +  ++GL T+  L++L L  N I+ I +   L+ L++L L  N I    N+ YL    +L  L L GNP+C  ++Y      K  V   +P+L YLD   ++   +  +   ++  I ++  N M E
Sbjct:   12 DEQMLQRAVEEQQTRYTEGI-QLEEV--LELRLDYRNI-LKIYHLWSFSSLTKLQLDNNAIERIEGL-ENLTNLTWLDLSFNKIEVIEGLQTLVKLQDLSLFNNRISVIENLDTLQRLQVLSLGNNSIAQLENVIYLRRFQSLRTLNLAGNPICEEDRY------KTFVSAYLPELVYLDYRLLDEQTRETANAKYQYAIEEMRQNEMQE 210          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Zebrafish
Match: cep72 (centrosomal protein 72 [Source:NCBI gene;Acc:553488])

HSP 1 Score: 50.447 bits (119), Expect = 5.270e-6
Identity = 39/137 (28.47%), Postives = 60/137 (43.80%), Query Frame = 1
Query:  391 LPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPI 801
            L ++  + L G+Y   I  LGTSL N                      LK L L+YN +  +     LE LE L+L  N +    ++  L    NL +L L  NP+   + +     Y+  ++ +IP+L  LDD P+
Sbjct:   24 LADVRSLTLPGTYEGKICHLGTSLKNF-------------------VRLKSLDLSYNALVTVQGIEHLELLERLNLYYNRLASLQDIFSLHKLQNLKQLDLRLNPVVKKHPH-----YRLYLVHAIPKLRRLDDCPV 136          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Xenopus
Match: LRRC56 (leucine rich repeat containing 56 [Source:NCBI gene;Acc:100496856])

HSP 1 Score: 232.261 bits (591), Expect = 2.774e-67
Identity = 168/444 (37.84%), Postives = 243/444 (54.73%), Query Frame = 1
Query:  166 ININSQGINVKVTDYSY-GNVNPSPIKLPKDSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFG------MYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLC---NPNKYEAP-MTYKQNVIESIPQLEYLDDLPINYCNK----LPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLAESARSKCSTNXXXXXXXXXXXXXXXXXXXXXXXXXIRPMSSQKRAITPGISRPGTSINQRPSTANTLEPEEKADDSNLTAGKIVCGNITKSLRRHSEENSVNSAPKIKSSDMRPKTCIIKKLQNNTDPNVDESCEIVLKELGKWRRDYEKSKARIEKQKEPQILTIEYSEDE 1452
            +++     +VKVTD  + G +NP P+   +D +L +E L+P KL+ LTGVD+L+ V  L+M VNT + SLGNFG       +LPNL Q+KL+ S + ++RDLGTSL  LQVLW+ QC L  LDG+ ++ +LKELYLAYN++ D+S   MLE+LE+LDLEGN+++    L YLA+CSNL+ LTLEGNP+C   +P   E+P   Y+ +V   IP L  LDD P++   +    +PS D              L  +D+       LV+ GL           N      +     ++    + RP SAIRP S    A+ P  S  G        +    E E++A D     G+++CGN  K+LR   E+    SAP I    +  + C   +L + T+  +D+  E V  EL  WR  +     R +++  PQILTI +SE+E
Sbjct:    6 LDVRPGTASVKVTDLGWQGLLNPFPLNKDEDDDLEDECLTPAKLRLLTGVDDLQEVTTLQMCVNTRENSLGNFGEDYSLGSHLPNLRQLKLNNSILTSVRDLGTSLSQLQVLWLAQCGLTDLDGIASLCSLKELYLAYNDLTDLSELSMLENLEVLDLEGNNLEQIKELQYLALCSNLTTLTLEGNPICTRPSPEAAESPDYNYRADVRSLIPHLRNLDDAPVDQITRASPCMPSPD-------------WLMVKDYIKESTGDLVDVGL----------GNGNLLRKKNQRPATAQPALTGRPHSAIRPAS----AVRPATSDQGPRGLLLTESIEDKEVEDEASDLTHGVGRVICGNPIKALRARKEK--FVSAPVIPLQ-LLSQDC---RLVDTTEAPLDKDHEDVFAELRAWREKHNVVLQRFQEEHTPQILTITHSEEE 416          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Xenopus
Match: lrrc9 (leucine rich repeat containing 9 [Source:NCBI gene;Acc:780204])

HSP 1 Score: 59.3066 bits (142), Expect = 2.062e-8
Identity = 49/143 (34.27%), Postives = 68/143 (47.55%), Query Frame = 1
Query:  388 YLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPL------CNPNKYEAPMTYKQNVIESIPQLEYLDDLP 798
            Y PNL Q+ L G  I  I  L +  + L+ LW+ +C L  + GL   A+L++LYL +NEI+ I     L  LE+L L  N I+    +  L M  NL  L L  N +       +PN     +    N I S  +L  L  LP
Sbjct:   52 YFPNLTQLILVGQNIHCIAGLESCHF-LKELWITECHLSKIQGLHHCADLQKLYLYHNEISVIEGLENLLKLEVLWLNNNQINV---IEGLDMMQNLKELNLANNLIHSIGESLDPNVQLERLNLSGNKISSFKELTNLARLP 190          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Xenopus
Match: lrrc9 (leucine rich repeat containing 9 [Source:NCBI gene;Acc:780204])

HSP 1 Score: 58.9214 bits (141), Expect = 2.302e-8
Identity = 49/143 (34.27%), Postives = 68/143 (47.55%), Query Frame = 1
Query:  388 YLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPL------CNPNKYEAPMTYKQNVIESIPQLEYLDDLP 798
            Y PNL Q+ L G  I  I  L +  + L+ LW+ +C L  + GL   A+L++LYL +NEI+ I     L  LE+L L  N I+    +  L M  NL  L L  N +       +PN     +    N I S  +L  L  LP
Sbjct:   45 YFPNLTQLILVGQNIHCIAGLESCHF-LKELWITECHLSKIQGLHHCADLQKLYLYHNEISVIEGLENLLKLEVLWLNNNQINV---IEGLDMMQNLKELNLANNLIHSIGESLDPNVQLERLNLSGNKISSFKELTNLARLP 183          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Xenopus
Match: lrrc9 (leucine rich repeat containing 9 [Source:NCBI gene;Acc:780204])

HSP 1 Score: 55.0694 bits (131), Expect = 4.013e-7
Identity = 40/105 (38.10%), Postives = 55/105 (52.38%), Query Frame = 1
Query:  388 YLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGN 702
            Y PNL Q+ L G  I  I  L +  + L+ LW+ +C L  + GL   A+L++LYL +NEI+ I     L  LE+L L  N I+    +  L M  NL  L L  N
Sbjct:   64 YFPNLTQLILVGQNIHCIAGLESCHF-LKELWITECHLSKIQGLHHCADLQKLYLYHNEISVIEGLENLLKLEVLWLNNNQINV---IEGLDMMQNLKELNLANN 164          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Xenopus
Match: lrrc9 (leucine rich repeat containing 9 [Source:NCBI gene;Acc:780204])

HSP 1 Score: 55.0694 bits (131), Expect = 4.165e-7
Identity = 40/105 (38.10%), Postives = 54/105 (51.43%), Query Frame = 1
Query:  388 YLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGN 702
            Y PNL Q+ L G  I  I  L +  + L+ LW+ +C L  + GL   A+L++LYL +NEI+ I     L  LE+L L  N I+       L M  NL  L L  N
Sbjct:   64 YFPNLTQLILVGQNIHCIAGLESCHF-LKELWITECHLSKIQGLHHCADLQKLYLYHNEISVIEGLENLLKLEVLWLNNNQINVIEG---LDMMQNLKELNLANN 164          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Mouse
Match: Lrrc56 (leucine rich repeat containing 56 [Source:MGI Symbol;Acc:MGI:1917802])

HSP 1 Score: 181.03 bits (458), Expect = 2.069e-50
Identity = 98/196 (50.00%), Postives = 134/196 (68.37%), Query Frame = 1
Query:  265 LEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLC---NP---NKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDT 834
            +EE LSP +LQAL  VD+L+ V  LEM V+T + SLGNFG+YLPNL Q+KL+ SY+ ++RDLGTSL +LQVLW+ +C L  LDG+ +   LKELY++YN I+D+S   +LE LE+LDLEGN+++D   + YL +C  L+ LTLEGN +C   +P   NK      Y+  V + IPQL  LD++P   C   P+  T
Sbjct:   50 VEERLSPARLQALAQVDDLQLVRVLEMCVDTRKNSLGNFGLYLPNLIQLKLNHSYLGSLRDLGTSLGHLQVLWLARCGLTDLDGIGSFLELKELYVSYNNISDLSPLCLLEQLEVLDLEGNNVEDLGQMRYLQLCPRLAMLTLEGNLVCLKPDPGPSNKAPQGYNYRAEVKKLIPQLHVLDEVPTT-CTSAPAPQT 244          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Mouse
Match: Lrrc56 (leucine rich repeat containing 56 [Source:MGI Symbol;Acc:MGI:1917802])

HSP 1 Score: 181.415 bits (459), Expect = 2.402e-49
Identity = 98/196 (50.00%), Postives = 134/196 (68.37%), Query Frame = 1
Query:  265 LEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLC---NP---NKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDT 834
            +EE LSP +LQAL  VD+L+ V  LEM V+T + SLGNFG+YLPNL Q+KL+ SY+ ++RDLGTSL +LQVLW+ +C L  LDG+ +   LKELY++YN I+D+S   +LE LE+LDLEGN+++D   + YL +C  L+ LTLEGN +C   +P   NK      Y+  V + IPQL  LD++P   C   P+  T
Sbjct:   50 VEERLSPARLQALAQVDDLQLVRVLEMCVDTRKNSLGNFGLYLPNLIQLKLNHSYLGSLRDLGTSLGHLQVLWLARCGLTDLDGIGSFLELKELYVSYNNISDLSPLCLLEQLEVLDLEGNNVEDLGQMRYLQLCPRLAMLTLEGNLVCLKPDPGPSNKAPQGYNYRAEVKKLIPQLHVLDEVPTT-CTSAPAPQT 244          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Mouse
Match: Lrrc56 (leucine rich repeat containing 56 [Source:MGI Symbol;Acc:MGI:1917802])

HSP 1 Score: 181.415 bits (459), Expect = 2.402e-49
Identity = 98/196 (50.00%), Postives = 134/196 (68.37%), Query Frame = 1
Query:  265 LEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLC---NP---NKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDT 834
            +EE LSP +LQAL  VD+L+ V  LEM V+T + SLGNFG+YLPNL Q+KL+ SY+ ++RDLGTSL +LQVLW+ +C L  LDG+ +   LKELY++YN I+D+S   +LE LE+LDLEGN+++D   + YL +C  L+ LTLEGN +C   +P   NK      Y+  V + IPQL  LD++P   C   P+  T
Sbjct:   50 VEERLSPARLQALAQVDDLQLVRVLEMCVDTRKNSLGNFGLYLPNLIQLKLNHSYLGSLRDLGTSLGHLQVLWLARCGLTDLDGIGSFLELKELYVSYNNISDLSPLCLLEQLEVLDLEGNNVEDLGQMRYLQLCPRLAMLTLEGNLVCLKPDPGPSNKAPQGYNYRAEVKKLIPQLHVLDEVPTT-CTSAPAPQT 244          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Mouse
Match: Lrrc56 (leucine rich repeat containing 56 [Source:MGI Symbol;Acc:MGI:1917802])

HSP 1 Score: 68.5514 bits (166), Expect = 1.034e-13
Identity = 39/89 (43.82%), Postives = 58/89 (65.17%), Query Frame = 1
Query:  190 NVKVTDYSYGNVN---PSPIKLPKDSEL-----LEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYI 432
            +++V + S+  +N   P   +L    ++     +EE LSP +LQAL  VD+L+ V  LEM V+T + SLGNFG+YLPNL Q+KL+ SY+
Sbjct:   17 SIRVRELSWQGLNNPHPQNKRLGSHGDIHRERWVEERLSPARLQALAQVDDLQLVRVLEMCVDTRKNSLGNFGLYLPNLIQLKLNHSYL 105          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Mouse
Match: Lrrc9 (leucine rich repeat containing 9 [Source:MGI Symbol;Acc:MGI:1925507])

HSP 1 Score: 55.4546 bits (132), Expect = 2.076e-7
Identity = 53/168 (31.55%), Postives = 76/168 (45.24%), Query Frame = 1
Query:  391 LPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPL------CNPNKYEAPMTYKQNVIESIPQLEYLDDLP--INYCNKLPSGDTHENPISDLSNNS 870
              NL+ + +    I  I  L T L  L+ LW+ +CC+  ++GL    NL++LYL YN+I+ I +   L  LE+L L  N I    N+  L    NL  L L GN +       +PN+    +    N I S   L  L  L    + C   P   +  NP+  L N S
Sbjct:   53 FHNLSSLTIVAQDIREISGLETCL-QLKELWIAECCIEKIEGLQGCRNLEKLYLYYNKISKIENLEKLIKLEVLWLNHNMI---KNIEGLQTLKNLKDLNLAGNLVSSIGRCLDPNEQLEKLNLSGNQITSFKDLTNLTKLTRLKDLCLNDPQYKS--NPVCQLCNYS 214          
BLAST of Leucine-rich repeat-containing protein 56 vs. UniProt/SwissProt
Match: sp|Q8IYG6|LRC56_HUMAN (Leucine-rich repeat-containing protein 56 OS=Homo sapiens OX=9606 GN=LRRC56 PE=1 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 8.963e-50
Identity = 95/191 (49.74%), Postives = 133/191 (69.63%), Query Frame = 1
Query:  259 ELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLC-----NP-NKYEAPMTYKQNVIESIPQLEYLDDLPINYCN 813
            +L+EE+LSP +LQAL  VD+L  V  LEM V+T + SLGNFG++LPNL Q+KL+GS++ ++RDLGTSL +LQVLW+ +C L  LDG+ ++  LKELY +YN I+D+S   +LE LE+LDLEGN ++D   + YL +C  L+ LTLEGN +C      P NK      Y+  V + IPQL+ LD++P  +  
Sbjct:   48 QLVEEYLSPARLQALARVDDLRLVRTLEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWLARCGLADLDGIASLPALKELYASYNNISDLSPLCLLEQLEVLDLEGNSVEDLGQVRYLQLCPRLAMLTLEGNLVCLQPAPGPTNKVPRGYNYRAEVRKLIPQLQVLDEVPAAHTG 238          
BLAST of Leucine-rich repeat-containing protein 56 vs. UniProt/SwissProt
Match: sp|Q4V8C9|LRC56_RAT (Leucine-rich repeat-containing protein 56 OS=Rattus norvegicus OX=10116 GN=Lrrc56 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 2.875e-49
Identity = 135/387 (34.88%), Postives = 190/387 (49.10%), Query Frame = 1
Query:  265 LEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLC---NP---NKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLL-AESARSKCSTNXXXXXXXXXXXXXXXXXXXXXXXXXIRPMSSQKRAITPGISRPGTS-------INQRPSTANTLEPEEKADD--SNLT--AGKIVCGNITKSLRRHSEENSVNSAPKIKSSDMRPKTCIIKKLQNNTDPNVDESCEIVLKELGKWR 1371
            +EE LSP +LQAL  VD+L+ V  LEM V+T + SLGNFGM+LPNL Q+KL+ S + ++RDLGTSL  LQVLW+ +C L  LDG+ +   LKELY++YN I+D+S   +LE LE+LDLEGN+++D   + YL +C  L+ LTLEGN +C   +P   NK      Y+  V + IPQL  LD++P   C  LP+                 +    W  +   + E  +L     R +CS  +                                R   P +  P T        + + P     L     A+D  SNLT   G+++CGN TK LR    +     AP  +    RP   I     +   P+  ESC++ +  L  WR
Sbjct:   50 VEEHLSPARLQALAQVDDLQLVRVLEMCVDTRKNSLGNFGMHLPNLIQLKLNHSCLGSLRDLGTSLGQLQVLWLARCGLTDLDGIGSFLALKELYVSYNNISDLSPLCLLEQLEVLDLEGNNVEDLGQMRYLQLCPRLTTLTLEGNLVCLKPDPGPSNKAPQDYNYRAEVKKLIPQLHILDEVPTT-CTNLPAPQ---------------KLSQDWLMVKEAIKEGNVLDILLPRLECSHGATI------------------------------RKFDPTLPVPETQPWALSLLVPEGPLPEGLLSENPAAEDHASNLTHGPGQVLCGNPTKGLRERRNQYQ-EWAPLEQLPPHRPDLAIRP---STLRPDPAESCDLSMTGLRAWR 386          
BLAST of Leucine-rich repeat-containing protein 56 vs. UniProt/SwissProt
Match: sp|Q8K375|LRC56_MOUSE (Leucine-rich repeat-containing protein 56 OS=Mus musculus OX=10090 GN=Lrrc56 PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 1.680e-48
Identity = 98/196 (50.00%), Postives = 134/196 (68.37%), Query Frame = 1
Query:  265 LEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLC---NP---NKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDT 834
            +EE LSP +LQAL  VD+L+ V  LEM V+T + SLGNFG+YLPNL Q+KL+ SY+ ++RDLGTSL +LQVLW+ +C L  LDG+ +   LKELY++YN I+D+S   +LE LE+LDLEGN+++D   + YL +C  L+ LTLEGN +C   +P   NK      Y+  V + IPQL  LD++P   C   P+  T
Sbjct:   50 VEERLSPARLQALAQVDDLQLVRVLEMCVDTRKNSLGNFGLYLPNLIQLKLNHSYLGSLRDLGTSLGHLQVLWLARCGLTDLDGIGSFLELKELYVSYNNISDLSPLCLLEQLEVLDLEGNNVEDLGQMRYLQLCPRLAMLTLEGNLVCLKPDPGPSNKAPQGYNYRAEVKKLIPQLHVLDEVPTT-CTSAPAPQT 244          
BLAST of Leucine-rich repeat-containing protein 56 vs. UniProt/SwissProt
Match: sp|Q387Y5|LRC56_TRYB2 (Leucine-rich repeat-containing protein 56 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1230 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.773e-13
Identity = 62/235 (26.38%), Postives = 111/235 (47.23%), Query Frame = 1
Query:  292 LQALTGVDNLETVEYLEMRVNTDQMS-LGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMAN-LKELYLAYNEIADISSCGMLES-LEILDLEGNHIDDPSNL-HYLAMCSNLSRLTLEGNPLCNP-------------NKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLAESA 945
            L+ LT   +L++V   + +++   +  + +    +P L  +KL+ S I  +R LGT+  NL+ LW+  C +  + G+   A  L+ELY ++N I+DI +   + S L+++DLEGN I D   L   L     +  L L+GNP+ +                 +  ++Y + +   +P L+YLDD  I+  +   S    +   S   +   +   D + F+   + E G  A  A
Sbjct:  176 LRRLTRCSDLKSVSSAQFQLDFGTLRCVESISARMPQLNSLKLNNSRITELRVLGTNYANLRRLWISNCLVSSVSGVGACAPVLEELYASFNSISDIDALTEVSSTLQVVDLEGNDIRDTDMLKRTLPQLKKMKHLVLKGNPVASSETIVELSHSSEEKGTRQRKVSYSKLIGHLMPDLQYLDDAEISNTSLQKSARVQKKHHSAHVDPLEICIRDEYLFVQECIRECGFDALGA 410          
BLAST of Leucine-rich repeat-containing protein 56 vs. UniProt/SwissProt
Match: sp|A0JM56|LRRC9_XENTR (Leucine-rich repeat-containing protein 9 OS=Xenopus tropicalis OX=8364 GN=lrrc9 PE=2 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 1.047e-7
Identity = 49/143 (34.27%), Postives = 68/143 (47.55%), Query Frame = 1
Query:  388 YLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPL------CNPNKYEAPMTYKQNVIESIPQLEYLDDLP 798
            Y PNL Q+ L G  I  I  L +  + L+ LW+ +C L  + GL   A+L++LYL +NEI+ I     L  LE+L L  N I+    +  L M  NL  L L  N +       +PN     +    N I S  +L  L  LP
Sbjct:   52 YFPNLTQLILVGQNIHCIAGLESCHF-LKELWITECHLSKIQGLHHCADLQKLYLYHNEISVIEGLENLLKLEVLWLNNNQINV---IEGLDMMQNLKELNLANNLIHSIGESLDPNVQLERLNLSGNKISSFKELTNLARLP 190          
BLAST of Leucine-rich repeat-containing protein 56 vs. TrEMBL
Match: A0A267FCI4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007237g2 PE=4 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 1.048e-92
Identity = 198/490 (40.41%), Postives = 279/490 (56.94%), Query Frame = 1
Query:  175 NSQGINVKVTDYSYGNVNPSPIKLPKDSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCN---PNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLAESARSKCSTNXXXXXXXXXXXXXXXXXXXXXX----------XXXIRPMSSQKRAIT----PGIS-RPGTSINQRPSTANTLEPE-----EKADDSNLTAGKIVCGNITKSLRRHSEENSVNSAPKIKSS----------------DMRPKTCI---------------------------IKKLQNNTDPNVDESCEIVLKELGKWRRDYEKSKARIEKQKEPQILTIEYSE 1446
            NS G  VK++  S   VNP P+K+  +S LL++FLSPR+L+ALTGV++LE V  LEM+V+T + SLGNFG++LPNL Q+KLS S IP++RDLG+ L+NL VLWMPQCCL  LDG+ +MA L+ELYL+YNEI D+S CGMLE LEILDLEGN IDD  N+ YL+MCS L +L+LEGNP+C+   P +  A   Y++ V+  +P L+ LDD        +P+G+   NP       + L+F++HWN+INS+L ESG+LA +A S+    S        SS      +S              SA+R  S+QKR +T    PG + RPG+++  RP +A +         +++D+S LTAG +VCGNI+K+LRR     S        S+                + RP+T                              K  +   D   D     +++EL  W+ +YEKS  RI  ++ PQ+L + + E
Sbjct:   23 NSFGKIVKISKISDSVVNPEPMKI-DESVLLDDFLSPRRLRALTGVEDLEKVTQLEMQVDTGEASLGNFGVHLPNLRQLKLSNSIIPSVRDLGSCLFNLSVLWMPQCCLENLDGIASMARLRELYLSYNEIVDVSPCGMLEHLEILDLEGNLIDDIHNVMYLSMCSQLRQLSLEGNPVCSRPGPKEDAAGYNYREEVLRMLPSLQCLDD--------VPTGERDPNP---QLRQATLQFDEHWNYINSLLQESGMLATAASSESLDTSSGIGSTLPSSNRPRTGASTAAASSASLPPRPQSALRMPSAQKRLMTSKGRPGTANRPGSAL-IRPGSAASNASSADDLMDRSDESALTAGTVVCGNISKALRRRRSPQSGGGGSSGASTATAAASSSSLSSPGGFERRPQTAAGAFFARRSAAGFGQQQQRGQQPQQQSRQKITEFKDDETFDRDHAKLVEELKSWKVEYEKSVRRIRSERAPQVLAVTHDE 499          
BLAST of Leucine-rich repeat-containing protein 56 vs. TrEMBL
Match: A0A267EBQ9 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007237g3 PE=4 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 1.177e-92
Identity = 198/490 (40.41%), Postives = 279/490 (56.94%), Query Frame = 1
Query:  175 NSQGINVKVTDYSYGNVNPSPIKLPKDSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCN---PNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLAESARSKCSTNXXXXXXXXXXXXXXXXXXXXXX----------XXXIRPMSSQKRAIT----PGIS-RPGTSINQRPSTANTLEPE-----EKADDSNLTAGKIVCGNITKSLRRHSEENSVNSAPKIKSS----------------DMRPKTCI---------------------------IKKLQNNTDPNVDESCEIVLKELGKWRRDYEKSKARIEKQKEPQILTIEYSE 1446
            NS G  VK++  S   VNP P+K+  +S LL++FLSPR+L+ALTGV++LE V  LEM+V+T + SLGNFG++LPNL Q+KLS S IP++RDLG+ L+NL VLWMPQCCL  LDG+ +MA L+ELYL+YNEI D+S CGMLE LEILDLEGN IDD  N+ YL+MCS L +L+LEGNP+C+   P +  A   Y++ V+  +P L+ LDD        +P+G+   NP       + L+F++HWN+INS+L ESG+LA +A S+    S        SS      +S              SA+R  S+QKR +T    PG + RPG+++  RP +A +         +++D+S LTAG +VCGNI+K+LRR     S        S+                + RP+T                              K  +   D   D     +++EL  W+ +YEKS  RI  ++ PQ+L + + E
Sbjct:   23 NSFGKIVKISKISDSVVNPEPMKI-DESVLLDDFLSPRRLRALTGVEDLEKVTQLEMQVDTGEASLGNFGVHLPNLRQLKLSNSIIPSVRDLGSCLFNLSVLWMPQCCLENLDGIASMARLRELYLSYNEIVDVSPCGMLEHLEILDLEGNLIDDIHNVMYLSMCSQLRQLSLEGNPVCSRPGPKEDAAGYNYREEVLRMLPSLQCLDD--------VPTGERDPNP---QLRQATLQFDEHWNYINSLLQESGMLATAASSESLDTSSGIGSTLPSSNRPRTGASTAAASSASLPPRPQSALRMPSAQKRLMTSKGRPGTANRPGSAL-IRPGSAASNASSADDLMDRSDESALTAGTVVCGNISKALRRRRSPQSGGGGSSGASTATAAAASSSLSSPGGFERRPQTAAGAFFARRSAACFGQQQQRGQQQQQQSRQKITEFKDDETFDRDHAKLVEELKSWKVEYEKSVRRIRSERAPQVLAVTHDE 499          
BLAST of Leucine-rich repeat-containing protein 56 vs. TrEMBL
Match: A0A267GHK5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007237g5 PE=4 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 1.309e-92
Identity = 197/490 (40.20%), Postives = 278/490 (56.73%), Query Frame = 1
Query:  175 NSQGINVKVTDYSYGNVNPSPIKLPKDSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCN---PNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLAESARSKCSTNXXXXXXXXXXXXXXXXXXXXXX----------XXXIRPMSSQKRAIT----PGIS-RPGTSINQRPSTANTLEPE-----EKADDSNLTAGKIVCGNITKSLRRHSEENSVNSAPKIKSS----------------DMRPKTCI---------------------------IKKLQNNTDPNVDESCEIVLKELGKWRRDYEKSKARIEKQKEPQILTIEYSE 1446
            NS G  VK++  S   VNP P+K+  +S LL++FLSPR+L+ALTGV++LE V  LEM+V+T + SLGNFG++LPNL Q+KLS S IP++RDLG+ L+NL VLWMPQCCL  LDG+ +MA L+ELYL+YNEI D+S CGMLE LEILDLEGN IDD  N+ YL+MCS L +L+LEGNP+C+   P +  A   Y++ V+  +P L+ LDD+P           T E  ++     + L+F++HWN+INS+L ESG+LA +A S+    S        SS      +S              SA+R  S+QKR +T    PG + RPG+++  RP +A +         +++D+S LTAG +VCGNI+K+LRR     S        S+                + RP+T                              K  +   D   D     +++EL  W+ +YEKS  RI  ++ PQ+L + + E
Sbjct:   23 NSFGKIVKISKISDSVVNPEPMKI-DESVLLDDFLSPRRLRALTGVEDLEKVTQLEMQVDTGEASLGNFGVHLPNLRQLKLSNSIIPSVRDLGSCLFNLSVLWMPQCCLENLDGIASMARLRELYLSYNEIVDVSPCGMLEHLEILDLEGNLIDDIHNVMYLSMCSQLRQLSLEGNPVCSRPGPKEDAAGYNYREEVLRMLPSLQCLDDVP-----------TGERDLNPQLRQATLQFDEHWNYINSLLQESGMLATAASSESLDTSSGIGSTLPSSNRPRTGASTAAASSASLPPRPQSALRMPSAQKRLMTSKGRPGTANRPGSAL-IRPGSAASNASSADDLMDRSDESALTAGTVVCGNISKALRRRRSPQSGGGGSSGASTATAAASSSSLSSPGGFERRPQTAAGAFFARRSAAGFGQQQQRGQQPQQQSRQKITEFKDDETFDRDHAKLVEELKSWKVEYEKSVRRIRSERAPQVLAVTHDE 499          
BLAST of Leucine-rich repeat-containing protein 56 vs. TrEMBL
Match: A0A1I8GAD8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 1.686e-91
Identity = 177/372 (47.58%), Postives = 244/372 (65.59%), Query Frame = 1
Query:  175 NSQGINVKVTDYSYGNVNPSPIKLPKDSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCN---PNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLAESARSKCSTNXXXXXXXXXXXXXXXXXXXXXX----------XXXIRPMSSQKRAIT----PGIS-RPGTSINQRPSTANTLEPE-----EKADDSNLTAGKIVCGNITKSLRRH 1221
            NS G  VK++  S   VNP P+K+  +S LL++FLSPR+L+ALTGV++LE V  LEM+V+T + SLGNFG++LPNL Q+KLS S IP++RDLG+ L+NL VLWMPQCCL  LDG+ +MA L+ELYL+YNEI D+S CGMLE LEILDLEGN IDD  N+ YL+MCS L +L+LEGNP+C+   P +  A   Y++ V+  +P L+ LDD        +P+G+   NP       + L+F++HWN+INS+L ESG+LA +A S+    S        SS      +S              SA+R  S+QKR +T    PG + RPG+++  RP +A +         +++D+S LTAG +VCGNI+K+LRR 
Sbjct:    8 NSFGKIVKISKISDSVVNPEPMKI-DESVLLDDFLSPRRLRALTGVEDLEKVTQLEMQVDTGEASLGNFGVHLPNLRQLKLSNSIIPSVRDLGSCLFNLSVLWMPQCCLENLDGIASMARLRELYLSYNEIVDVSPCGMLEHLEILDLEGNLIDDIHNVMYLSMCSQLRQLSLEGNPVCSRPGPKEDAAGYNYREEVLRMLPSLQCLDD--------VPTGERDPNP---QLRQATLQFDEHWNYINSLLQESGMLATAASSESLDTSSGIGSTLPSSNRPRTGASTAAASSASLPPRPQSALRMPSAQKRLMTSKGRPGTANRPGSAL-IRPGSAASNASSADDLMDRSDESALTAGTVVCGNISKALRRR 366          
BLAST of Leucine-rich repeat-containing protein 56 vs. TrEMBL
Match: A0A1I8GGK3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 2.392e-90
Identity = 177/372 (47.58%), Postives = 244/372 (65.59%), Query Frame = 1
Query:  175 NSQGINVKVTDYSYGNVNPSPIKLPKDSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCN---PNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLAESARSKCSTNXXXXXXXXXXXXXXXXXXXXXX----------XXXIRPMSSQKRAIT----PGIS-RPGTSINQRPSTANTLEPE-----EKADDSNLTAGKIVCGNITKSLRRH 1221
            NS G  VK++  S   VNP P+K+  +S LL++FLSPR+L+ALTGV++LE V  LEM+V+T + SLGNFG++LPNL Q+KLS S IP++RDLG+ L+NL VLWMPQCCL  LDG+ +MA L+ELYL+YNEI D+S CGMLE LEILDLEGN IDD  N+ YL+MCS L +L+LEGNP+C+   P +  A   Y++ V+  +P L+ LDD        +P+G+   NP       + L+F++HWN+INS+L ESG+LA +A S+    S        SS      +S              SA+R  S+QKR +T    PG + RPG+++  RP +A +         +++D+S LTAG +VCGNI+K+LRR 
Sbjct:    8 NSFGKIVKISKISDSVVNPEPMKI-DESVLLDDFLSPRRLRALTGVEDLEKVTQLEMQVDTGEASLGNFGVHLPNLRQLKLSNSIIPSVRDLGSCLFNLSVLWMPQCCLENLDGIASMARLRELYLSYNEIVDVSPCGMLEHLEILDLEGNLIDDIHNVMYLSMCSQLRQLSLEGNPVCSRPGPKEDAAGYNYREEVLRMLPSLQCLDD--------VPTGERDPNP---QLRQATLQFDEHWNYINSLLQESGMLATAASSESLDTSSGIGSTLPSSNRPRTGASTAAASSASLPPRPQSALRMPSAQKRLMTSKGRPGTANRPGSAL-IRPGSAASNASSADDLMDRSDESALTAGTVVCGNISKALRRR 366          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Cavefish
Match: si:ch211-103e16.5 (leucine rich repeat containing 56 [Source:NCBI gene;Acc:103021834])

HSP 1 Score: 172.555 bits (436), Expect = 1.260e-46
Identity = 140/434 (32.26%), Postives = 222/434 (51.15%), Query Frame = 1
Query:  217 GNVNPSPIKLPKDSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCN---PNKYEAP-MTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLAESARSKCSTNXXXXXXXXXXXXXXXXXXXXXXXXXIRPMSSQKRAITPG-------------ISRP-GTSINQRPSTANTLEPEEKADDSNLTAGK---IVCGNITKSLRRHSEENSVNSAPKIKSSDMRPKTCIIKKLQNNT----DPNVDESCEIVLKELGKWRRDYEKSKARIEKQKEPQILTIEYS 1443
            G +NP P        L E  LSP KL++LTG D+L+ V   EM V+  + +LGNFG+YLP L Q+K++ S I ++RDLGT+L ++QVL + +C L  LDG+ ++ +LKELY+AYN ++D++  GMLE+LE+LDLEGN++DD S + YL +C  L  L+L  NP+C    P+K E P   Y+  V + IPQL  LDD P                            E      ++++ +  +L ES +   S              +S    S       RP S+Q+    PG              +RP  +S + RP +A++ +P+    +S+LT G    + CGN  +++R   ++       ++ +S  RP T +   +  +T    + N  +  + V  EL  WR ++ K    +EK+++PQI+ I + 
Sbjct:   27 GQINPCPATAVDTDPLSEFILSPEKLKSLTGSDDLDQVTTFEMCVDIRENTLGNFGVYLPKLVQLKMNNSLILSVRDLGTTLSHIQVLSLVRCGLADLDGISSLLSLKELYVAYNNVSDLNQVGMLENLELLDLEGNNVDDLSQVQYLGLCGQLRTLSLMRNPVCTCPRPDKPEVPDYNYRAAVRKLIPQLHVLDDAPAE--------------------------EVELRCSSTLMEDETVLTESIKDSASITDTASGSLEDERAASVCGLS-------RPCSAQR----PGTSLSFSSISSRPSTARPLSSSSDSRPGSASS-DPDTLEHESDLTHGVGRILFCGNPVQAVRARRQK----IKHQVTNSHSRPCTQLGTYVPEHTYDVEETNSQDRSD-VFAELRAWREEHSKRLLALEKERQPQIMKIVHG 417          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Cavefish
Match: si:ch211-103e16.5 (leucine rich repeat containing 56 [Source:NCBI gene;Acc:103021834])

HSP 1 Score: 171.014 bits (432), Expect = 4.019e-45
Identity = 146/435 (33.56%), Postives = 229/435 (52.64%), Query Frame = 1
Query:  217 GNVNPSPIKLPKDSELLEEF-LSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCN---PNKYEAP-MTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLA-ESARSKCSTNXXXXXXXXXXXXXXXXXXXXXXXXXIRPMSSQKRAITPGI-------------SRP-GTSINQRPSTANTLEPEEKADDSNLTAGK---IVCGNITKSLRRHSEENSVNSAPKIKSSDMRPKTCIIKKLQNNTDPNVDESCEI----VLKELGKWRRDYEKSKARIEKQKEPQILTIEY 1440
            G +NP P     D++ L EF LSP KL++LTG D+L+ V   EM V+  + +LGNFG+YLP L Q+K++ S I ++RDLGT+L ++QVL + +C L  LDG+ ++ +LKELY+AYN ++D++  GMLE+LE+LDLEGN++DD S + YL +C  L  L+L  NP+C    P+K E P   Y+  V + IPQL  LDD         P+ +      S L  +  +  E   +  +     SG L  E A S C  +                          RP S+Q+    PG              +RP  +S + RP +A++ +P+    +S+LT G    + CGN  +++R   ++       ++ +S  RP T +   +  +T  +V+E+       V  EL  WR ++ K    +EK+++PQI+ I +
Sbjct:   27 GQINPCPATA-VDTDPLSEFILSPEKLKSLTGSDDLDQVTTFEMCVDIRENTLGNFGVYLPKLVQLKMNNSLILSVRDLGTTLSHIQVLSLVRCGLADLDGISSLLSLKELYVAYNNVSDLNQVGMLENLELLDLEGNNVDDLSQVQYLGLCGQLRTLSLMRNPVCTCPRPDKPEVPDYNYRAAVRKLIPQLHVLDDA--------PAEEVELRCSSTLMEDETVLTESIKDSASITDTASGSLEDERAASVCGLS--------------------------RPCSAQR----PGTSLSFSSISSRPSTARPLSSSSDSRPGSASS-DPDTLEHESDLTHGVGRILFCGNPVQAVRARRQKIKH----QVTNSHSRPCTQLGTYVPEHTY-DVEETNSQDRSDVFAELRAWREEHSKRLLALEKERQPQIMKIVH 416          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Cavefish
Match: si:ch211-103e16.5 (leucine rich repeat containing 56 [Source:NCBI gene;Acc:103021834])

HSP 1 Score: 140.584 bits (353), Expect = 6.661e-35
Identity = 126/392 (32.14%), Postives = 202/392 (51.53%), Query Frame = 1
Query:  343 MRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCN---PNKYEAP-MTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLA-ESARSKCSTNXXXXXXXXXXXXXXXXXXXXXXXXXIRPMSSQKRAITPGI-------------SRP-GTSINQRPSTANTLEPEEKADDSNLTAGK---IVCGNITKSLRRHSEENSVNSAPKIKSSDMRPKTCIIKKLQNNTDPNVDESCEI----VLKELGKWRRDYEKSKARIEKQKEPQILTIEY 1440
            M V+  + +LGNFG+YLP L Q+K++ S I ++RDLGT+L ++QVL + +C L  LDG+ ++ +LKELY+AYN ++D++  GMLE+LE+LDLEGN++DD S + YL +C  L  L+L  NP+C    P+K E P   Y+  V + IPQL  LDD         P+ +      S L  +  +  E   +  +     SG L  E A S C  +                          RP S+Q+    PG              +RP  +S + RP +A++ +P+    +S+LT G    + CGN  +++R   ++       ++ +S  RP T +   +  +T  +V+E+       V  EL  WR ++ K    +EK+++PQI+ I +
Sbjct:    1 MCVDIRENTLGNFGVYLPKLVQLKMNNSLILSVRDLGTTLSHIQVLSLVRCGLADLDGISSLLSLKELYVAYNNVSDLNQVGMLENLELLDLEGNNVDDLSQVQYLGLCGQLRTLSLMRNPVCTCPRPDKPEVPDYNYRAAVRKLIPQLHVLDDA--------PAEEVELRCSSTLMEDETVLTESIKDSASITDTASGSLEDERAASVCGLS--------------------------RPCSAQR----PGTSLSFSSISSRPSTARPLSSSSDSRPGSASS-DPDTLEHESDLTHGVGRILFCGNPVQAVRARRQKIKH----QVTNSHSRPCTQLGTYVPEHTY-DVEETNSQDRSDVFAELRAWREEHSKRLLALEKERQPQIMKIVH 348          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Cavefish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 55.0694 bits (131), Expect = 1.393e-7
Identity = 47/154 (30.52%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  331 EYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQC-CLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLD 789
            E +++R+    + + +   +  +L +++L+ + I  I+ L   L NL  LW+     ++ ++GL  +  L+ L L+ N+I  I     LE LEIL L  N I    N+ YL    NL  L L  NP+C          YK  V+  +P L YLD
Sbjct:   33 EVIQLRLEYKILQIDHLWEF-TSLTKLQLNNNSIEKIQGL-EKLTNL--LWLLSFNKIKMIEGLEALVKLQTLSLSNNQIPAIEKMDTLEHLEILSLGENVISQIDNVIYLRRFKNLRSLNLARNPICQET------NYKIFVVAYLPDLVYLD 176          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Cavefish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 55.0694 bits (131), Expect = 1.701e-7
Identity = 47/155 (30.32%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  331 EYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCC--LRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLD 789
            E +++R+   ++   +      +L +++L+ + I  I+ L   L NL  LW+      ++ ++GL  +  L+ L L+ N+I  I     LE LEIL L  N I    N+ YL    NL  L L  NP+C          YK  V+  +P L YLD
Sbjct:   44 EVIQLRLEYKKILQIDHLWEFTSLTKLQLNNNSIEKIQGL-EKLTNL--LWLDLSFNKIKMIEGLEALVKLQTLSLSNNQIPAIEKMDTLEHLEILSLGENVISQIDNVIYLRRFKNLRSLNLARNPICQET------NYKIFVVAYLPDLVYLD 189          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004503.1 (pep scaffold:Pmarinus_7.0:GL476669:33448:48069:1 gene:ENSPMAG00000004103.1 transcript:ENSPMAT00000004503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 1.122e-40
Identity = 90/186 (48.39%), Postives = 124/186 (66.67%), Query Frame = 1
Query:  295 QALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPM------TYKQNVIESIPQLEYLDDLPINYCNKLPSGDT 834
            QALTG +NL+ V  LEM V+T + SLGNFG +LP L  +KL+ S I  IRDLG SL +LQVLWM +C L  L GL ++ +L+ELY+AYN   ++    +LE LE+LDLEGN ++D + +H LA+C +L+ LTLEGNP+C+     AP        Y++ V++ +PQL  LDD P N  + LP+  T
Sbjct:    1 QALTGQENLQEVSTLEMCVDTRESSLGNFGAHLPGLLHLKLNNSTISCIRDLGGSLRHLQVLWMCRCSLVDLHGLSSLPSLRELYIAYNGAHELGPLSLLEELEVLDLEGNGVEDMAQVHALALCPHLACLTLEGNPVCSRASPNAPQPQDPSYEYRRAVLDLLPQLSVLDDRPANERHALPAAAT 186          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005086.1 (pep scaffold:Pmarinus_7.0:GL477410:204878:243212:-1 gene:ENSPMAG00000004613.1 transcript:ENSPMAT00000005086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 4.926e-7
Identity = 40/116 (34.48%), Postives = 63/116 (54.31%), Query Frame = 1
Query:  469 LQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGM-LES---LEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPIN 804
            L+VLW+   C+  ++ L  + +LKEL LA N+I  I S G  L+S   LE L+L GN I     L +L+    L+ L+L+ +PL  P        Y  +++  +PQL  LD + ++
Sbjct:  114 LEVLWLNNNCIAAIENLHCLQHLKELNLADNQIEFIVSKGHSLDSNLELERLNLSGNKISCFKELTHLSRLPALTELSLQ-DPLYAPCSVSLLCNYATHLLYHLPQLRRLDTIDVS 228          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Nematostella
Match: EDO49180 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH85])

HSP 1 Score: 196.438 bits (498), Expect = 3.336e-56
Identity = 134/394 (34.01%), Postives = 207/394 (52.54%), Query Frame = 1
Query:  193 VKVTDYSYGNVNPSPIK--LPKDSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLC---NPNKYE---------------------------------APMTYKQNVIESIPQLEYLDDLP--INYCNKLPSGDTHENPISDLSNNSM-LEFEDH----WNFINSMLVESGLLAESARSKCSTNXXXXXXXXXXXXXXXXXXXXXXXXXIRPMSSQ-KRAITPGISRPGTSINQRPSTANTLEPEEKA-----DDSNLTAG--KIVCGNITKSLR 1215
            V++ +   G VNP PIK    +   L EEFLSP KL++L GV NLE +  LEM VNT + SLGNFG  LPNL ++KLS S I T+RDLGT L NL++LWM +C L  LDG+ ++++L ELYLA+N+I+D+S   ML++L++LDLEGN +D+ + + +L +CS+L  L LEGNP+C   +P+  E                                 A   Y++ V +++P L +LDD P  +   +  P        + D+ +++  +   DH    W+ IN  +    +  +  +   +      +                     RP S+  +R  +    RPG+++ QRP +A   + E  A     D S+LT G  +++CGNI+K+L+
Sbjct:   17 VRIRELDDGYVNPEPIKHEEEEAEHLWEEFLSPAKLKSLAGVRNLEDITQLEMNVNTRENSLGNFGSMLPNLNKLKLSNSIISTVRDLGTCLTNLRMLWMCRCSLSDLDGISSLSSLAELYLAFNDISDVSPVSMLDNLQVLDLEGNLVDEIAQVEFLTLCSSLKCLNLEGNPVCTAPHPDASEEVGVTRVLNSFLMLPGQFSNREIKNKLSNTLDNASYDYRKAVHQAVPSLRFLDDEPFLVEKVDGKPV-------LRDMPDSAKGVRIPDHLITDWHIINEGIKAVDVAEDDEKGTAAVRQRPATTARQ-----------------RPGSAAGQRPGSAMGQRPGSAMGQRPGSAMGSQAEAAAVFQADDSSDLTHGSSEVICGNISKALK 386          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Nematostella
Match: EDO38071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDZ3])

HSP 1 Score: 58.5362 bits (140), Expect = 5.017e-9
Identity = 45/159 (28.30%), Postives = 73/159 (45.91%), Query Frame = 1
Query:  391 LPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNN 867
              NL  ++L  + I  I  L   L NLQ L +    +  ++GL  +  LK+L L  N I  I +   L +L +  +  N +    N+ YL    NL  L L  NP C  +K      YK+ VI  +P L YLD   I+   +  + + ++  I ++ ++
Sbjct:   64 FVNLTTLQLDNNIIEKIEGLDM-LVNLQWLDLSFNNIEVIEGLDKLTKLKDLTLYNNRITKIENMDSLTNLHVFSIGNNSLKQLDNVIYLRRFKNLRTLNLSFNPFCEDSK------YKEYVIAHLPDLVYLDFRLIDETAREAATERYKYSIEEMVHD 215          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Nematostella
Match: EDO31770 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWZ7])

HSP 1 Score: 54.299 bits (129), Expect = 1.105e-7
Identity = 41/137 (29.93%), Postives = 70/137 (51.09%), Query Frame = 1
Query:  397 NLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLES-LEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPIN 804
            NL ++    ++I  I +L +SL  L VLW+    ++ ++GL ++A L +L LA N+I  I       + LE+LDL  N I    +L  L    +L  L+L+ +P   PN       Y  +++  +P+L  LD   ++
Sbjct:  130 NLKKVYFYDNHISKIENL-SSLTRLTVLWLNNNNIQAIEGLESLAQLTDLNLASNKITSIGDTLQRNTHLEVLDLSANRIGSFKDLTNLVHLPHLKSLSLK-DPTYGPNPVSLLCNYATHLLFHLPKLTRLDSYDVD 264          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Nematostella
Match: EDO44937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU20])

HSP 1 Score: 53.5286 bits (127), Expect = 1.109e-7
Identity = 65/249 (26.10%), Postives = 115/249 (46.18%), Query Frame = 1
Query:  109 TSTDLETNEFSFNDSNLSGININSQGINVKVTDYSYGNVNPSPIKLPKDSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNL-----------------HY-----LAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLD 789
            T T LE  E  F D+ +S I    + +N+++ D S+ NV      L   ++L + +L   K+  + G+++L  +  +E+  N  ++  G    +L  L  + +  + I  +++L + L +L+VL +    +  L GL  + +L+ELY+++N I +I     L  L  LDL  N I   SN+                 H+     LA C  L  + LE NPL           Y++ V  ++P L+ +D
Sbjct:   69 TLTSLE--ELDFYDNQISKIENLDRLVNLRILDLSF-NVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEG--LEHLTKLESLFVGKNKITELQNL-SGLCSLKVLSIQSNRIVELKGLEHLDSLEELYISHNGIEEIKGLESLTKLNTLDLASNRIKRISNVGHLLNLEEFWFNDNQLEHWEDLDELAKCPKLHTVYLERNPLSRDT------AYRRKVKLALPALKQID 305          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Nematostella
Match: EDO32918 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STQ2])

HSP 1 Score: 51.6026 bits (122), Expect = 2.821e-7
Identity = 37/111 (33.33%), Postives = 56/111 (50.45%), Query Frame = 1
Query:  499 LRCLDGLVTMANLKELYLAYNEIA---DISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSR-------LTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPI 801
            +R ++ +  +  L  L +A+N +A   DI      + L I+DL  N IDDP+ +  LA   NL R       L L GNP+    K      Y++N+I  +  L+YLDD P+
Sbjct:   98 IRSIENIACLPVLNTLQIAHNRLASAGDIKELASCQKLSIVDLSYNKIDDPNIVDVLAEMPNLVRAHIFGVVLNLIGNPVIKKIK-----NYRKNMILKLKNLKYLDDRPV 203          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Medaka
Match: ENSORLT00000037485.1 (leucine rich repeat containing 56 [Source:NCBI gene;Acc:101165026])

HSP 1 Score: 114.775 bits (286), Expect = 1.014e-26
Identity = 64/177 (36.16%), Postives = 102/177 (57.63%), Query Frame = 1
Query:  286 RKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPM----TYKQNVIESIPQLEYLDDLPIN 804
            R+   L G  +L  V  LE+ V+     L + G  LP L +++++ S I ++RDLG +  NL+ LWM  C L+ L+G+ +   LKEL+ A+N ++D+ +   L+ L++LDLEGN +DD  ++  L  C  L  LTL GNP+C       P     +Y+  V E +PQ+ YLD++ + 
Sbjct:   37 RRQGLLGGTWDLCHVTSLELCVDAHHDLLEHVGSSLPRLVELRVNNSKIASVRDLGLNSPNLERLWMSGCGLQDLEGISSFPFLKELHAAFNRLSDLFNVSFLQKLQLLDLEGNDVDDLVHVQCLQACIKLQTLTLRGNPVCVRPDTTCPQVTDYSYRAAVQELLPQVCYLDNVKVQ 213          
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Medaka
Match: LRRC9 (leucine-rich repeat-containing protein 9 [Source:NCBI gene;Acc:101159959])

HSP 1 Score: 58.9214 bits (141), Expect = 1.607e-8
Identity = 49/131 (37.40%), Postives = 67/131 (51.15%), Query Frame = 1
Query:  400 LAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADIS-SCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLD 789
            L ++ L  + I  I++L   + NL+VLW+   C+  + GL  + NLKEL LA N I  I  S     SLEIL+L GN I     L  LA    L  L L+ +P+  PN       Y  +V+  IP L+ LD
Sbjct:  141 LEKLYLYNNQICEIQNLDLQV-NLEVLWLNNNCITKIQGLDMLQNLKELNLADNLIEKIGNSLDPNVSLEILNLSGNQISSFKELAQLAHLPRLKELALK-DPMSTPNPVCLLCNYATHVLYHIPGLQQLD 269          
BLAST of Leucine-rich repeat-containing protein 56 vs. Planmine SMEST
Match: SMESG000036659.1 (SMESG000036659.1)

HSP 1 Score: 1030.78 bits (2664), Expect = 0.000e+0
Identity = 555/556 (99.82%), Postives = 555/556 (99.82%), Query Frame = 1
Query:  106 MTSTDLETNEFSFNDSNLSGININSQGINVKVTDYSYGNVNPSPIKLPKDSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLAESARSKCSTNXXXXXXXXXXXXXXXXXXXXXXXXXIRPMSSQKRAITPGISRPGTSINQRPSTANTLEPEEKADDSNLTAGKIVCGNITKSLRRHSEENSVNSAPKIKSSDMRPKTCIIKKLQNNTDPNVDESCEIVLKELGKWRRDYEKSKARIEKQKEPQILTIEYSEDELEEVNITKPIDKITVEKDILKTKVIEKHSNKKTDIQLNPIKNGKLIERELPSSWIPNMKPIYXXXXXXXXXXXXXXEKQPSQMSRIRRQLLQSGVSSIAPNKPLLKR 1773
            MTSTDLETNEFSFNDSNLSGININSQGINVKVTDYSYGNVNPSPIKLPKDSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLAESARSKCSTNSPDDSGRPSSSTSSTRISSARPTSAIRPMSSQKRAITPGISRPGTSINQRPSTANTLEPEEKADDSNLTAGKIVCGNITKSLRRHSEENSVNSAPKIK SDMRPKTCIIKKLQNNTDPNVDESCEIVLKELGKWRRDYEKSKARIEKQKEPQILTIEYSEDELEEVNITKPIDKITVEKDILKTKVIEKHSNKKTDIQLNPIKNGKLIERELPSSWIPNMKPIYNDHNNLLNNTSNNLEKQPSQMSRIRRQLLQSGVSSIAPNKPLLKR
Sbjct:    1 MTSTDLETNEFSFNDSNLSGININSQGINVKVTDYSYGNVNPSPIKLPKDSELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISDLSNNSMLEFEDHWNFINSMLVESGLLAESARSKCSTNSPDDSGRPSSSTSSTRISSARPTSAIRPMSSQKRAITPGISRPGTSINQRPSTANTLEPEEKADDSNLTAGKIVCGNITKSLRRHSEENSVNSAPKIK-SDMRPKTCIIKKLQNNTDPNVDESCEIVLKELGKWRRDYEKSKARIEKQKEPQILTIEYSEDELEEVNITKPIDKITVEKDILKTKVIEKHSNKKTDIQLNPIKNGKLIERELPSSWIPNMKPIYNDHNNLLNNTSNNLEKQPSQMSRIRRQLLQSGVSSIAPNKPLLKR 555          
BLAST of Leucine-rich repeat-containing protein 56 vs. Planmine SMEST
Match: SMESG000047633.1 (SMESG000047633.1)

HSP 1 Score: 58.9214 bits (141), Expect = 3.547e-9
Identity = 41/139 (29.50%), Postives = 72/139 (51.80%), Query Frame = 1
Query:  388 YLPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNPLCNPNKYEAPMTYKQNVIESIPQLEYLDDLPIN 804
            +  NL +++L  + I  I  L   L +L+ L +    +  ++G+ ++ N+++L L  N I  + +   L+ L++L +  N IDD +NL YL    +L  + L GNP C  +++         V+  +PQL YLD   IN
Sbjct:   63 WFKNLTKLQLDNNIIEKISGLN-HLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVLSIGNNLIDDLNNLKYLRTFKSLKAINLSGNPCCEKDEFRVV------VLAYLPQLIYLDYKLIN 194          
BLAST of Leucine-rich repeat-containing protein 56 vs. Planmine SMEST
Match: SMESG000026105.1 (SMESG000026105.1)

HSP 1 Score: 55.4546 bits (132), Expect = 4.821e-8
Identity = 63/250 (25.20%), Postives = 110/250 (44.00%), Query Frame = 1
Query:  133 EFSFNDSNLSGININSQGINVKVTDYSYGNVNPSPIKLPKDSELLEEFLSPRKLQALTGVDN-LETVEYLEMRVNTDQMSLGNFGMY-------LPNLAQIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLAYNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCS-------------------NLSRLT---LEGNPLC-NPNKYEAPMTYKQNVIESIPQLEYLD 789
            E    D+ ++ I    + +N+ + D S+  +           +L+E      KL  L  V+N + T+E L   VN + + LG+  +        L  L Q+ L  + I  + +L   + NL VL +    +  +DGL  + NL++LYL++N I+ I + G L  L  LDL  N I    NL +L +                     NL +L     E NP+   P++ +    Y++ +   +P+L+ +D
Sbjct:   73 ELDLYDNQITKIENLDKLVNLSILDLSFNRI-----------KLIENIDKLIKLTKLYFVNNKIRTIENLNSLVNIEMLELGSNSIKRIENLDSLTKLDQLYLGKNKISKLENLDF-MKNLTVLSIQGNRITQIDGLDNLINLEQLYLSHNGISKIENLGNLTKLTTLDLSSNRISKVENLSHLKILEEFWFNDNNLADWNSIDELVNLEKLATVYFERNPIWYTPDRSKEDPNYRRKIRLLLPKLKQID 310          
The following BLAST results are available for this feature:
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC561.866e-5049.74leucine rich repeat containing 56 [Source:HGNC Sym... [more]
LRRC562.169e-5049.74leucine rich repeat containing 56 [Source:HGNC Sym... [more]
DRC36.263e-729.75dynein regulatory complex subunit 3 [Source:HGNC S... [more]
DRC36.263e-729.75dynein regulatory complex subunit 3 [Source:HGNC S... [more]
DRC38.801e-729.75dynein regulatory complex subunit 3 [Source:HGNC S... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
K10D2.87.375e-1029.11pep chromosome:WBcel235:III:5188726:5190175:1 gene... [more]
C06A8.65.077e-825.62pep chromosome:WBcel235:II:7772499:7773914:1 gene:... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG141859.357e-1831.58gene:FBgn0036936 transcript:FBtr0074818[more]
CG108393.135e-727.82gene:FBgn0028858 transcript:FBtr0343725[more]
CG108393.135e-727.82gene:FBgn0028858 transcript:FBtr0305563[more]
CG108393.135e-727.82gene:FBgn0028858 transcript:FBtr0080800[more]
sds221.479e-626.40gene:FBgn0028992 transcript:FBtr0083436[more]
back to top
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
LRRC566.051e-4532.01si:ch211-103e16.5 [Source:ZFIN;Acc:ZDB-GENE-110913... [more]
LRRC568.386e-4231.80si:ch211-103e16.5 [Source:ZFIN;Acc:ZDB-GENE-110913... [more]
drc33.895e-926.67dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
cep725.270e-628.47centrosomal protein 72 [Source:NCBI gene;Acc:55348... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC562.774e-6737.84leucine rich repeat containing 56 [Source:NCBI gen... [more]
lrrc92.062e-834.27leucine rich repeat containing 9 [Source:NCBI gene... [more]
lrrc92.302e-834.27leucine rich repeat containing 9 [Source:NCBI gene... [more]
lrrc94.013e-738.10leucine rich repeat containing 9 [Source:NCBI gene... [more]
lrrc94.165e-738.10leucine rich repeat containing 9 [Source:NCBI gene... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrc562.069e-5050.00leucine rich repeat containing 56 [Source:MGI Symb... [more]
Lrrc562.402e-4950.00leucine rich repeat containing 56 [Source:MGI Symb... [more]
Lrrc562.402e-4950.00leucine rich repeat containing 56 [Source:MGI Symb... [more]
Lrrc561.034e-1343.82leucine rich repeat containing 56 [Source:MGI Symb... [more]
Lrrc92.076e-731.55leucine rich repeat containing 9 [Source:MGI Symbo... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 56 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IYG6|LRC56_HUMAN8.963e-5049.74Leucine-rich repeat-containing protein 56 OS=Homo ... [more]
sp|Q4V8C9|LRC56_RAT2.875e-4934.88Leucine-rich repeat-containing protein 56 OS=Rattu... [more]
sp|Q8K375|LRC56_MOUSE1.680e-4850.00Leucine-rich repeat-containing protein 56 OS=Mus m... [more]
sp|Q387Y5|LRC56_TRYB21.773e-1326.38Leucine-rich repeat-containing protein 56 homolog ... [more]
sp|A0JM56|LRRC9_XENTR1.047e-734.27Leucine-rich repeat-containing protein 9 OS=Xenopu... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 56 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FCI41.048e-9240.41Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267EBQ91.177e-9240.41Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GHK51.309e-9240.20Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GAD81.686e-9147.58Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GGK32.392e-9047.58Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-103e16.51.260e-4632.26leucine rich repeat containing 56 [Source:NCBI gen... [more]
si:ch211-103e16.54.019e-4533.56leucine rich repeat containing 56 [Source:NCBI gen... [more]
si:ch211-103e16.56.661e-3532.14leucine rich repeat containing 56 [Source:NCBI gen... [more]
drc31.393e-730.52dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
drc31.701e-730.32dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004503.11.122e-4048.39pep scaffold:Pmarinus_7.0:GL476669:33448:48069:1 g... [more]
ENSPMAT00000005086.14.926e-734.48pep scaffold:Pmarinus_7.0:GL477410:204878:243212:-... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491803.336e-5634.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380715.017e-928.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317701.105e-729.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449371.109e-726.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329182.821e-733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 56 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000037485.11.014e-2636.16leucine rich repeat containing 56 [Source:NCBI gen... [more]
LRRC91.607e-837.40leucine-rich repeat-containing protein 9 [Source:N... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 56 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000036659.10.000e+099.82SMESG000036659.1[more]
SMESG000047633.13.547e-929.50SMESG000047633.1[more]
SMESG000026105.14.821e-825.20SMESG000026105.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035576 ID=SMED30035576|Name=Leucine-rich repeat-containing protein 56|organism=Schmidtea mediterranea sexual|type=transcript|length=1876bp
AGTCAATGTAAATAGACCTGCAAATTCAAATTGTAATATTTTATGATTTT
ACTTTTGTAAAGTTTGTAAATTTAGAATAAAAATACAAAAATAATAATCA
ATTAAATGACATCAACCGATTTGGAAACAAATGAGTTTTCTTTCAATGAT
TCTAATTTATCGGGTATTAATATTAATTCTCAAGGAATCAATGTAAAAGT
TACAGATTATAGTTACGGCAATGTAAATCCATCACCAATAAAATTACCTA
AAGATTCGGAGCTGTTGGAAGAATTTTTATCTCCTCGAAAATTGCAAGCT
CTAACCGGAGTTGATAATCTCGAGACTGTTGAGTATTTGGAAATGAGGGT
CAACACCGATCAAATGAGTCTAGGAAATTTCGGCATGTATTTACCAAATT
TGGCACAGATCAAGCTTTCAGGAAGTTATATTCCTACAATCAGAGATCTC
GGAACATCGCTTTGGAATCTACAAGTGTTATGGATGCCGCAATGCTGTTT
GCGTTGTCTCGATGGACTTGTAACGATGGCAAATTTAAAAGAGCTCTATT
TAGCTTATAATGAAATCGCAGATATCAGTTCGTGTGGAATGTTGGAAAGT
TTGGAGATTTTGGATTTAGAAGGAAATCACATTGATGATCCGAGCAATCT
TCATTATTTAGCAATGTGTTCCAACCTGTCTCGACTTACATTGGAAGGAA
ATCCTTTATGTAACCCTAACAAATATGAAGCTCCTATGACATACAAACAA
AACGTCATTGAATCTATACCACAACTCGAATATCTCGATGACCTACCAAT
TAATTATTGCAATAAGTTACCTTCTGGTGATACACATGAAAACCCAATTT
CAGATCTTAGCAACAACTCGATGTTAGAATTCGAAGATCACTGGAATTTC
ATAAACTCCATGCTGGTAGAGTCTGGTTTATTAGCAGAATCGGCTCGAAG
TAAATGTAGTACAAATTCCCCCGATGACAGCGGTCGACCATCTTCGTCAA
CTTCATCTACTCGTATTTCTTCAGCTAGGCCTACTTCAGCCATAAGGCCC
ATGTCAAGCCAGAAACGTGCCATAACTCCTGGTATCTCTCGACCGGGCAC
TAGTATTAATCAACGACCATCAACAGCTAACACCTTAGAACCTGAAGAAA
AAGCCGATGATTCGAATTTAACAGCAGGAAAAATCGTATGTGGCAATATC
ACAAAATCACTCCGGAGGCATTCAGAAGAAAACAGTGTAAATAGCGCACC
GAAAATCAAATCATCAGATATGAGACCCAAAACATGTATAATAAAAAAAT
TACAAAACAATACCGATCCAAATGTCGATGAAAGTTGTGAGATCGTTCTG
AAGGAATTGGGTAAATGGAGAAGGGATTATGAAAAATCCAAAGCCAGGAT
CGAGAAACAAAAAGAGCCCCAAATTTTGACAATCGAATATTCCGAGGACG
AATTGGAAGAAGTCAATATTACAAAACCCATTGATAAAATAACTGTGGAA
AAAGATATTTTAAAGACAAAAGTTATCGAAAAGCATTCAAATAAAAAAAC
AGACATACAATTAAACCCGATTAAAAATGGAAAATTAATTGAAAGGGAAT
TGCCATCGTCATGGATACCAAACATGAAGCCAATTTATAATGATCACAAC
AATTTATTAAACAACACATCGAACAATCTCGAAAAGCAGCCTTCTCAAAT
GAGTCGAATTCGTCGCCAACTTCTACAGAGTGGGGTCAGTTCAATCGCCC
CGAATAAACCGCTTCTGAAAAGATGAATAAGATAATACTAATAATAATAA
TTTTTACTGTAGAAATGTCTGTTAGATGCTGTGAATTCATATTTTGCAGT
TTGTCAGTTGATGAGCAGGAGAATCC
back to top

protein sequence of SMED30035576-orf-1

>SMED30035576-orf-1 ID=SMED30035576-orf-1|Name=SMED30035576-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=557bp
MTSTDLETNEFSFNDSNLSGININSQGINVKVTDYSYGNVNPSPIKLPKD
SELLEEFLSPRKLQALTGVDNLETVEYLEMRVNTDQMSLGNFGMYLPNLA
QIKLSGSYIPTIRDLGTSLWNLQVLWMPQCCLRCLDGLVTMANLKELYLA
YNEIADISSCGMLESLEILDLEGNHIDDPSNLHYLAMCSNLSRLTLEGNP
LCNPNKYEAPMTYKQNVIESIPQLEYLDDLPINYCNKLPSGDTHENPISD
LSNNSMLEFEDHWNFINSMLVESGLLAESARSKCSTNSPDDSGRPSSSTS
STRISSARPTSAIRPMSSQKRAITPGISRPGTSINQRPSTANTLEPEEKA
DDSNLTAGKIVCGNITKSLRRHSEENSVNSAPKIKSSDMRPKTCIIKKLQ
NNTDPNVDESCEIVLKELGKWRRDYEKSKARIEKQKEPQILTIEYSEDEL
EEVNITKPIDKITVEKDILKTKVIEKHSNKKTDIQLNPIKNGKLIERELP
SSWIPNMKPIYNDHNNLLNNTSNNLEKQPSQMSRIRRQLLQSGVSSIAPN
KPLLKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0070507regulation of microtubule cytoskeleton organization
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR040091LRRC56
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF14580LRR_9coord: 102..217
e-value: 1.3E-9
score: 37.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 281..343
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 281..356
NoneNo IPR availablePANTHERPTHR22708:SF0LEUCINE-RICH REPEAT-CONTAINING PROTEIN 56coord: 7..458
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 89..233
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 80..237
e-value: 9.2E-31
score: 108.1
IPR040091Leucine-rich repeat-containing protein 56PANTHERPTHR22708UNCHARACTERIZEDcoord: 7..458
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 98..119
score: 4.763
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 121..142
score: 5.332
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 190..211
score: 4.639
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 237..258
score: 5.086
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 143..164
score: 7.789
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 165..186
score: 8.166