Voltage gated potassium channel

Overview
NameVoltage gated potassium channel
Smed IDSMED30035575
Length (bp)3550
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage gated potassium channel (SMED30035575) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage gated potassium channel (SMED30035575) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage gated potassium channel (SMED30035575) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage gated potassium channel (SMED30035575) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035575

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035575SMESG000035416.1 SmedASXL_008037SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30035575SMESG000035416.1 dd_Smed_v4_18793_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035575SMESG000035416.1 dd_Smed_v4_18793_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035575SMESG000035416.1 dd_Smed_v6_18793_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30035575SMESG000035416.1 dd_Smed_v4_18793_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNH5 (potassium voltage-gated channel subfamily H member 5 [Source:HGNC Symbol;Acc:HGNC:6254])

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 426/844 (50.47%), Postives = 583/844 (69.08%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKV-----FYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGP--ETLIKLPLQES--ENNNCVSKVSP--APDQS--KQRQPSKML------WQRLKH 2627
            M G +RGLVAPQNTFL+ I+RR  S  S+F L N+ I ++P++YS++GFCK+SGY + +V+ + +TC+FM+G+ T  +  ++ +  F+       EVL YKKN+  +W   Q++PIRNE +++ LFL TFK+IT  K    D DS+K  +KFARL R +T +RS+LQ +    T ++K  +                  S   +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  ++I +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     ISSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++V        W+ +L+        +     I +  P K  +Y++SLY+T++ +T+IGFGN++  T  EK+ SV  M++G+  YATIFG +TTIFQQM +   RYHEM++NV+DF+K + VP+ L+ERV+DYI S+W+++KGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLR+LA+ FQTIH APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH IKR+ LL +LDFY AF NSF+RNL LT +L+ RIIFRK+SDVK+E+E   ++KN+     +  +HPVRK+  K ++     +Q ++  D  PE +    + +S  +  +   TS++   ++ P   +L  +   ES  +NN    ++ P    DQ   K   P +M       W RLK+
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIED-DSTKGWTKFARLTRALTNSRSVLQQL----TPMNKTEV--------------VHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQDDEVVAILGKGDVFGDIFWKE-TTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKRIIFRKISDVKKEEEERLRQKNEVTL-SIPVDHPVRKLFQKFKQQKELRNQGSTQGD--PERNQLQVESRSLQNGASITGTSVVTVSQITPIQTSLAYVKTSESLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKN 816          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNH1 (potassium voltage-gated channel subfamily H member 1 [Source:HGNC Symbol;Acc:HGNC:6250])

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 408/744 (54.84%), Postives = 539/744 (72.45%), Query Frame = 3
Query:  147 LSMYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGH-----ADLQNKVFYGWIPRLSNDT-MHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            ++M G RRGLVAPQNTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  ++ +  FE       E+L YKKN+  +W   +++PIRNE+D++ LFL TF +ITA K    D DS K   KFARL R +T +R +LQ +                 A SV         S   +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDWIILILT YTA++VPYN +FK+R  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYDV NAF  E     ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHW+ACIW+SIG       D +      W+ +L+ D    Y+   + +   +  P K+ VYI+SLY+T++ +TS+GFGN++ +T  EK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI S+W++++GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQT+H APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+ S A VRALTYCDLH IKRD L  +L+FY AF +SF+RNL+LTY+L+ RI+FRK+SDVKRE+E   KRKN+     L P+HPVR++  + R+
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIED-DSCKGWGKFARLTRALTSSRGVLQQL-----------------APSVQKGENVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTRQ-NNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEAT-LAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRKNEAPL-ILPPDHPVRRLFQRFRQ 719          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNH1 (potassium voltage-gated channel subfamily H member 1 [Source:HGNC Symbol;Acc:HGNC:6250])

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 408/744 (54.84%), Postives = 539/744 (72.45%), Query Frame = 3
Query:  147 LSMYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGH-----ADLQNKVFYGWIPRLSNDT-MHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            ++M G RRGLVAPQNTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  ++ +  FE       E+L YKKN+  +W   +++PIRNE+D++ LFL TF +ITA K    D DS K   KFARL R +T +R +LQ +                 A SV         S   +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDWIILILT YTA++VPYN +FK+R  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYDV NAF  E     ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHW+ACIW+SIG       D +      W+ +L+ D    Y+   + +   +  P K+ VYI+SLY+T++ +TS+GFGN++ +T  EK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI S+W++++GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQT+H APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+ S A VRALTYCDLH IKRD L  +L+FY AF +SF+RNL+LTY+L+ RI+FRK+SDVKRE+E   KRKN+     L P+HPVR++  + R+
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIED-DSCKGWGKFARLTRALTSSRGVLQQL-----------------APSVQKGENVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTRQ-NNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEAT-LAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRKNEAPL-ILPPDHPVRRLFQRFRQ 719          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNH1 (potassium voltage-gated channel subfamily H member 1 [Source:HGNC Symbol;Acc:HGNC:6250])

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 408/744 (54.84%), Postives = 539/744 (72.45%), Query Frame = 3
Query:  147 LSMYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGH-----ADLQNKVFYGWIPRLSNDT-MHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            ++M G RRGLVAPQNTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  ++ +  FE       E+L YKKN+  +W   +++PIRNE+D++ LFL TF +ITA K    D DS K   KFARL R +T +R +LQ +                 A SV         S   +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDWIILILT YTA++VPYN +FK+R  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYDV NAF  E     ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHW+ACIW+SIG       D +      W+ +L+ D    Y+   + +   +  P K+ VYI+SLY+T++ +TS+GFGN++ +T  EK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI S+W++++GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQT+H APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+ S A VRALTYCDLH IKRD L  +L+FY AF +SF+RNL+LTY+L+ RI+FRK+SDVKRE+E   KRKN+     L P+HPVR++  + R+
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIED-DSCKGWGKFARLTRALTSSRGVLQQL-----------------APSVQKGENVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTRQ-NNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEAT-LAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRKNEAPL-ILPPDHPVRRLFQRFRQ 719          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNH1 (potassium voltage-gated channel subfamily H member 1 [Source:HGNC Symbol;Acc:HGNC:6250])

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 408/744 (54.84%), Postives = 539/744 (72.45%), Query Frame = 3
Query:  147 LSMYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGH-----ADLQNKVFYGWIPRLSNDT-MHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            ++M G RRGLVAPQNTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  ++ +  FE       E+L YKKN+  +W   +++PIRNE+D++ LFL TF +ITA K    D DS K   KFARL R +T +R +LQ +                 A SV         S   +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDWIILILT YTA++VPYN +FK+R  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYDV NAF  E     ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHW+ACIW+SIG       D +      W+ +L+ D    Y+   + +   +  P K+ VYI+SLY+T++ +TS+GFGN++ +T  EK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI S+W++++GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQT+H APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+ S A VRALTYCDLH IKRD L  +L+FY AF +SF+RNL+LTY+L+ RI+FRK+SDVKRE+E   KRKN+     L P+HPVR++  + R+
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIED-DSCKGWGKFARLTRALTSSRGVLQQL-----------------APSVQKGENVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTRQ-NNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEAT-LAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRKNEAPL-ILPPDHPVRRLFQRFRQ 719          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: egl-2 (pep chromosome:WBcel235:V:1288841:1299208:-1 gene:WBGene00001171.1 transcript:F16B3.1a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:egl-2)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 384/753 (51.00%), Postives = 519/753 (68.92%), Query Frame = 3
Query:  162 NRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSR-------------NMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLSNDTMHYRN--WKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
             +RGLVAPQNTFL+ +IRRCN+  ++F LAN+ + +YPI+Y ++GF K+ GY++ E++ +  +  FMHG+        + + A E    EQ E+   KKNK  +WL+  ++PI+N KD + L+L  FK+IT LK   +DE++ K  S+  ++AR + K++     + T     S           + S++          Q   +  + LP YRQE PKT PHIILHY +FK +WDW IL LT YTA MVP+N AFK+                      ++DSIVDV+FF DI+ NFHTTFVGP GEV+ +P+VIR NY K WF+IDLLSCLPYD+F  F+ +  +  I SLFSALKVVRLLR+GRV RKLD YLEY A +L+L++  +V++AHWLAC+WF IG ++++ K+       GW+ +LSND   + N    N T +    P ++  YI+SLYYT+S ++++GFGN+++NT  EK+  V  M+I A  YA IFG +TTI QQM S+  RYHEM+SNV++FIK   +P++LAERV+DY+ S+WA+TKGIDT KVL YCPKDMKAD+C+HLNR VFN+H+ FRLASDGCLRSLA+  +  H APGDL++H GES+D L FVVSGSLEVIQDDE+VAILG+GD+FG+ FWK       S A VRALTY DLH IK+D L+ +LDFY AF NSFARN+ LTY+L HR+ FRK++DVKREKEL+ KRKN+ L   L  +HP+RK++ ++R+
Sbjct:    4 GKRGLVAPQNTFLENVIRRCNNADTSFILANAQVVDYPIVYCNDGFSKLVGYTRAEIMQKPCSLAFMHGEHGEVGSLQKMQEALENARTEQAEIGLCKKNKTPIWLLVHLAPIKNHKDAVVLYLCQFKDITPLKQPLDDENN-KGLSRILQIAR-IAKSKQQFNQIETKDLHKSP--------GNTSSNF---------NQVMNLGGDMLPQYRQETPKTSPHIILHYSSFKTIWDWSILALTFYTAFMVPFNIAFKNSLRPFYLISSRENPGGGIDSVALMDSIVDVIFFADILLNFHTTFVGPGGEVVIEPSVIRQNYFKSWFLIDLLSCLPYDIFYMFKRDDER--IGSLFSALKVVRLLRLGRVARKLDNYLEYGAATLLLLLCAYVIVAHWLACVWFWIGDSEVRLKMDNLALPDGWLWKLSNDLRQHYNIPLSNKTTLVGG-PSRTSAYISSLYYTMSCMSTVGFGNIASNTDNEKIFGVCMMIISALLYAAIFGHMTTIIQQMTSSTVRYHEMISNVREFIKLQEIPKELAERVMDYVVSTWAMTKGIDTAKVLGYCPKDMKADICVHLNRKVFNEHSCFRLASDGCLRSLAMFLELNHAAPGDLLYHTGESVDALWFVVSGSLEVIQDDEVVAILGKGDVFGDEFWKANGSTGQSAANVRALTYSDLHMIKKDKLMDVLDFYKAFANSFARNMTLTYNLTHRMKFRKVADVKREKELDAKRKNEKL--TLPNDHPIRKLLFRMRE 732          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: egl-2 (pep chromosome:WBcel235:V:1289373:1299332:-1 gene:WBGene00001171.1 transcript:F16B3.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:egl-2)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 384/753 (51.00%), Postives = 519/753 (68.92%), Query Frame = 3
Query:  162 NRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSR-------------NMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLSNDTMHYRN--WKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
             +RGLVAPQNTFL+ +IRRCN+  ++F LAN+ + +YPI+Y ++GF K+ GY++ E++ +  +  FMHG+        + + A E    EQ E+   KKNK  +WL+  ++PI+N KD + L+L  FK+IT LK   +DE++ K  S+  ++AR + K++     + T     S           + S++          Q   +  + LP YRQE PKT PHIILHY +FK +WDW IL LT YTA MVP+N AFK+                      ++DSIVDV+FF DI+ NFHTTFVGP GEV+ +P+VIR NY K WF+IDLLSCLPYD+F  F+ +  +  I SLFSALKVVRLLR+GRV RKLD YLEY A +L+L++  +V++AHWLAC+WF IG ++++ K+       GW+ +LSND   + N    N T +    P ++  YI+SLYYT+S ++++GFGN+++NT  EK+  V  M+I A  YA IFG +TTI QQM S+  RYHEM+SNV++FIK   +P++LAERV+DY+ S+WA+TKGIDT KVL YCPKDMKAD+C+HLNR VFN+H+ FRLASDGCLRSLA+  +  H APGDL++H GES+D L FVVSGSLEVIQDDE+VAILG+GD+FG+ FWK       S A VRALTY DLH IK+D L+ +LDFY AF NSFARN+ LTY+L HR+ FRK++DVKREKEL+ KRKN+ L   L  +HP+RK++ ++R+
Sbjct:    4 GKRGLVAPQNTFLENVIRRCNNADTSFILANAQVVDYPIVYCNDGFSKLVGYTRAEIMQKPCSLAFMHGEHGEVGSLQKMQEALENARTEQAEIGLCKKNKTPIWLLVHLAPIKNHKDAVVLYLCQFKDITPLKQPLDDENN-KGLSRILQIAR-IAKSKQQFNQIETKDLHKSP--------GNTSSNF---------NQVMNLGGDMLPQYRQETPKTSPHIILHYSSFKTIWDWSILALTFYTAFMVPFNIAFKNSLRPFYLISSRENPGGGIDSVALMDSIVDVIFFADILLNFHTTFVGPGGEVVIEPSVIRQNYFKSWFLIDLLSCLPYDIFYMFKRDDER--IGSLFSALKVVRLLRLGRVARKLDNYLEYGAATLLLLLCAYVIVAHWLACVWFWIGDSEVRLKMDNLALPDGWLWKLSNDLRQHYNIPLSNKTTLVGG-PSRTSAYISSLYYTMSCMSTVGFGNIASNTDNEKIFGVCMMIISALLYAAIFGHMTTIIQQMTSSTVRYHEMISNVREFIKLQEIPKELAERVMDYVVSTWAMTKGIDTAKVLGYCPKDMKADICVHLNRKVFNEHSCFRLASDGCLRSLAMFLELNHAAPGDLLYHTGESVDALWFVVSGSLEVIQDDEVVAILGKGDVFGDEFWKANGSTGQSAANVRALTYSDLHMIKKDKLMDVLDFYKAFANSFARNMTLTYNLTHRMKFRKVADVKREKELDAKRKNEKL--TLPNDHPIRKLLFRMRE 732          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: egl-2 (pep chromosome:WBcel235:V:1288841:1299208:-1 gene:WBGene00001171.1 transcript:F16B3.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:egl-2)

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 383/753 (50.86%), Postives = 520/753 (69.06%), Query Frame = 3
Query:  162 NRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSR-------------NMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLSNDTMHYRN--WKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
             +RGLVAPQNTFL+ +IRRCN+  ++F LAN+ + +YPI+Y ++GF K+ GY++ E++ +  +  FMHG+        + + A E    EQ E+   KKNK  +WL+  ++PI+N KD + L+L  FK+IT LK   +DE++ K  S+  ++AR + K++     + T     S           + S++ +        +   +  + LP YRQE PKT PHIILHY +FK +WDW IL LT YTA MVP+N AFK+                      ++DSIVDV+FF DI+ NFHTTFVGP GEV+ +P+VIR NY K WF+IDLLSCLPYD+F  F+ +  +  I SLFSALKVVRLLR+GRV RKLD YLEY A +L+L++  +V++AHWLAC+WF IG ++++ K+       GW+ +LSND   + N    N T +    P ++  YI+SLYYT+S ++++GFGN+++NT  EK+  V  M+I A  YA IFG +TTI QQM S+  RYHEM+SNV++FIK   +P++LAERV+DY+ S+WA+TKGIDT KVL YCPKDMKAD+C+HLNR VFN+H+ FRLASDGCLRSLA+  +  H APGDL++H GES+D L FVVSGSLEVIQDDE+VAILG+GD+FG+ FWK       S A VRALTY DLH IK+D L+ +LDFY AF NSFARN+ LTY+L HR+ FRK++DVKREKEL+ KRKN+ L   L  +HP+RK++ ++R+
Sbjct:    4 GKRGLVAPQNTFLENVIRRCNNADTSFILANAQVVDYPIVYCNDGFSKLVGYTRAEIMQKPCSLAFMHGEHGEVGSLQKMQEALENARTEQAEIGLCKKNKTPIWLLVHLAPIKNHKDAVVLYLCQFKDITPLKQPLDDENN-KGLSRILQIAR-IAKSKQQFNQIETKDLHKSP--------GNTSSNFNQV------IKVMNLGGDMLPQYRQETPKTSPHIILHYSSFKTIWDWSILALTFYTAFMVPFNIAFKNSLRPFYLISSRENPGGGIDSVALMDSIVDVIFFADILLNFHTTFVGPGGEVVIEPSVIRQNYFKSWFLIDLLSCLPYDIFYMFKRDDER--IGSLFSALKVVRLLRLGRVARKLDNYLEYGAATLLLLLCAYVIVAHWLACVWFWIGDSEVRLKMDNLALPDGWLWKLSNDLRQHYNIPLSNKTTLVGG-PSRTSAYISSLYYTMSCMSTVGFGNIASNTDNEKIFGVCMMIISALLYAAIFGHMTTIIQQMTSSTVRYHEMISNVREFIKLQEIPKELAERVMDYVVSTWAMTKGIDTAKVLGYCPKDMKADICVHLNRKVFNEHSCFRLASDGCLRSLAMFLELNHAAPGDLLYHTGESVDALWFVVSGSLEVIQDDEVVAILGKGDVFGDEFWKANGSTGQSAANVRALTYSDLHMIKKDKLMDVLDFYKAFANSFARNMTLTYNLTHRMKFRKVADVKREKELDAKRKNEKL--TLPNDHPIRKLLFRMRE 735          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 385.571 bits (989), Expect = 1.317e-119
Identity = 245/650 (37.69%), Postives = 363/650 (55.85%), Query Frame = 3
Query:  669 STSLSKVGIGVAVDAKSVSDYIK---YDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXX--------XXNFHTTFVGPNGE---VISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDE-IVAILGQGDIFGEAFWKDP---NKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRI-IFRKLSDVXXXXXXXXXXXNDNLFEDLDPNH---PVRKMISKL-RKGLHSTDQTNST-----VDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQES 2534
            +T+ S  G  VA  AK +   ++   Y V S G       ++ LP Y+ +  +     I+HY  FKAVWDWIIL+L  YTAV  PY AAF  R + D       +    +  + +        + NF TT+V  N E   V+SDP  I  +Y KGWF+ID+++ +P+D+       T     ++L   LK  RLLR+ RV RKLD+Y EY A  L+L++  F L+AHWLACIW++IG A+L +K  Y W+ +LS          N T I    P     Y+TSLY+TLS ITSIGFGNVSA T  EK+ +++ M++G+  YA++FG ++ I Q++ S  ARYH  MS +++FI+ H +P  L +R+ +Y   +W+ T GID   VL   P  ++AD+C+HLNR + +   AF  ++ GCLR+L++ F+T H+ PGD + H+G+ +  L F+  GS+E++ DD  ++ ILG+ DIFGE    +P   +++  S+  VRALTYCDLH I RD LL +LD Y  F  +F +NL +TY+L+      RK  D  +   +      D      D +H    VR+    + R   +  D+  S       D+  E  AN   R+   +S+ ++   + NK     ETLIKL  ++S
Sbjct:   22 ATTSSGAGNAVASQAKQLMVVLQSGSYKVLSLG-------ADVLPEYKLQPTRIHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLLLV---STNSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAELSHKE-YTWLHQLSKQLAQPYTSTNGT-IPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGE----NPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYPEFAETFCKNLTITYNLRDDAQSLRKKFDRHKLLRMSSSMNKDRYTTPPDGDHGNAAVRRSAESVSRCDSNPIDRRQSAGSRNRSDDYEERRANMFGRR--LESIESQMERMQNKFNSDMETLIKLVKEQS 653          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 386.341 bits (991), Expect = 2.144e-119
Identity = 255/706 (36.12%), Postives = 377/706 (53.40%), Query Frame = 3
Query:  669 STSLSKVGIGVAVDAKSVSDYIK---YDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXX--------XXNFHTTFVGPNGE---VISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDE-IVAILGQGDIFGEAFWKDP---NKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRI-IFRKLSDVXXXXXXXXXXXNDNLFEDLDPNH---PVRKMISKL-RKGLHSTDQTNST-----VDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQES----------------ENNNCVSKVSPAPDQSKQRQPSKMLWQRLKHPEPIREVEE 2654
            +T+ S  G  VA  AK +   ++   Y V S G       ++ LP Y+ +  +     I+HY  FKAVWDWIIL+L  YTAV  PY AAF  R + D       +    +  + +        + NF TT+V  N E   V+SDP  I  +Y KGWF+ID+++ +P+D+       T     ++L   LK  RLLR+ RV RKLD+Y EY A  L+L++  F L+AHWLACIW++IG A+L +K  Y W+ +LS          N T I    P     Y+TSLY+TLS ITSIGFGNVSA T  EK+ +++ M++G+  YA++FG ++ I Q++ S  ARYH  MS +++FI+ H +P  L +R+ +Y   +W+ T GID   VL   P  ++AD+C+HLNR + +   AF  ++ GCLR+L++ F+T H+ PGD + H+G+ +  L F+  GS+E++ DD  ++ ILG+ DIFGE    +P   +++  S+  VRALTYCDLH I RD LL +LD Y  F  +F +NL +TY+L+      RK  D  +   +      D      D +H    VR+    + R   +  D+  S       D+  E  AN   R+   +S+ ++   + NK     ETLIKL  ++S                  NN +S     P+        +M   RL   EP    +E
Sbjct:   22 ATTSSGAGNAVASQAKQLMVVLQSGSYKVLSLG-------ADVLPEYKLQPTRIHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLLLV---STNSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAELSHKE-YTWLHQLSKQLAQPYTSTNGT-IPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGE----NPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYPEFAETFCKNLTITYNLRDDAQSLRKKFDRHKLLRMSSSMNKDRYTTPPDGDHGNAAVRRSAESVSRCDSNPIDRRQSAGSRNRSDDYEERRANMFGRR--LESIESQMERMQNKFNSDMETLIKLVKEQSIIRNNGSSNEEPNARYRPNNYISSAIRLPNGGGGGVVDEMRVSRLSSHEPPTPTQE 709          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: eag (gene:FBgn0000535 transcript:FBtr0310016)

HSP 1 Score: 841.262 bits (2172), Expect = 0.000e+0
Identity = 431/744 (57.93%), Postives = 556/744 (74.73%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQ-HSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQA--TCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSK--DSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRN--WKNITNIQ-DNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M G RRGLVAPQNTFL+ IIRR NSQ  S+F LAN+ I ++PI+Y +E FCK+SGY++ EV+ +     C FM+G+ T  E   R +   E    +Q E+L YKKNK  LWL+ QV+PIRNE+D + LFL+TF++ITALK   + ED+      SKFA+LAR+VT++R    H+ T                  + D  K   +S       + ++ +P YRQEAPKTPPHI+LHY  FKA+WDW+IL LT YTA+MVPYN AFK++  +D+  LVVDSIVDV+FFIDIV NFHTTFVGP GEV+SDP VIR+NYLK WF+IDLLSCLPYDVFNAF  +  +  I SLFSALKVVRLLR+GRV RKLD+YLEY A  LIL++  ++L+AHWLACIW+SIG +D  N + Y W+ +L+N T    +  W N T  +  N P +  +Y+T+LY+T++ +TS+GFGNV+A T  EK+ ++  M+I A  YATIFG +TTI QQM S  A+YH+M++NV++F+K H VP+ L+ERV+DY+ S+WA+TKG+DT KVLNYCPKDMKAD+C+HLNR VFN+H AFRLASDGCLR+LA++F   H+APGDL++H GESID LCF+V+GSLEVIQDDE+VAILG+GD+FG+ FWKD + +  S A VRALTYCDLH IKRD LL +LDFY+AF NSFARNLVLTY+L+HR+IFRK++DVKREKEL E+RKN+      + +H VRK+ SK R+
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRYVCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNKTPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSEDTKGVLGLSKFAKLARSVTRSRQFSAHLPT------------------LKDPTK---QSNLAHMMSLSADIMPQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFKNKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFNAF--DRDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYSWLWKLANVTQSPYSYIWSNDTGPELVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTEKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFMMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILGKGDVFGDQFWKD-SAVGQSAANVRALTYCDLHAIKRDKLLEVLDFYSAFANSFARNLVLTYNLRHRLIFRKVADVKREKELAERRKNEPQLPQ-NQDHLVRKIFSKFRR 719          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: eag (gene:FBgn0000535 transcript:FBtr0303286)

HSP 1 Score: 833.943 bits (2153), Expect = 0.000e+0
Identity = 436/796 (54.77%), Postives = 565/796 (70.98%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQ-HSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKN-----------------KNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSK--DSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRN--WKNITNIQ-DNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWT 2471
            M G RRGLVAPQNTFL+ IIRR NSQ  S+F LAN+ I ++PI+Y +E FCK+SGY++ EV+ +   C FM+G+ T  E   R +   E    +Q E+L YKKN                 +  LWL+ QV+PIRNE+D + LFL+TF++ITALK   + ED+      SKFA+LAR+VT++R    H+ T                  + D  K   +S       + ++ +P YRQEAPKTPPHI+LHY  FKA+WDW+IL LT YTA+MVPYN AFK++  +D+  LVVDSIVDV+FFIDIV NFHTTFVGP GEV+SDP VIR+NYLK WF+IDLLSCLPYDVFNAF  +  +  I SLFSALKVVRLLR+GRV RKLD+YLEY A  LIL++  ++L+AHWLACIW+SIG +D  N + Y W+ +L+N T    +  W N T  +  N P +  +Y+T+LY+T++ +TS+GFGNV+A T  EK+ ++  M+I A  YATIFG +TTI QQM S  A+YH+M++NV++F+K H VP+ L+ERV+DY+ S+WA+TKG+DT KVLNYCPKDMKAD+C+HLNR VFN+H AFRLASDGCLR+LA++F   H+APGDL++H GESID LCF+V+GSLEVIQDDE+VAILG+GD+FG+ FWKD + +  S A VRALTYCDLH IKRD LL +LDFY+AF NSFARNLVLTY+L+HR+IFRK++DVKREKEL E+RKN+      + +H VRK+ SK R+       +   V  S +      D +     L  K T
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNNLQCGCALSQFGKAQTQETPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSEDTKGVLGLSKFAKLARSVTRSRQFSAHLPT------------------LKDPTK---QSNLAHMMSLSADIMPQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFKNKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFNAF--DRDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYSWLWKLANVTQSPYSYIWSNDTGPELVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTEKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFMMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILGKGDVFGDQFWKD-SAVGQSAANVRALTYCDLHAIKRDKLLEVLDFYSAFANSFARNLVLTYNLRHRLIFRKVADVKREKELAERRKNEPQLPQ-NQDHLVRKIFSKFRRTPQVQAGSKELVGGSGQSDVEKGDGEVERTKLPAKLT 771          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: eag (gene:FBgn0000535 transcript:FBtr0111009)

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 436/798 (54.64%), Postives = 565/798 (70.80%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQ-HSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQA--TCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKN-----------------KNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSK--DSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRN--WKNITNIQ-DNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWT 2471
            M G RRGLVAPQNTFL+ IIRR NSQ  S+F LAN+ I ++PI+Y +E FCK+SGY++ EV+ +     C FM+G+ T  E   R +   E    +Q E+L YKKN                 +  LWL+ QV+PIRNE+D + LFL+TF++ITALK   + ED+      SKFA+LAR+VT++R    H+ T                  + D  K   +S       + ++ +P YRQEAPKTPPHI+LHY  FKA+WDW+IL LT YTA+MVPYN AFK++  +D+  LVVDSIVDV+FFIDIV NFHTTFVGP GEV+SDP VIR+NYLK WF+IDLLSCLPYDVFNAF  +  +  I SLFSALKVVRLLR+GRV RKLD+YLEY A  LIL++  ++L+AHWLACIW+SIG +D  N + Y W+ +L+N T    +  W N T  +  N P +  +Y+T+LY+T++ +TS+GFGNV+A T  EK+ ++  M+I A  YATIFG +TTI QQM S  A+YH+M++NV++F+K H VP+ L+ERV+DY+ S+WA+TKG+DT KVLNYCPKDMKAD+C+HLNR VFN+H AFRLASDGCLR+LA++F   H+APGDL++H GESID LCF+V+GSLEVIQDDE+VAILG+GD+FG+ FWKD + +  S A VRALTYCDLH IKRD LL +LDFY+AF NSFARNLVLTY+L+HR+IFRK++DVKREKEL E+RKN+      + +H VRK+ SK R+       +   V  S +      D +     L  K T
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRYVCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNNLQCGCALSQFGKAQTQETPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSEDTKGVLGLSKFAKLARSVTRSRQFSAHLPT------------------LKDPTK---QSNLAHMMSLSADIMPQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFKNKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFNAF--DRDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYSWLWKLANVTQSPYSYIWSNDTGPELVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTEKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFMMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILGKGDVFGDQFWKD-SAVGQSAANVRALTYCDLHAIKRDKLLEVLDFYSAFANSFARNLVLTYNLRHRLIFRKVADVKREKELAERRKNEPQLPQ-NQDHLVRKIFSKFRRTPQVQAGSKELVGGSGQSDVEKGDGEVERTKLPAKLT 773          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: eag (gene:FBgn0000535 transcript:FBtr0073955)

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 430/761 (56.50%), Postives = 556/761 (73.06%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQ-HSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQA--TCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKN-----------------KNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSK--DSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRN--WKNITNIQ-DNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M G RRGLVAPQNTFL+ IIRR NSQ  S+F LAN+ I ++PI+Y +E FCK+SGY++ EV+ +     C FM+G+ T  E   R +   E    +Q E+L YKKN                 +  LWL+ QV+PIRNE+D + LFL+TF++ITALK   + ED+      SKFA+LAR+VT++R    H+ T                  + D  K   +S       + ++ +P YRQEAPKTPPHI+LHY  FKA+WDW+IL LT YTA+MVPYN AFK++  +D+  LVVDSIVDV+FFIDIV NFHTTFVGP GEV+SDP VIR+NYLK WF+IDLLSCLPYDVFNAF  +  +  I SLFSALKVVRLLR+GRV RKLD+YLEY A  LIL++  ++L+AHWLACIW+SIG +D  N + Y W+ +L+N T    +  W N T  +  N P +  +Y+T+LY+T++ +TS+GFGNV+A T  EK+ ++  M+I A  YATIFG +TTI QQM S  A+YH+M++NV++F+K H VP+ L+ERV+DY+ S+WA+TKG+DT KVLNYCPKDMKAD+C+HLNR VFN+H AFRLASDGCLR+LA++F   H+APGDL++H GESID LCF+V+GSLEVIQDDE+VAILG+GD+FG+ FWKD + +  S A VRALTYCDLH IKRD LL +LDFY+AF NSFARNLVLTY+L+HR+IFRK++DVKREKEL E+RKN+      + +H VRK+ SK R+
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRYVCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNNLQCGCALSQFGKAQTQETPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSEDTKGVLGLSKFAKLARSVTRSRQFSAHLPT------------------LKDPTK---QSNLAHMMSLSADIMPQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFKNKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFNAF--DRDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYSWLWKLANVTQSPYSYIWSNDTGPELVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTEKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFMMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILGKGDVFGDQFWKD-SAVGQSAANVRALTYCDLHAIKRDKLLEVLDFYSAFANSFARNLVLTYNLRHRLIFRKVADVKREKELAERRKNEPQLPQ-NQDHLVRKIFSKFRR 736          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: eag (gene:FBgn0000535 transcript:FBtr0310014)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 297/549 (54.10%), Postives = 392/549 (71.40%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQ-HSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQA--TCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRN--WKNITNIQ-DNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKV 1781
            M G RRGLVAPQNTFL+ IIRR NSQ  S+F LAN+ I ++PI+Y +E FCK+SGY++ EV+ +     C FM+G+ T  E   R +   E    +Q E+L YKKNK  LWL+ QV+PIRNE+D + LFL+TF++ITALK   + ED+    SKFA+LAR+VT++R    H+ T                  + D  K   +S       + ++ +P YRQEAPKTPPHI+LHY  FKA+WDW+IL LT YTA+MVPYN AFK++  +D+  LVVDSIVDV+FFIDIV NFHTTFVGP GEV+SDP VIR+NYLK WF+IDLLSCLPYDVFNAF  +  +  I SLFSALKVVRLLR+GRV RKLD+YLEY A  LIL++  ++L+AHWLACIW+SIG +D  N + Y W+ +L+N T    +  W N T  +  N P +  +Y+T+LY+T++ +TS+GFGNV+A T  EK+ ++  M+I A  YATIFG +TTI QQM S  A+YH+M++NV++F+K H VP+ L+ERV+DY+ S+WA+TKG+DT KV
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRYVCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNKTPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSEDTKGGLSKFAKLARSVTRSRQFSAHLPT------------------LKDPTK---QSNLAHMMSLSADIMPQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFKNKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFNAF--DRDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYSWLWKLANVTQSPYSYIWSNDTGPELVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTEKV 526          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 436/884 (49.32%), Postives = 588/884 (66.52%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADL----QNKVFY-GWIPRLSNDTMH-YRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKL-PLQESENNNCVSK----VSPAPDQSKQRQPSKMLWQRLKHP--------EPIREVEEVSPLPDKN-FEEELISIQSADIAEGNVNNGD 2744
            M G RRGLVAPQNTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ +  E  ++ +  FE       E+L YKKN+  +W   +++PIRNE+D++ LFL TF +ITA K    D DSSK   KFARL R +T +R +LQ ++ +               +   + +K+   S   +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NY+K WFVIDLLSCLPYDV NAF  E     ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHWLACIW+SIG  ++     N V    W+  L       Y    + +   +  P K  VYITSLY+T++ +TSIGFGN++  T GEK+ +V  M+IG+  YATIFG +T IFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI S+W++++GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQTIH+APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+ N L+ S A VRALTYCDLH IKRD L  +L+FY AF   F+RNLVLTY+L+ RI+FRK+SDVKRE+E   +RKN+    +L P+HPVR++  + R+   +  +  +   N  E        + +        TS++   +  P TL  L P   S    C +K    ++P   Q     P    W R K            + + E +  LPD+   ++EL+S++  D  +  +   D
Sbjct:    1 MAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELSDKETSEKLRQTFENYEMNSFELLMYKKNRMPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIED-DSSKGWGKFARLTRALTSSRGVLQQLAPT--------------VQRGENVLKH---SRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYVKTWFVIDLLSCLPYDVINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDQDANMVRTDSWLYLLGEAVGQPYHFNASGSGKWEGGPSKDSVYITSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTNIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTDKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTIHSAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEVN-LAQSCANVRALTYCDLHIIKRDALQKVLEFYTAFAGHFSRNLVLTYNLRKRIVFRKISDVKREEEEMLRRKNEAPL-NLPPDHPVRRLFQRFRQQREA--RLAAERANQVEQDVEKGKSEQTVVKEITSPTSIITVTE-SPATLNTLSPTTPSTKTLCRAKLNTPLAPNTAQKSAEAPKSKGWSRFKEATAKSDLSLSSVSKAESMEMLPDRTKSQDELLSLKKTDSCDSGITKSD 856          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnh1a (potassium voltage-gated channel, subfamily H (eag-related), member 1a [Source:ZFIN;Acc:ZDB-GENE-061226-1])

HSP 1 Score: 797.349 bits (2058), Expect = 0.000e+0
Identity = 432/859 (50.29%), Postives = 582/859 (67.75%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADL----QNKVFY-GWIPRLSNDT-MHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHS-TDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQESENNNCVSKV---SPAPDQSKQRQPSKMLWQRLKH----PEP---IREVEEVSPLPDKN 2678
            M G RRGLVAPQNTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  ++ +  FE       E+L YKKN+  +W   +++PIRNE++++ LFL TF +ITA K    D DSSK   KFARL R +T +R +LQ +  +      V  G  V   S              +  ++ S+ LP Y+QE PKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYDV NAF  E     ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHWLACIW+SIG  ++    +N V    W+  L+      YR   + T   +  P K  VYITSLY+T++ +TSIGFGN++  T GEK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI+S+W+++ GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQTIH APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+ + A VRALTYCDLH IKRD L  +L+FY AF N F+RNL+LTY+L+ R++FRK+SDVKRE+E   +RKN+    +L P+HPVR++  + R+   +         ++S        +   S D +A   TS++   +  P T I   L ++       +    +PAP+ S+  +P    W R +     PE    + + E +  LP+++
Sbjct:    1 MAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTSEKVRLTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQEKVVLFLCTFSDITAFKQPIED-DSSKGWGKFARLTRALTSSRGVLQQLQPT------VHKGENVHKHSRL-----------AEVLQLGSDILPQYKQETPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEDRNTVRTDSWLYMLAESIGTPYRFNASGTGRWEGGPTKDTVYITSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIASTWSMSHGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTIHCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEVT-LAQACANVRALTYCDLHVIKRDALQKVLEFYTAFSNHFSRNLLLTYNLRKRLVFRKISDVKREEEERLRRKNEAPL-NLPPDHPVRRLFQRFRQQKEARLAAVRPNSEDSDLEKGQIHNEVISQDVIAT--TSIVTVTE-SPATPIPSHLIKNRTLGPFDQAKLSAPAPNASRMSEPRARGWARFRESVAKPESWGNVPKAESMETLPERS 831          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnh5b (potassium voltage-gated channel, subfamily H (eag-related), member 5b [Source:ZFIN;Acc:ZDB-GENE-090319-1])

HSP 1 Score: 796.579 bits (2056), Expect = 0.000e+0
Identity = 408/742 (54.99%), Postives = 539/742 (72.64%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGH---ADLQNKVFY--GWIPRLSNDTMH-YRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M G +RGLVAPQNTFL+ I+RR  S  ++F L N+ I ++P++YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  D+ + AF+       EVL Y+KN+  +W   Q++PIRNE D++ LFL TFK+IT  K    DE S++  +KFARL R +T ++S +Q ++  S +          D  S       +V   G       S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++ +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDPN+IR+NYLK WFVIDLLSCLPYD+ NAF  E     ISSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG     D Q        W+ +L+      YR   + T   +  P K  +YITSLY+T++ +T+IGFGN++  T GEK+ SV  M++G+  YATIFG +TTIFQQM +   RYHEM++NV+DF+K + VP+ L+ERV+DYI S+W+++KGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLRSLA+ FQ IH+APGDLIFH GES+D LCFVVSGSLEVIQDDE++AILG+GD+FG+ FWK+   L+HS A VRALTYCDLH IKR+ LL +LDFY AF NSF+RNL LT +L+ R +FRK+ DVK+E+E  ++ KN+     +  +HPVRK+  K ++
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVDWPVVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKKTIDKVRQAFDNYESNCFEVLLYRKNRTPVWFYMQIAPIRNENDKVVLFLCTFKDITVFKQPIEDE-STRGWTKFARLTRALTNSKSTIQQITPVSRT----------DVTSHKPSRLAEVLQLG-------SDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPNLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEQTNTIKTDSWLFQLATSIGSPYRYNASGTGQWEGGPGKDSLYITSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRSLAVEFQMIHSAPGDLIFHAGESVDLLCFVVSGSLEVIQDDEVIAILGKGDVFGDVFWKE-TTLAHSCANVRALTYCDLHIIKREALLKVLDFYTAFANSFSRNLFLTCNLRKRFVFRKIIDVKKEEEERQRSKNEVPLT-IPVDHPVRKLFQKFKQ 717          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnh5b (potassium voltage-gated channel, subfamily H (eag-related), member 5b [Source:ZFIN;Acc:ZDB-GENE-090319-1])

HSP 1 Score: 795.038 bits (2052), Expect = 0.000e+0
Identity = 408/742 (54.99%), Postives = 539/742 (72.64%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGH---ADLQNKVFY--GWIPRLSNDTMH-YRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M G +RGLVAPQNTFL+ I+RR  S  ++F L N+ I ++P++YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  D+ + AF+       EVL Y+KN+  +W   Q++PIRNE D++ LFL TFK+IT  K    DE S++  +KFARL R +T ++S +Q ++  S +          D  S       +V   G       S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++ +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDPN+IR+NYLK WFVIDLLSCLPYD+ NAF  E     ISSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG     D Q        W+ +L+      YR   + T   +  P K  +YITSLY+T++ +T+IGFGN++  T GEK+ SV  M++G+  YATIFG +TTIFQQM +   RYHEM++NV+DF+K + VP+ L+ERV+DYI S+W+++KGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLRSLA+ FQ IH+APGDLIFH GES+D LCFVVSGSLEVIQDDE++AILG+GD+FG+ FWK+   L+HS A VRALTYCDLH IKR+ LL +LDFY AF NSF+RNL LT +L+ R +FRK+ DVK+E+E  ++ KN+     +  +HPVRK+  K ++
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVDWPVVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKKTIDKVRQAFDNYESNCFEVLLYRKNRTPVWFYMQIAPIRNENDKVVLFLCTFKDITVFKQPIEDE-STRGWTKFARLTRALTNSKSTIQQITPVSRT----------DVTSHKPSRLAEVLQLG-------SDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPNLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEQTNTIKTDSWLFQLATSIGSPYRYNASGTGQWEGGPGKDSLYITSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRSLAVEFQMIHSAPGDLIFHAGESVDLLCFVVSGSLEVIQDDEVIAILGKGDVFGDVFWKE-TTLAHSCANVRALTYCDLHIIKREALLKVLDFYTAFANSFSRNLFLTCNLRKRFVFRKIIDVKKEEEERQRSKNEVPLT-IPVDHPVRKLFQKFKQ 717          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnh5a (potassium voltage-gated channel, subfamily H (eag-related), member 5a [Source:ZFIN;Acc:ZDB-GENE-061106-2])

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 407/784 (51.91%), Postives = 549/784 (70.03%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQ----------------PETTQS-------------AISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYG-----WIPRLS-NDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVD 2399
            M+G +RGLVAPQNTFL+ ++RR  S  ++F L N+ I  +PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  D+ +  F+       EVL YKKN+  +WL  QV+PIRNE D++ LFL TFK+IT  K    DE +++  +KFARL R +T +R  +Q +    T ++K  +                  S   +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++V+LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF+                P    S              +SSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++         W+ +L+ +    YR   + +   +  P K  +YI+SLY+T++ +T+IGFGN++  T GEK+ SV  M++G+  YATIFG +TTIFQQM +   RYHEM++NV+DF+K + VP+ L+ERV+DYI S+WA+TKGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLRSLA+ FQT H APGDLIFH GES+D LCFVVSGSLEVIQDDE++AILG+GD+FG+ FWK+ + L+H+ A VRALTYCDLH I+RD LL +L+FY AF NSF+RNL+LT +L+ RI+FRK++DVK+E+E    +KN+     +  +HPVRK+  K ++      Q  S  D
Sbjct:    1 MHGGKRGLVAPQNTFLENVVRR--SSENSFLLGNAQIVEWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKKTIDKVRQTFDNYESNCFEVLLYKKNRTPVWLHMQVAPIRNENDKVVLFLCTFKDITVFKQPIEDE-TTRGWTKFARLTRALTNSRGTVQQL----TPMNKTEVS--------------HKHSRLAEALQLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNLVWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFENVDEDTFVDSSAVGHLPSAGHSPRNATRAEDSVLPGLSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEATNSLKTDSWLYQLAISIGTPYRYNASGSGHWEGGPSKHTLYISSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYTNTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWAMTKGIDTEKVLSICPKDMRADICVHLNRQVFNEHPAFRLASDGCLRSLAVEFQTTHCAPGDLIFHAGESVDTLCFVVSGSLEVIQDDEVIAILGKGDVFGDVFWKE-SSLAHACANVRALTYCDLHVIRRDALLKVLEFYTAFANSFSRNLILTCNLRKRIVFRKIADVKKEEEERRHQKNEVTL-SIPVDHPVRKLFQKFKQQKEMRTQGPSQYD 760          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tmem50b (transmembrane protein 50B [Source:Xenbase;Acc:XB-GENE-970258])

HSP 1 Score: 793.497 bits (2048), Expect = 0.000e+0
Identity = 406/757 (53.63%), Postives = 554/757 (73.18%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLS-NDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLR--KGLHSTDQTNSTVD 2399
            M G +RGLVAPQNTFL+ I+RR N   S+F L N+ I ++P++YS++GFCK+SGY + +++ + +TC+FM+G+ T  +  ++ +  FE       EVL YKK++  +W   Q++PIRNE +++ LFL TFK+IT  K    DE S++  +KFARL R +T +RS+LQ +    T ++K        A+ V  + +        +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  ++I +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     +SSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++V        W+ +L  +    YR   + +   +  P K  +Y++SLY+T++ +T+IGFGN++  T GEK+ SV  M++G+  YATIFG +TTIFQQM +   RYHE+++NV+DF+K + VP+ L+ERV+DYI S+W+++KGIDT KVL  CPKDM+AD+C+HLNR VFN+H AFRLASDGCLRSLA+ FQTIH APGDLI+H GES+D LCFVVSGSLEVIQD+E+VAILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH IKR+ LL +LDFY AF NSF+RNL LT +L+ RI+FRK+SDVK+E+E  +++KN+     +  +HPVRK+  K +  K L +   TNS ++
Sbjct:    4 MPGGKRGLVAPQNTFLENIVRRSN--ESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADIMQKSSTCSFMYGELTDKKTIEKVRQTFENYESNCFEVLLYKKSRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDE-STRGWTKFARLTRALTNSRSVLQQL----TPMNK--------AEVVHKHSRL------AEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGMSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKKDSWLYQLGLSIGTPYRYNASGSGQWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEVLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLGICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRSLAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQDEEVVAILGKGDVFGDVFWKE-TTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKRIVFRKISDVKKEEEERQRQKNEVTL-SIPVDHPVRKLFQKFKQQKELRNQGSTNSDLE 734          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tmem50b (transmembrane protein 50B [Source:Xenbase;Acc:XB-GENE-970258])

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 406/757 (53.63%), Postives = 553/757 (73.05%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLS-NDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLR--KGLHSTDQTNSTVD 2399
            M G +RGLVAPQNTFL+ I+RR N    NF L N+ I ++P++YS++GFCK+SGY + +++ + +TC+FM+G+ T  +  ++ +  FE       EVL YKK++  +W   Q++PIRNE +++ LFL TFK+IT  K    DE S++  +KFARL R +T +RS+LQ +    T ++K        A+ V  + +        +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  ++I +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     +SSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++V        W+ +L  +    YR   + +   +  P K  +Y++SLY+T++ +T+IGFGN++  T GEK+ SV  M++G+  YATIFG +TTIFQQM +   RYHE+++NV+DF+K + VP+ L+ERV+DYI S+W+++KGIDT KVL  CPKDM+AD+C+HLNR VFN+H AFRLASDGCLRSLA+ FQTIH APGDLI+H GES+D LCFVVSGSLEVIQD+E+VAILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH IKR+ LL +LDFY AF NSF+RNL LT +L+ RI+FRK+SDVK+E+E  +++KN+     +  +HPVRK+  K +  K L +   TNS ++
Sbjct:    4 MPGGKRGLVAPQNTFLENIVRRSNG---NFLLGNAQIVDWPVVYSNDGFCKLSGYHRADIMQKSSTCSFMYGELTDKKTIEKVRQTFENYESNCFEVLLYKKSRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDE-STRGWTKFARLTRALTNSRSVLQQL----TPMNK--------AEVVHKHSRL------AEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGMSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKKDSWLYQLGLSIGTPYRYNASGSGQWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEVLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLGICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRSLAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQDEEVVAILGKGDVFGDVFWKE-TTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKRIVFRKISDVKKEEEERQRQKNEVTL-SIPVDHPVRKLFQKFKQQKELRNQGSTNSDLE 733          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tmem50b (transmembrane protein 50B [Source:Xenbase;Acc:XB-GENE-970258])

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 406/757 (53.63%), Postives = 553/757 (73.05%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLS-NDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLR--KGLHSTDQTNSTVD 2399
            M G +RGLVAPQNTFL+ I+RR N    NF L N+ I ++P++YS++GFCK+SGY + +++ + +TC+FM+G+ T  +  ++ +  FE       EVL YKK++  +W   Q++PIRNE +++ LFL TFK+IT  K    DE S++  +KFARL R +T +RS+LQ +    T ++K        A+ V  + +        +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  ++I +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     +SSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++V        W+ +L  +    YR   + +   +  P K  +Y++SLY+T++ +T+IGFGN++  T GEK+ SV  M++G+  YATIFG +TTIFQQM +   RYHE+++NV+DF+K + VP+ L+ERV+DYI S+W+++KGIDT KVL  CPKDM+AD+C+HLNR VFN+H AFRLASDGCLRSLA+ FQTIH APGDLI+H GES+D LCFVVSGSLEVIQD+E+VAILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH IKR+ LL +LDFY AF NSF+RNL LT +L+ RI+FRK+SDVK+E+E  +++KN+     +  +HPVRK+  K +  K L +   TNS ++
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRRSNG---NFLLGNAQIVDWPVVYSNDGFCKLSGYHRADIMQKSSTCSFMYGELTDKKTIEKVRQTFENYESNCFEVLLYKKSRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDE-STRGWTKFARLTRALTNSRSVLQQL----TPMNK--------AEVVHKHSRL------AEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGMSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKKDSWLYQLGLSIGTPYRYNASGSGQWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEVLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLGICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRSLAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQDEEVVAILGKGDVFGDVFWKE-TTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKRIVFRKISDVKKEEEERQRQKNEVTL-SIPVDHPVRKLFQKFKQQKELRNQGSTNSDLE 730          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tmem50b (transmembrane protein 50B [Source:Xenbase;Acc:XB-GENE-970258])

HSP 1 Score: 791.571 bits (2043), Expect = 0.000e+0
Identity = 430/896 (47.99%), Postives = 605/896 (67.52%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLS-NDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLR--KGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGP--ETLIKLPLQES--ENNNCVSKVSPAPDQSKQRQPSKMLWQRLKHPEPIREVEEVSPLPDKNFEEELISIQSADIAEGNVNNGDISKLLNAMQNRFSMEISSLH 2804
            M G +RGLVAPQNTFL+ I+RR N    NF L N+ I ++P++YS++GFCK+SGY + +++ + +TC+FM+G+ T  +  ++ +  FE       EVL YKK++  +W   Q++PIRNE +++ LFL TFK+IT  K    DE S++  +KFARL R +T +RS+LQ +    T ++K        A+ V  + +        +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  ++I +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     +SSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++V        W+ +L  +    YR   + +   +  P K  +Y++SLY+T++ +T+IGFGN++  T GEK+ SV  M++G+  YATIFG +TTIFQQM +   RYHE+++NV+DF+K + VP+ L+ERV+DYI S+W+++KGIDT KVL  CPKDM+AD+C+HLNR VFN+H AFRLASDGCLRSLA+ FQTIH APGDLI+H GES+D LCFVVSGSLEVIQD+E+VAILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH IKR+ LL +LDFY AF NSF+RNL LT +L+ RI+FRK+SDVK+E+E  +++KN+     +  +HPVRK+  K +  K L +   TNS +    E +    + +S ++      TS++   ++ P   +L  +   ES  +NN    ++ P+   S  ++  K  W  +   E +  + +     D         ++  D  +  +   D+ +L  A + R  +E S L 
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRRSNG---NFLLGNAQIVDWPVVYSNDGFCKLSGYHRADIMQKSSTCSFMYGELTDKKTIEKVRQTFENYESNCFEVLLYKKSRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDE-STRGWTKFARLTRALTNSRSVLQQL----TPMNK--------AEVVHKHSRL------AEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGMSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKKDSWLYQLGLSIGTPYRYNASGSGQWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEVLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLGICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRSLAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQDEEVVAILGKGDVFGDVFWKE-TTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKRIVFRKISDVKKEEEERQRQKNEVTL-SIPVDHPVRKLFQKFKQQKELRNQGSTNSDL----ERNQLQVEHRSMHNGAVLTGTSVVTVSQITPIQTSLSYVRTNESLKQNNRDAMELKPS-SSSDTKKEKKEDWNNVTKAESLGLLSDDPKCTDPESNVSKNPLRKTDSCDSGITKSDL-RLDKAGETRSPLEHSPLQ 863          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tmem50b (transmembrane protein 50B [Source:Xenbase;Acc:XB-GENE-970258])

HSP 1 Score: 790.801 bits (2041), Expect = 0.000e+0
Identity = 406/757 (53.63%), Postives = 553/757 (73.05%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLS-NDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLR--KGLHSTDQTNSTVD 2399
            M G +RGLVAPQNTFL+ I+RR N    NF L N+ I ++P++YS++GFCK+SGY + +++ + +TC+FM+G+ T  +  ++ +  FE       EVL YKK++  +W   Q++PIRNE +++ LFL TFK+IT  K    DE S++  +KFARL R +T +RS+LQ +    T ++K        A+ V  + +        +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  ++I +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     +SSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++V        W+ +L  +    YR   + +   +  P K  +Y++SLY+T++ +T+IGFGN++  T GEK+ SV  M++G+  YATIFG +TTIFQQM +   RYHE+++NV+DF+K + VP+ L+ERV+DYI S+W+++KGIDT KVL  CPKDM+AD+C+HLNR VFN+H AFRLASDGCLRSLA+ FQTIH APGDLI+H GES+D LCFVVSGSLEVIQD+E+VAILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH IKR+ LL +LDFY AF NSF+RNL LT +L+ RI+FRK+SDVK+E+E  +++KN+     +  +HPVRK+  K +  K L +   TNS ++
Sbjct:    4 MPGGKRGLVAPQNTFLENIVRRSNG---NFLLGNAQIVDWPVVYSNDGFCKLSGYHRADIMQKSSTCSFMYGELTDKKTIEKVRQTFENYESNCFEVLLYKKSRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDE-STRGWTKFARLTRALTNSRSVLQQL----TPMNK--------AEVVHKHSRL------AEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGMSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKKDSWLYQLGLSIGTPYRYNASGSGQWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEVLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLGICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRSLAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQDEEVVAILGKGDVFGDVFWKE-TTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKRIVFRKISDVKKEEEERQRQKNEVTL-SIPVDHPVRKLFQKFKQQKELRNQGSTNSDLE 733          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnh5 (potassium voltage-gated channel, subfamily H (eag-related), member 5 [Source:MGI Symbol;Acc:MGI:3584508])

HSP 1 Score: 798.119 bits (2060), Expect = 0.000e+0
Identity = 424/844 (50.24%), Postives = 583/844 (69.08%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKV-----FYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGP--ETLIKLPLQES--ENNNCVSKVSP----APDQSKQRQPSKML------WQRLKH 2627
            M G +RGLVAPQNTFL+ I+RR  S  S+F L N+ I ++P++YS++GFCK+SGY + +V+ + +TC+FM+G+ T  +  ++ +  F+       EVL YKKN+  +W   Q++PIRNE +++ LFL TFK+IT  K    D DS+K  +KFARL R +T +RS+LQ +    T ++K         ++V  + +        +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  ++I +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     ISSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++V        W+ +L+        +     I +  P K  +Y++SLY+T++ +T+IGFGN++  T  EK+ SV  M++G+  YATIFG +TTIFQQM +   RYHEM++NV+DF+K + VP+ L+ERV+DYI S+W+++KGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLR+LA+ FQTIH APGDLI+H GES+D LCFVVSGSLEVIQD+E+VAILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH IKR+ LL +LDFY AF NSF+RNL LT +L+ RIIFRK+SDVK+E+E   ++KN+     +  +HPVRK+  K ++      Q ++  D  PE S    + +   +  +   TS++   ++ P   +L  +   ES  +NN    ++ P     P   K   P +M       W RLK+
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIED-DSTKGWTKFARLTRALTNSRSVLQQL----TPMNK--------TETVHKHSRL------AEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQDEEVVAILGKGDVFGDIFWKE-TTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKRIIFRKISDVKKEEEERLRQKNEVTL-SIPVDHPVRKLFQKFKQQKELRIQGSAQSD--PERSQLQVESRPLQNGASITGTSVVTVSQITPIQTSLAYVKTSESLKQNNRDAMELKPNGGAEPKCLKVNSPIRMKNGNGKGWLRLKN 816          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnh1 (potassium voltage-gated channel, subfamily H (eag-related), member 1 [Source:MGI Symbol;Acc:MGI:1341721])

HSP 1 Score: 790.415 bits (2040), Expect = 0.000e+0
Identity = 430/902 (47.67%), Postives = 591/902 (65.52%), Query Frame = 3
Query:  147 LSMYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGH-----ADLQNKVFYGWIPRLSNDT-MHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK---GLHSTDQTNSTVDNSPEPSANT-TDRKSSYDSLANKWTSLMNKDKVGP--------ETLIKLPLQESENNNCVSKVSPAPDQSKQRQPSKMLWQRLKHP-------EPIREVEEVSPLPDKNFEEELISIQSADIAEGNVNNGDISKLLNAMQNR 2777
            ++M G RRGLVAPQNTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + + C+FM+G+ T  +  ++ +  FE       E+L YKKN+  +W   +++PIRNE+D++ LFL TF +ITA K    D DS K   KFARL R +T +R +LQ +                 A SV         S   +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDWIILILT YTA++VPYN +FK+R  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYDV NAF  E     ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHW+ACIW+SIG       D +      W+ +L+ D    Y+   + +   +  P K+ VYI+SLY+T++ +TS+GFGN++ +T  EK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI S+W++++GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQT+H APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+ S A VRALTYCDLH IKRD L  +L+FY AF +SF+RNL+LTY+L+ RI+FRK+SDVKRE+E   KRKN+     L P+HPVR++  + R+      + ++    +D+      N  TD  S+  SL       + +    P         T+       +  + C+   + + D +K++      W R K           + + E +  LP++       +++  D  +  +   D+ +L N  + R
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIED-DSCKGWGKFARLTRALTSSRGVLQQL-----------------APSVQKGENVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTRQ-NNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLALDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEAT-LAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRKNEAPL-ILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGNALTDHTSANHSLVKASVVTVRESPATPVSFQAATTSTMSDHAKLHAPGSECLGPKAVSCDPAKRKG-----WARFKDACGKGEDWNKVSKAESMETLPERTKAPGEATLKKTDSCDSGITKSDL-RLDNVGETR 871          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnh1 (potassium voltage-gated channel, subfamily H (eag-related), member 1 [Source:MGI Symbol;Acc:MGI:1341721])

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 408/769 (53.06%), Postives = 540/769 (70.22%), Query Frame = 3
Query:  147 LSMYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSA-------------------------ISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGH-----ADLQNKVFYGWIPRLSNDT-MHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            ++M G RRGLVAPQNTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + + C+FM+G+ T  +  ++ +  FE       E+L YKKN+  +W   +++PIRNE+D++ LFL TF +ITA K    D DS K   KFARL R +T +R +LQ +                 A SV         S   +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDWIILILT YTA++VPYN +FK+R  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYDV NAF+     SA                         ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHW+ACIW+SIG       D +      W+ +L+ D    Y+   + +   +  P K+ VYI+SLY+T++ +TS+GFGN++ +T  EK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI S+W++++GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQT+H APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+ S A VRALTYCDLH IKRD L  +L+FY AF +SF+RNL+LTY+L+ RI+FRK+SDVKRE+E   KRKN+     L P+HPVR++  + R+
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIED-DSCKGWGKFARLTRALTSSRGVLQQL-----------------APSVQKGENVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTRQ-NNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFENVDEVSAFMGDPGKIGFADQIPPPLEGRESQGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLALDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEAT-LAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRKNEAPL-ILPPDHPVRRLFQRFRQ 746          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnh6 (potassium voltage-gated channel, subfamily H (eag-related), member 6 [Source:MGI Symbol;Acc:MGI:2684139])

HSP 1 Score: 488.804 bits (1257), Expect = 5.017e-157
Identity = 286/737 (38.81%), Postives = 429/737 (58.21%), Query Frame = 3
Query:  165 RRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITAL--KTST--------------NDEDSSKDSSKFARLAR----TVTK---------NRSLLQHMSTSSTSLSKVGIGVAVD-AKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAF----------KSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYD--VFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHAD---LQNKVFYGWIPRLSNDTMHYRNWKNITN---IQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGE--AFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLK 2225
            RRG VAPQNT+LD IIR+   Q   F +AN+ + N  IIY ++GFC++ GYS+ EV+ +  TC+F+ G  T +    R   A       ++++L+Y+K+ +    +  V P++NE   + +F++ F+++  L  K+S+              ++   S+ S +     R    TV++           +L +H S S+T +  +     V+  ++V++ +        TQ   + ++ LP Y+ +AP+     ILHY  FKAVWDW+IL+L  YTAV  PY+AAF           +         VVD IVD++F +DIV NF TT+V  N EV+S P  I ++Y KGWF+ID+++ +P+D  +F     ETT     +L   LK  RLLR+ RV RKLD+Y EY A  L L++  F L+AHWLACIW++IG+ +   L+ K+  GW+  L      + N  +  +   +QD        Y+T+LY+T S +TS+GFGNVS NT  EK+ S+  MLIG+  YA+IFG ++ I Q++ S  ARYH  M  VK+FI+ H +P  L +R+ +Y   +W+ T GID   VL   P+ ++AD+C+HL+R +     AFR AS GCLR+LA+ F+T H  PGD + H G+ +  L F+  GS+E+++DD +VAILG+ DIFGE  +    P K   S+A VRALTYCDLH I R  LL +LD Y AF ++F   L +T++L+
Sbjct:    4 RRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVMQRPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDGAVIMFILNFEDLAQLLAKSSSRSLTQRLLSHSFLGSEGSHSRPSGQGPGPGRGKYGTVSQIPQFTLSFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKV--------TQVLSLGADVLPEYKLQAPRIHRGTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDDSQRGTCGYTCSPLTVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLIFRTGSDETT-----TLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNVERPYLEPKI--GWLDSLGAQLGKHYNGSDPASGPSVQDK-------YVTALYFTFSSLTSVGFGNVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFRGASKGCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEPASLHARPGK---SSADVRALTYCDLHKIHRADLLEVLDMYPAFADTFWNKLEVTFNLR 715          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnh6 (potassium voltage-gated channel, subfamily H (eag-related), member 6 [Source:MGI Symbol;Acc:MGI:2684139])

HSP 1 Score: 491.115 bits (1263), Expect = 9.316e-156
Identity = 286/737 (38.81%), Postives = 429/737 (58.21%), Query Frame = 3
Query:  165 RRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITAL--KTST--------------NDEDSSKDSSKFARLAR----TVTK---------NRSLLQHMSTSSTSLSKVGIGVAVD-AKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAF----------KSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYD--VFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHAD---LQNKVFYGWIPRLSNDTMHYRNWKNITN---IQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGE--AFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLK 2225
            RRG VAPQNT+LD IIR+   Q   F +AN+ + N  IIY ++GFC++ GYS+ EV+ +  TC+F+ G  T +    R   A       ++++L+Y+K+ +    +  V P++NE   + +F++ F+++  L  K+S+              ++   S+ S +     R    TV++           +L +H S S+T +  +     V+  ++V++ +        TQ   + ++ LP Y+ +AP+     ILHY  FKAVWDW+IL+L  YTAV  PY+AAF           +         VVD IVD++F +DIV NF TT+V  N EV+S P  I ++Y KGWF+ID+++ +P+D  +F     ETT     +L   LK  RLLR+ RV RKLD+Y EY A  L L++  F L+AHWLACIW++IG+ +   L+ K+  GW+  L      + N  +  +   +QD        Y+T+LY+T S +TS+GFGNVS NT  EK+ S+  MLIG+  YA+IFG ++ I Q++ S  ARYH  M  VK+FI+ H +P  L +R+ +Y   +W+ T GID   VL   P+ ++AD+C+HL+R +     AFR AS GCLR+LA+ F+T H  PGD + H G+ +  L F+  GS+E+++DD +VAILG+ DIFGE  +    P K   S+A VRALTYCDLH I R  LL +LD Y AF ++F   L +T++L+
Sbjct:    4 RRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVMQRPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDGAVIMFILNFEDLAQLLAKSSSRSLTQRLLSHSFLGSEGSHSRPSGQGPGPGRGKYGTVSQIPQFTLSFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKV--------TQVLSLGADVLPEYKLQAPRIHRGTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDDSQRGTCGYTCSPLTVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLIFRTGSDETT-----TLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNVERPYLEPKI--GWLDSLGAQLGKHYNGSDPASGPSVQDK-------YVTALYFTFSSLTSVGFGNVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFRGASKGCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEPASLHARPGK---SSADVRALTYCDLHKIHRADLLEVLDMYPAFADTFWNKLEVTFNLR 715          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q02280|KCNAE_DROME (Potassium voltage-gated channel protein eag OS=Drosophila melanogaster OX=7227 GN=eag PE=1 SV=2)

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 430/761 (56.50%), Postives = 556/761 (73.06%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQ-HSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQA--TCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKN-----------------KNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSK--DSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRN--WKNITNIQ-DNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M G RRGLVAPQNTFL+ IIRR NSQ  S+F LAN+ I ++PI+Y +E FCK+SGY++ EV+ +     C FM+G+ T  E   R +   E    +Q E+L YKKN                 +  LWL+ QV+PIRNE+D + LFL+TF++ITALK   + ED+      SKFA+LAR+VT++R    H+ T                  + D  K   +S       + ++ +P YRQEAPKTPPHI+LHY  FKA+WDW+IL LT YTA+MVPYN AFK++  +D+  LVVDSIVDV+FFIDIV NFHTTFVGP GEV+SDP VIR+NYLK WF+IDLLSCLPYDVFNAF  +  +  I SLFSALKVVRLLR+GRV RKLD+YLEY A  LIL++  ++L+AHWLACIW+SIG +D  N + Y W+ +L+N T    +  W N T  +  N P +  +Y+T+LY+T++ +TS+GFGNV+A T  EK+ ++  M+I A  YATIFG +TTI QQM S  A+YH+M++NV++F+K H VP+ L+ERV+DY+ S+WA+TKG+DT KVLNYCPKDMKAD+C+HLNR VFN+H AFRLASDGCLR+LA++F   H+APGDL++H GESID LCF+V+GSLEVIQDDE+VAILG+GD+FG+ FWKD + +  S A VRALTYCDLH IKRD LL +LDFY+AF NSFARNLVLTY+L+HR+IFRK++DVKREKEL E+RKN+      + +H VRK+ SK R+
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRYVCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNNLQCGCALSQFGKAQTQETPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSEDTKGVLGLSKFAKLARSVTRSRQFSAHLPT------------------LKDPTK---QSNLAHMMSLSADIMPQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFKNKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFNAF--DRDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYSWLWKLANVTQSPYSYIWSNDTGPELVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTEKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFMMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILGKGDVFGDQFWKD-SAVGQSAANVRALTYCDLHAIKRDKLLEVLDFYSAFANSFARNLVLTYNLRHRLIFRKVADVKREKELAERRKNEPQLPQ-NQDHLVRKIFSKFRR 736          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q8NCM2|KCNH5_HUMAN (Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens OX=9606 GN=KCNH5 PE=1 SV=3)

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 426/844 (50.47%), Postives = 583/844 (69.08%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKV-----FYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGP--ETLIKLPLQES--ENNNCVSKVSP--APDQS--KQRQPSKML------WQRLKH 2627
            M G +RGLVAPQNTFL+ I+RR  S  S+F L N+ I ++P++YS++GFCK+SGY + +V+ + +TC+FM+G+ T  +  ++ +  F+       EVL YKKN+  +W   Q++PIRNE +++ LFL TFK+IT  K    D DS+K  +KFARL R +T +RS+LQ +    T ++K  +                  S   +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  ++I +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     ISSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++V        W+ +L+        +     I +  P K  +Y++SLY+T++ +T+IGFGN++  T  EK+ SV  M++G+  YATIFG +TTIFQQM +   RYHEM++NV+DF+K + VP+ L+ERV+DYI S+W+++KGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLR+LA+ FQTIH APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH IKR+ LL +LDFY AF NSF+RNL LT +L+ RIIFRK+SDVK+E+E   ++KN+     +  +HPVRK+  K ++     +Q ++  D  PE +    + +S  +  +   TS++   ++ P   +L  +   ES  +NN    ++ P    DQ   K   P +M       W RLK+
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIED-DSTKGWTKFARLTRALTNSRSVLQQL----TPMNKTEV--------------VHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQDDEVVAILGKGDVFGDIFWKE-TTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKRIIFRKISDVKKEEEERLRQKNEVTL-SIPVDHPVRKLFQKFKQQKELRNQGSTQGD--PERNQLQVESRSLQNGASITGTSVVTVSQITPIQTSLAYVKTSESLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKN 816          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q9EPI9|KCNH5_RAT (Potassium voltage-gated channel subfamily H member 5 OS=Rattus norvegicus OX=10116 GN=Kcnh5 PE=2 SV=1)

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 410/788 (52.03%), Postives = 563/788 (71.45%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKV-----FYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGP 2501
            M G +RGLVAPQNTFL+ I+RR  S  S+F L N+ I ++P++YS++GFCK+SGY + +V+ + +TC+FM+G+ T  +  ++ +  F+       EVL YKKN+  +W   Q++PIRNE +++ LFL TFK+IT  K    D DS+K  +KFARL R +T +RS+LQ +    T ++K         ++V  + +        +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  ++I +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     ISSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++V        W+ +L+        +     I +  P K  +Y++SLY+T++ +T+IGFGN++  T  EK+ SV  M++G+  YATIFG +TTIFQQM +   RYHEM++NV+DF+K + VP+ L+ERV+DYI S+W+++KGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLR+LA+ FQTIH APGDLI+H GES+D LCFVVSGSLEVIQD+E+VAILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH IKR+ LL +LDFY AF NSF+RNL LT +L+ RIIFRK+SDVK+E+E   ++KN+     +  +HPVRK+  K ++     +Q ++  D  PE S    + +   +  +   TS++   ++ P
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIED-DSTKGWTKFARLTRALTNSRSVLQQL----TPMNK--------TETVHKHSRL------AEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQDEEVVAILGKGDVFGDIFWKE-TTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKRIIFRKISDVKKEEEERLRQKNEVTL-SIPVDHPVRKLFQKFKQQKELRNQGSAQSD--PERSQLQVESRPLQNGASITGTSVVTVSQITP 760          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q920E3|KCNH5_MOUSE (Potassium voltage-gated channel subfamily H member 5 OS=Mus musculus OX=10090 GN=Kcnh5 PE=1 SV=3)

HSP 1 Score: 798.119 bits (2060), Expect = 0.000e+0
Identity = 424/844 (50.24%), Postives = 583/844 (69.08%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKV-----FYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGP--ETLIKLPLQES--ENNNCVSKVSP----APDQSKQRQPSKML------WQRLKH 2627
            M G +RGLVAPQNTFL+ I+RR  S  S+F L N+ I ++P++YS++GFCK+SGY + +V+ + +TC+FM+G+ T  +  ++ +  F+       EVL YKKN+  +W   Q++PIRNE +++ LFL TFK+IT  K    D DS+K  +KFARL R +T +RS+LQ +    T ++K         ++V  + +        +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  ++I +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     ISSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++V        W+ +L+        +     I +  P K  +Y++SLY+T++ +T+IGFGN++  T  EK+ SV  M++G+  YATIFG +TTIFQQM +   RYHEM++NV+DF+K + VP+ L+ERV+DYI S+W+++KGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLR+LA+ FQTIH APGDLI+H GES+D LCFVVSGSLEVIQD+E+VAILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH IKR+ LL +LDFY AF NSF+RNL LT +L+ RIIFRK+SDVK+E+E   ++KN+     +  +HPVRK+  K ++      Q ++  D  PE S    + +   +  +   TS++   ++ P   +L  +   ES  +NN    ++ P     P   K   P +M       W RLK+
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIED-DSTKGWTKFARLTRALTNSRSVLQQL----TPMNK--------TETVHKHSRL------AEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQDEEVVAILGKGDVFGDIFWKE-TTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKRIIFRKISDVKKEEEERLRQKNEVTL-SIPVDHPVRKLFQKFKQQKELRIQGSAQSD--PERSQLQVESRPLQNGASITGTSVVTVSQITPIQTSLAYVKTSESLKQNNRDAMELKPNGGAEPKCLKVNSPIRMKNGNGKGWLRLKN 816          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q63472|KCNH1_RAT (Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1)

HSP 1 Score: 790.415 bits (2040), Expect = 0.000e+0
Identity = 430/902 (47.67%), Postives = 590/902 (65.41%), Query Frame = 3
Query:  147 LSMYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGH-----ADLQNKVFYGWIPRLSNDT-MHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK---GLHSTDQTNSTVDNSPEPSANT-TDRKSSYDSLANKWTSLMNKDKVGP--------ETLIKLPLQESENNNCVSKVSPAPDQSKQRQPSKMLWQRLKHP-------EPIREVEEVSPLPDKNFEEELISIQSADIAEGNVNNGDISKLLNAMQNR 2777
            ++M G RRGLVAPQNTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + + C+FM+G+ T  +  ++ +  FE       E+L YKKN+  +W   +++PIRNE+D++ LFL TF +ITA K    D DS K   KFARL R +T +R +LQ +                 A SV         S   +  ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDWIILILT YTA++VPYN +FK+R  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYDV NAF  E     ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHW+ACIW+SIG       D +      W+ +L+ D    Y+   + +   +  P K+ VYI+SLY+T++ +TS+GFGN++ +T  EK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI S+W++++GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQT+H APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+ S A VRALTYCDLH IKRD L  +L+FY AF +SF+RNL+LTY+L+ RI+FRK+SDVKRE+E   KRKN+     L P+HPVR++  + R+      + ++    +D+      N  TD  S+  SL       + +    P         T+       +  + C+   +   D +K++      W R K           + + E +  LP++       +++  D  +  +   D+ +L N  + R
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIED-DSCKGWGKFARLTRALTSSRGVLQQL-----------------APSVQKGENVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTRQ-NNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLALDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEAT-LAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRKNEAPL-ILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGNALTDHTSANHSLVKASVVTVRESPATPVSFQAASTSTVSDHAKLHAPGSECLGPKAGGGDPAKRKG-----WARFKDACGKGEDWNKVSKAESMETLPERTKASGEATLKKTDSCDSGITKSDL-RLDNVGEAR 871          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A4Z2DCB7 (Potassium voltage-gated channel subfamily H member 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_002390 PE=4 SV=1)

HSP 1 Score: 1024.62 bits (2648), Expect = 0.000e+0
Identity = 518/803 (64.51%), Postives = 616/803 (76.71%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGV---------------------------------------------------AVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYR----NWKNITNIQDNLP-PKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK-GLHSTDQTNS 2390
            M G+RRGLVAPQNTFLDKIIRRCN Q  +F LAN+ I +YPI+Y +EGF +++GYS+ +++ +  +C F +G+ TT EM++R   A +    +QIE+LFYKKN+   WL+  V+P+RNE +E+ LFL+ F++ITALKT  +DE++ K  SKFARLAR+VT+NRS+LQ +S S TS    G+ +                                                   A  +    D  K D E     T   + + +P Y+QEAPKTPPHIILHY+ FK  WDW+IL LTGYTAVMVP+NAAFKS+ MDD+ FLVVDSIVDV+FFIDIV NFHTTFVGPNGEVISD  +IRINYLKGWF++D+LSCLPYDVFNAFQPE TQS ISSLF ALKVVRLLRIGRVTRKLDQYLEYMA SL+LMI GFVLLAHWLAC+W+S+G  DL+N ++YGWIPRL ND    +    NW +      N P P+++ Y+TSLY+TLSLITSIGFGNVSA TFGEKLV+ VFMLIGAFGYATIFG +TTIFQ M +TR+RYH+MM++VKDFIKTHSVP+DLAERVIDY++S+WAITKGIDT KVLNYCPKDMKADLCIHLNRMVFN+H AFRLASDGCLR+LA+NF TIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVA LG+GD+FGE FWKDPN +SHS A+VRALTYCDLHCIK+DCLL +L FY+AF NSFARNLVLTYDLK R+IFRKL+DV+RE EL E RK DN    L  +HPVR+MI K R+ G H+   T+S
Sbjct:    1 MSGSRRGLVAPQNTFLDKIIRRCNGQFYSFVLANARIVDYPIVYCNEGFSRLTGYSRVDIMQKSGSCAFFYGEQTTKEMRERLLNALDTQTPDQIEMLFYKKNRLPFWLLVCVAPVRNECEEVVLFLLAFRDITALKTPFDDEETVKGLSKFARLARSVTRNRSVLQQLSASQTSTQNSGLNLYRNNRLMPCSGGGGGDGGGTGTTSGINDDTDVTNQIEHYGSPTLSNFQNLSASTSSRFHDSTKSDPEKAAMSTSSWL-DLIPPYKQEAPKTPPHIILHYVAFKTTWDWLILFLTGYTAVMVPFNAAFKSKTMDDVSFLVVDSIVDVIFFIDIVLNFHTTFVGPNGEVISDATIIRINYLKGWFIVDVLSCLPYDVFNAFQPEATQSTISSLFGALKVVRLLRIGRVTRKLDQYLEYMAASLLLMISGFVLLAHWLACVWYSVGQTDLKNGIYYGWIPRLLNDIDQGKTLPTNWTS-----GNPPLPRTMTYVTSLYFTLSLITSIGFGNVSATTFGEKLVAAVFMLIGAFGYATIFGNVTTIFQGMYATRSRYHDMMASVKDFIKTHSVPKDLAERVIDYVTSTWAITKGIDTAKVLNYCPKDMKADLCIHLNRMVFNEHPAFRLASDGCLRALAVNFNTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAFLGRGDVFGEPFWKDPNSMSHSAASVRALTYCDLHCIKKDCLLQVLKFYSAFANSFARNLVLTYDLKTRLIFRKLADVRREYELAEHRKTDNALSSLRADHPVRRMIHKFRRIGTHNQSTTDS 797          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A4S2M2L1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003158 PE=4 SV=1)

HSP 1 Score: 1023.46 bits (2645), Expect = 0.000e+0
Identity = 517/789 (65.53%), Postives = 615/789 (77.95%), Query Frame = 3
Query:  159 GNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMST--------------------SSTSLSKV---------------GIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYR----NWKNITNIQDNLP-PKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK-GLHSTDQTNSTVDN 2402
            G+RRGLVAPQNTFLDKIIRRCN Q  +F LAN+ I +YPI+Y +EGF K+ GYS+ +++ +   C + +G+ TT EM+DR   A +    +QIE+LFYKKN + LWL+  +SP+RNE++++ LFL+ F++IT LKT   DE+S+K  SKFARLAR+VT+NRS LQ +S                     +ST+LS                     ++ +  + +  + D E  G        + +P Y+QEAPKTPPHIILHY+ FK  WDWIIL+LTGYTAVMVP+NAAFKS+ MDD+ FLVVDSIVDV+FFIDIV NFHTTFVGPNGEVISD  +IRINYLKGWF++DLLSCLPYDVFNAFQPE TQS ISSLF ALKVVRLLRIGRVTRKLDQYLEYMA SL+LMI GFVLLAHWLAC+W+S+G  DL+N + YGWIPRL ND    +    NW        N+P P+++ Y+TSLY+TLSLITSIGFGNVSA TFGEKLVSVVFMLIGAFGYATIFG +TTIFQ M +TR+RYH+MM +VKDFIKTHSVP+DLAERVIDY++S+WAITKGIDT KVLNYCPKDMKADLCIHLNRMVFN+H AFRLASDGCLR+LA+ F TIHTAPGDLIFHQGESIDQLCFVVSGSLEV+QDDEIVA LG+GD+FGE FWK+PN++SHS ATVRALTYCDLHCIK+D LL +L+FY+AF NSFARNLVLTYDLK R+IFRKL+DVKRE EL E RKNDN    L  +HPVR+MI + R  G H+     S++ N
Sbjct:    6 GSRRGLVAPQNTFLDKIIRRCNGQFCSFILANARIVDYPIVYCNEGFSKLIGYSRVDIMQKSGNCAYFYGEQTTQEMRDRLLKALDTQTPDQIEMLFYKKNHSPLWLLVCISPVRNEQEDVVLFLLAFRDITMLKTPFEDEESAKGLSKFARLARSVTRNRSTLQQLSAPHAAPSNASELVQSNRLLVPNSTTLSGSRSPLSSSTSGHTLCHSFNASMSSFRLHESTRSDPEK-GVMNASSWLDLVPPYKQEAPKTPPHIILHYVAFKTTWDWIILVLTGYTAVMVPFNAAFKSKTMDDVSFLVVDSIVDVIFFIDIVLNFHTTFVGPNGEVISDATIIRINYLKGWFLVDLLSCLPYDVFNAFQPEATQSTISSLFGALKVVRLLRIGRVTRKLDQYLEYMAASLLLMIAGFVLLAHWLACVWYSVGSTDLKNGIQYGWIPRLLNDIGQTKSQPANWTT-----GNIPIPRTMTYVTSLYFTLSLITSIGFGNVSATTFGEKLVSVVFMLIGAFGYATIFGNVTTIFQGMYATRSRYHDMMGSVKDFIKTHSVPKDLAERVIDYVTSTWAITKGIDTAKVLNYCPKDMKADLCIHLNRMVFNEHPAFRLASDGCLRALAVKFSTIHTAPGDLIFHQGESIDQLCFVVSGSLEVVQDDEIVAFLGRGDVFGEPFWKEPNRMSHSAATVRALTYCDLHCIKKDSLLQVLNFYSAFANSFARNLVLTYDLKTRLIFRKLADVKREFELAEHRKNDNPLSGLRADHPVRRMIHRFRMIGSHAQSTNGSSIPN 788          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: G7YRZ9 (Potassium voltage-gated channel subfamily H member 5 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_108850 PE=4 SV=1)

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 496/766 (64.75%), Postives = 592/766 (77.28%), Query Frame = 3
Query:  237 NFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMST--------------------SSTSLSKV---------------GIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYR----NWKNITNIQDNLP-PKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK-GLHSTDQTNSTVDNSPE 2411
            +F LAN+ I +YPI+Y +EGF K+ GYS+ +++ +   C + +G+ TT EM+DR   A +    +QIE+LFYKKN + LWL+  +SP+RNE++E+ LFL+ F++IT LKT   DE+S+K  SKFARLAR+VT+NRS LQ +                      +ST+LS                     ++ +  + +  + D E  G        + +P Y+QEAPKTPPHIILHY+ FK  WDWIIL+LTGYTAVMVP+NAAFKS+ MDD+ FLVVDSIVDV+FFIDIV NFHTTFVGPNGEVISD  +IRINYLKGWF++DLLSCLPYDVFNAFQPE TQS ISSLF ALKVVRLLRIGRVTRKLDQYLEYMA SL+LMI GFVLLAHWLAC+W+S+G  DL+N + YGWIPRL ND    +    NW        N+P P+++ Y+TSLY+TLSLITSIGFGNVSA TFGEKLVSVVFMLIGAFGYATIFG +TTIFQ M +TR+RYH+MM +VKDFIKTHSVP+DLAERVIDY++S+WAITKGIDT KVLNYCPKDMKADLCIHLNRMVFN+H AFRLASDGCLR+LA+ F TIHTAPGDLIFHQGESIDQLCFVVSGSLEV+QDDEIVA LG+GD+FGE FWK+PN++SHS ATVRALTYCDLHCIK+D LL +L+FY+AF NSFARNLVLTYDLK R+IFRKL+DVKRE EL E RKNDN    L  +HPVR+MI + R  G H+     S++ N  E
Sbjct:  128 SFILANARIVDYPIVYCNEGFSKLIGYSRVDIMQKSGNCAYFYGEQTTQEMRDRLLKALDTQTPDQIEMLFYKKNHSPLWLLVCISPVRNEQEEVVLFLLAFRDITMLKTPFEDEESAKGLSKFARLARSVTRNRSTLQQLPAPHAAPSNASELVQSNRLLVPNSTALSGSRSPLSSSTSGHTFCHSFNASMSSFRLHESTRSDPEK-GVMNASSWLDLVPPYKQEAPKTPPHIILHYVAFKTTWDWIILVLTGYTAVMVPFNAAFKSKTMDDVSFLVVDSIVDVIFFIDIVLNFHTTFVGPNGEVISDATIIRINYLKGWFLVDLLSCLPYDVFNAFQPEATQSTISSLFGALKVVRLLRIGRVTRKLDQYLEYMAASLLLMIAGFVLLAHWLACVWYSVGSTDLKNGIHYGWIPRLLNDIGQTKSQPANWTT-----GNIPIPRTMTYVTSLYFTLSLITSIGFGNVSATTFGEKLVSVVFMLIGAFGYATIFGNVTTIFQGMYATRSRYHDMMGSVKDFIKTHSVPKDLAERVIDYVTSTWAITKGIDTAKVLNYCPKDMKADLCIHLNRMVFNEHPAFRLASDGCLRALAVKFSTIHTAPGDLIFHQGESIDQLCFVVSGSLEVVQDDEIVAFLGRGDVFGEPFWKEPNRMSHSAATVRALTYCDLHCIKKDSLLQVLNFYSAFANSFARNLVLTYDLKTRLIFRKLADVKREFELAEHRKNDNPLSGLRADHPVRRMIHRFRMIGSHAQSTNGSSIPNGQE 887          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A4E0S3G1 (Ether a go-go isoform C OS=Fasciola hepatica OX=6192 GN=D915_001811 PE=4 SV=1)

HSP 1 Score: 971.844 bits (2511), Expect = 0.000e+0
Identity = 507/829 (61.16%), Postives = 623/829 (75.15%), Query Frame = 3
Query:  237 NFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSS----------------TSLSKVGIGVAVDAK--------------SVSDYIKYDVESC----GTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYR----NWKNITNIQDNLP-PKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK-GLHS-TDQTNSTVDNS-PEPSANTTDRKSSYD------------SLANKWTSLMNKDKVGPETLIKLPLQESENNNCVSKV 2561
            +F LAN+ I +YPI+Y +EGF +++GYS+ +++ +   C + +GD T++EM++R   A +    +QIE+L +KKN + +W++  V+P+RNE++E+ LFL+ F++IT LKT   DE++SK  SKFARLAR+VT+NRS +Q +  S                 T  +  G+G  +                 S S +  YD        G        + +P Y+QEAPKTPPHIILHY+ +K  WDWIIL LTGYTAVMVP+NAAFKS+ MDD+ FLVVDSIVDV+FFIDIV NFHTTFVGPNGEVISD  VIRINYLKGWF++DLLSCLPYDVFNAFQPE TQS ISSLF ALKVVRLLRIGRVTRKLDQYLEYMA SL+LMI GFVLLAHWLAC+W+S+G ADL+N + YGWIPRL ND    R    NW   T +   +P P+++ Y+TSLY+TLSLITSIGFGNVSA TFGEKLVSVVFMLIGAFGYATIFG +TTIFQ M +TR+RYH+MM +VKDFIKTHSVP+DLAERVIDY++S+WAITKGIDT KVLNYCPKDMKADLCIHLNRMVFN+H AFRLASDGCLR+LA+NF TIHTAPGDLIFHQGES+DQLCFVVSGSLEVIQDDEIVA LG+GD+FGE FWK+PN++SHS ATVRALTYCDLHCIK++ LL +L+FY+AF NSFARNLVLTYDLK R+IFRKL+DVKRE EL E RKN+N    L  +HPVR+MI + R  G H+ T   N + +NS P  +AN +   S+ D            SLA+    +   D++  + + K+  +E+EN+   +K+
Sbjct:   37 SFILANARIVDYPIVYCNEGFSRLTGYSRVDIMQKSGNCAYFYGDQTSDEMRERLLKALDNQTPDQIEMLLHKKNHSPIWVLVCVAPVRNEQEEVVLFLLAFRDITPLKTPFEDEETSKGLSKFARLARSVTRNRSAMQQLGVSQSAPPPALDESGHAQRITPHNATGLGAKLGFSSSSGGFSGLQNLNTSTSSFRLYDSTRSDPERGVLNTSSWLDLVPPYKQEAPKTPPHIILHYVAYKTTWDWIILFLTGYTAVMVPFNAAFKSKTMDDVSFLVVDSIVDVIFFIDIVLNFHTTFVGPNGEVISDATVIRINYLKGWFIVDLLSCLPYDVFNAFQPEATQSTISSLFGALKVVRLLRIGRVTRKLDQYLEYMAASLLLMISGFVLLAHWLACVWYSVGQADLKNGIRYGWIPRLMNDVQENRELSVNW--TTGV---VPLPRTMTYVTSLYFTLSLITSIGFGNVSATTFGEKLVSVVFMLIGAFGYATIFGNVTTIFQGMYATRSRYHDMMGSVKDFIKTHSVPKDLAERVIDYVTSTWAITKGIDTAKVLNYCPKDMKADLCIHLNRMVFNEHPAFRLASDGCLRALAVNFNTIHTAPGDLIFHQGESVDQLCFVVSGSLEVIQDDEIVAFLGRGDVFGEPFWKEPNRMSHSAATVRALTYCDLHCIKKENLLQVLNFYSAFANSFARNLVLTYDLKTRLIFRKLADVKREYELAEHRKNENPLSALRADHPVRRMIHRFRMIGSHAQTSSANPSGNNSGPNTNANGSATSSAVDLEYSPIKHTKSLSLADTGELVYMADQIT-DPIEKIQNRETENHTASTKL 859          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A267DWF6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011633g1 PE=4 SV=1)

HSP 1 Score: 956.436 bits (2471), Expect = 0.000e+0
Identity = 478/757 (63.14%), Postives = 593/757 (78.34%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDS-----SKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSP 2408
            M G+RRGLVAPQNTFL+ IIRRCN QHS+F LAN+ I +YPI+Y ++GF K+SG+S+ E + +  TCNFM+ D T  E   R   + E    +Q E+L  KKNK  LWL+  ++PI+NEKD + L+L+TF++ITALK    +E++         SKFARLAR+VT+NRS++  M+           G   D++         ++  G+    + ++ LP Y+QEAPKTPPHIILHY  FK +WDWIILILTGYTAVMVP+N AFK + MDD+ F+V DSIVDV+FFIDIV NFHTTFVGPNGEVISDP++IR+NYLKGWFVIDLLSCLPYDVFNAFQPE+T   ISSLFSALKVVRLLRIGRV RK+DQYLEY A  LILMIFGFVLLAHW+AC+W++IG  DL  +++YGWIPRL+ND++  +NW   T  Q  LP KS+ Y+TSLY+TLSL+TS+GFGN++  T GEK V VVFML+GA  YATIFG +TTIFQQM ++RARYHEMM+++K+FIK H VPR+L ERV+DY++SSWA+TKGIDT KVLNYCPKDMKADL +HLNR VFN+H AFRLASDGCLRSLAINF T+HTAPGDLIFHQGES+DQLCFVVSGSLEVIQDDE+VAILG+GD+FG+ FW++   L  S A+ RALTYCDLHCIKRD LL +L+FY AF NSFARNLVLTY+++HRI+FRK++DV+RE+EL EKRK +    +L  +HPVRK+IS+ +K    +  T     ++P
Sbjct:    1 MSGSRRGLVAPQNTFLENIIRRCNGQHSSFLLANARIVDYPIVYCNDGFSKLSGFSRAEAMQRSCTCNFMYSDQTDPESIQRINKSLESCEPDQQEILLLKKNKTPLWLLMYIAPIKNEKDVVILYLITFRDITALKQPYEEEEAKAAQTAVGLSKFARLARSVTRNRSVMVPMANVPPG------GRMDDSR---------LDQLGSAL-SLHADVLPQYKQEAPKTPPHIILHYSAFKTIWDWIILILTGYTAVMVPFNVAFKFKTMDDVSFIVTDSIVDVIFFIDIVLNFHTTFVGPNGEVISDPSIIRVNYLKGWFVIDLLSCLPYDVFNAFQPESTDGGISSLFSALKVVRLLRIGRVARKVDQYLEYGAALLILMIFGFVLLAHWMACVWYTIGLRDLDLEIWYGWIPRLANDSLEPKNWTKNT-YQSLLPDKSMAYLTSLYFTLSLLTSVGFGNIAPYTEGEKAVVVVFMLLGALVYATIFGNVTTIFQQMYASRARYHEMMNSIKEFIKIHDVPRELGERVMDYVTSSWAVTKGIDTTKVLNYCPKDMKADLSVHLNRKVFNEHPAFRLASDGCLRSLAINFSTVHTAPGDLIFHQGESLDQLCFVVSGSLEVIQDDEVVAILGKGDVFGDTFWRE-APLGQSAASARALTYCDLHCIKRDSLLEVLNFYQAFSNSFARNLVLTYNMRHRIVFRKIADVRRERELAEKRKFEPPLSELSSHHPVRKLISRFKKAPDGSAGTVKQNGSAP 739          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnh5a (potassium voltage-gated channel subfamily H member 5 [Source:NCBI gene;Acc:103032183])

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 406/742 (54.72%), Postives = 543/742 (73.18%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLS-NDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M+G +RGLVAPQNTFL+ I+RR  S  ++F L N+ I  +PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  D+ +  F+       EVL YKKN+  +WL  QV+PIRNE D++ LFL TFK+IT  K    DE ++K  +KFARL R +T +R  +Q ++              ++   VS       E+      ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++ +LVVDS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     +SSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++V        W+ +L+ +    YR   + +   +  P K  +YI+SLY+T++ +T+IGFGN++  T GEK+ SV  M++G+  YATIFG +TTIFQQM +   RYHEM++NV+DF+K + VP+ L+ERV+DYI S+WA++KGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLRSLA+ FQT H APGDLIFH GES+D LCFVVSGSLEVIQDDE++AILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH I+RD LL +L+FY AF NSF+RNL+LT +L+ RIIFRK++DVK+E+E    +KN+     +  +HPVRK+  K ++
Sbjct:    1 MHGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVEWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDRKTIDKVRQTFDNYESNCFEVLLYKKNRTPVWLYMQVAPIRNENDKVVLFLCTFKDITVFKQPIEDE-TTKGWTKFARLTRALTTSRGTVQQLA-------------PMNKTEVSHKPSRLAEAL-----QLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNLAWLVVDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGLSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKTDSWLYQLAVSIGTPYRYNASGSGQWEGGPSKDTLYISSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYTNTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWAMSKGIDTEKVLSICPKDMRADICVHLNRQVFNEHPAFRLASDGCLRSLAVEFQTTHCAPGDLIFHAGESVDTLCFVVSGSLEVIQDDEVIAILGKGDVFGDVFWKE-TALAHACANVRALTYCDLHVIRRDALLKVLEFYTAFANSFSRNLILTCNLRKRIIFRKIADVKKEEEERRHQKNEVTL-SIPVDHPVRKLFQKFKQ 716          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnh5b (potassium voltage-gated channel subfamily H member 5 [Source:NCBI gene;Acc:103041965])

HSP 1 Score: 798.119 bits (2060), Expect = 0.000e+0
Identity = 400/742 (53.91%), Postives = 544/742 (73.32%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLSNDTMH-YRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M G +RGLVAPQNTFL+ I+RR  S  ++F L N+ I  +P++YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  ++ +  F+       E+L Y+KN+  +W   Q++PIRNE D++ LFL TFK+IT  K    DE +    +KFARL R +T ++S +Q +    T ++K  +     ++    +             ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++ +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     ISSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ +++        W+ +L+      YR   + +   +  P K  +YITSLY+T++ +T+IGFGN++  T GEK+ SV  M++G+  YATIFG +TTIFQQM +   RYHEM++NV+DF+K + VP+ L+ERV+DYI S+W++TKGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLRSLA+ FQTIH+APGDLIFH GES+D LCFVVSGSLEVIQDDE++AILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH I+R+ LL +LDFY AF NSF+RNL+LT +L+ RIIFRK+SDVK+E+E  ++ KN+ +   +  +HPVRK+  K ++
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVEWPVVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEILLYRKNRTPVWFYMQIAPIRNENDKVVLFLCTFKDITVFKQPIEDESTRVGWTKFARLTRALTTSKSTIQQL----TPMNKTDVTSHKHSRLAEVF-------------QLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDELTNTIKTDSWLYQLATSIGSPYRYNASGSGQWEGGPGKHSLYITSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMTKGIDTEKVLSICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRSLAVEFQTIHSAPGDLIFHAGESVDTLCFVVSGSLEVIQDDEVIAILGKGDVFGDVFWKE-TTLAHACANVRALTYCDLHIIRREALLKVLDFYTAFANSFSRNLILTCNLRKRIIFRKISDVKKEEEERQRSKNE-VPMTIPVDHPVRKLFQKFKQ 718          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnh5b (potassium voltage-gated channel subfamily H member 5 [Source:NCBI gene;Acc:103041965])

HSP 1 Score: 796.964 bits (2057), Expect = 0.000e+0
Identity = 400/742 (53.91%), Postives = 544/742 (73.32%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLSNDTMH-YRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M G +RGLVAPQNTFL+ I+RR  S  ++F L N+ I  +P++YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  ++ +  F+       E+L Y+KN+  +W   Q++PIRNE D++ LFL TFK+IT  K    DE +    +KFARL R +T ++S +Q +    T ++K  +     ++    +             ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++ +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     ISSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ +++        W+ +L+      YR   + +   +  P K  +YITSLY+T++ +T+IGFGN++  T GEK+ SV  M++G+  YATIFG +TTIFQQM +   RYHEM++NV+DF+K + VP+ L+ERV+DYI S+W++TKGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLRSLA+ FQTIH+APGDLIFH GES+D LCFVVSGSLEVIQDDE++AILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH I+R+ LL +LDFY AF NSF+RNL+LT +L+ RIIFRK+SDVK+E+E  ++ KN+ +   +  +HPVRK+  K ++
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVEWPVVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEILLYRKNRTPVWFYMQIAPIRNENDKVVLFLCTFKDITVFKQPIEDESTRVGWTKFARLTRALTTSKSTIQQL----TPMNKTDVTSHKHSRLAEVF-------------QLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDELTNTIKTDSWLYQLATSIGSPYRYNASGSGQWEGGPGKHSLYITSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMTKGIDTEKVLSICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRSLAVEFQTIHSAPGDLIFHAGESVDTLCFVVSGSLEVIQDDEVIAILGKGDVFGDVFWKE-TTLAHACANVRALTYCDLHIIRREALLKVLDFYTAFANSFSRNLILTCNLRKRIIFRKISDVKKEEEERQRSKNE-VPMTIPVDHPVRKLFQKFKQ 718          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnh5a (potassium voltage-gated channel subfamily H member 5 [Source:NCBI gene;Acc:103032183])

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 407/771 (52.79%), Postives = 546/771 (70.82%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQ----------------PETTQS-------------AISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLS-NDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M+G +RGLVAPQNTFL+ I+RR  S  ++F L N+ I  +PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  D+ +  F+       EVL YKKN+  +WL  QV+PIRNE D++ LFL TFK+IT  K    DE ++K  +KFARL R +T +R  +Q ++              ++   VS       E+      ++ S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++ +LVVDS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF+                P +  S              +SSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++V        W+ +L+ +    YR   + +   +  P K  +YI+SLY+T++ +T+IGFGN++  T GEK+ SV  M++G+  YATIFG +TTIFQQM +   RYHEM++NV+DF+K + VP+ L+ERV+DYI S+WA++KGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLRSLA+ FQT H APGDLIFH GES+D LCFVVSGSLEVIQDDE++AILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH I+RD LL +L+FY AF NSF+RNL+LT +L+ RIIFRK++DVK+E+E    +KN+     +  +HPVRK+  K ++
Sbjct:    1 MHGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVEWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDRKTIDKVRQTFDNYESNCFEVLLYKKNRTPVWLYMQVAPIRNENDKVVLFLCTFKDITVFKQPIEDE-TTKGWTKFARLTRALTTSRGTVQQLA-------------PMNKTEVSHKPSRLAEAL-----QLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNLAWLVVDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFENVDEDPISDSTAVGHLPASGSSPRNATRAEDSVLPGLSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKTDSWLYQLAVSIGTPYRYNASGSGQWEGGPSKDTLYISSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYTNTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWAMSKGIDTEKVLSICPKDMRADICVHLNRQVFNEHPAFRLASDGCLRSLAVEFQTTHCAPGDLIFHAGESVDTLCFVVSGSLEVIQDDEVIAILGKGDVFGDVFWKE-TALAHACANVRALTYCDLHVIRRDALLKVLEFYTAFANSFSRNLILTCNLRKRIIFRKIADVKKEEEERRHQKNEVTL-SIPVDHPVRKLFQKFKQ 747          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 783.482 bits (2022), Expect = 0.000e+0
Identity = 428/881 (48.58%), Postives = 577/881 (65.49%), Query Frame = 3
Query:  180 APQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADL----QNKVFY-GWIPRLSNDT-MHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKG----LHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQESENNNCVSKVSPAPDQSKQRQPSKML-------WQRLKHP--------EPIREVEEVSPLPDKNFEEELISIQSADIAEGNVNNGDI 2747
            A  NTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ T  EM ++ +  FE       E+L YKKN+  +W   +++PIRNE+D++ LFL TF +ITA K    DE SSK   KFARL R +T +R +LQ +                 A +V         S   +  ++ S+ LP Y+QE PKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NY+K WFVIDLLSCLPYDV NAF  E     ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHWLACIW+SIG  ++     N+V    W+  L       YR   + T   +  P K  VYITSLY+T++ +TSIGFGN++  T GEK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI S+W++++GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQT+H+APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+ N L+ + A VRALTYCDLH IKRD L  +L+FY AF N FARNLVLTY+L+ RI+FRK+SDVKRE+E   KRK++    +L P+HPVR++  + R+     L +       VD   E  +   +RKS    ++      + +    P          +  +N  +K+  A   S     SK+        W R K            + + E +  LPD+   ++ + ++  D  +  +   D+
Sbjct:    1 AGMNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKEMGEKVRQTFENYEMNSFEILMYKKNRMPVWFFVKIAPIRNEQDKVVLFLCTFNDITAFKQPIEDE-SSKGWGKFARLTRALTSSRGVLQQL-----------------APTVHKGENVHKHSRLAEVLQLGSDILPQYKQETPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYVKTWFVIDLLSCLPYDVINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEGSNRVRTDSWLYLLGEAVGTPYRFNASGTGRWEGGPSKDSVYITSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTDKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHSAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEVN-LAQACANVRALTYCDLHIIKRDALQKVLEFYTAFSNHFARNLVLTYNLRKRIVFRKISDVKREEEEMLKRKDEAPL-NLPPDHPVRRLFQRFRQQKEARLAAELANQGEVD--VEKGSVLMERKSVIHDVSGSSLVTVAESPATPLASSSSLSSAARTSN-QAKLHAAIGASSNSTGSKLAEAPKGKGWGRFKEASGKVDLSWSSVSKAESMETLPDRTKSQDELPLKKTDSCDSGITKSDL 853          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 393/745 (52.75%), Postives = 528/745 (70.87%), Query Frame = 3
Query:  222 NSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQ---------------------------PETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVF-----YGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            +S  +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + +TC+FM+GD T  E  ++ K  FE       E+L YKKN+  LW   Q++PIRNE +++ LFL TF++ITA K    D DS+K  +KFARL R +T +RS+LQ ++ +               ++V  + +        +  ++ S+ LP Y+QE PKTPPHIILHY  FK  WDWIILILT YTA+MVPYN +FK++  +++ +LVVDS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF+                           P      ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHWLACIW+SIG  ++ ++       + W+ +L  +T+      N T  +   P K  VYI+SLY+T++ +TSIGFGN++  T GEK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI S+W+++KGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLR+LA+ FQT H APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   ++ S A VRALTYCDLH I+RD L+ +LDFY AF NSF+RNL+LTY+++  +IFRK+SDVKRE+E  +K KN+    D+ P+HPVRK+  + R+
Sbjct:    4 HSADTNFLLGNAQILDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGDLTDKETMEKVKQTFENYESCSFEILMYKKNRTPLWFYMQIAPIRNEHEKVVLFLCTFRDITAFKQPIED-DSTKGWTKFARLTRALTNSRSVLQQLTPNVHK-----------GENVHKHSRL------AEVLQLGSDILPQYKQETPKTPPHIILHYCAFKTTWDWIILILTFYTAIMVPYNVSFKTKQ-NNVAWLVVDSVVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFENVDEVVRAAQIRGPFGSRSPSRLLDAWPRVAPQGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEATNLIRKHSWLYQL-GETIGTPYHFNGTQWEGG-PSKDAVYISSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLHICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTHHCAPGDLIYHAGESVDTLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKE-RVIAPSCANVRALTYCDLHVIRRDALVKVLDFYMAFANSFSRNLILTYNVRGLLIFRKISDVKREEEELQKLKNEAPL-DIPPDHPVRKLFQRFRQ 725          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005594.1 (pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1 gene:ENSPMAG00000005049.1 transcript:ENSPMAT00000005594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 390.578 bits (1002), Expect = 3.305e-122
Identity = 215/509 (42.24%), Postives = 310/509 (60.90%), Query Frame = 3
Query:  759 TQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAF-----------KSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGH----ADLQNKVFYGWIPRLSNDTMHYRNWKNITN---IQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAF--WKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLK 2225
            TQ   + ++ LP Y+ +AP+     ILHY  FKAVWDW+IL+L  YTA+  PY AAF           +          +VD +VD++F +DI  NF TT++  N EV+S P  I I+Y KGWF+ID+++ +P+D+   F   +     ++L   LK  RLLR+ RV RKLD+Y EY A  L+L++  F L+AHWLACIW++IG+     D   K   GW+ +L        N  + ++   I+D        Y+T+LY+T S +TS+GFGNVS NT  EK+ S+  MLIG+  YA+IFG ++ I Q++ S  ARYH  M  VK+FI+ H +P  L +R+ +Y   +W+ T GID   VL   P+ ++AD+C+HLNR +     AF  AS GCLR+LA+ F+T H  PGD + H G+ I  + F+  GS+E++++D +VAILG+ DIFGE    +  P K   S+A VRALTYCDLH I R+ +L +LD Y  F   F  +L +T++L+
Sbjct:   66 TQVLSLGADVLPEYKLQAPRIHKWTILHYSPFKAVWDWLILLLVIYTAIFTPYTAAFLLSDQQVENERQKCGYSCNPLNIVDLMVDIMFMVDIFINFRTTYINKNEEVVSHPGKIAIHYFKGWFLIDMVAAIPFDLL-IFGSGSGSGETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLVLLMCTFALIAHWLACIWYAIGNMERPVDSLAKDRIGWLDQLGGQIGKPYNDTDTSSGPSIKDK-------YVTALYFTFSSLTSVGFGNVSPNTNYEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNMVLKGFPECLQADICLHLNRTLLESCKAFNGASKGCLRALAMKFKTTHAPPGDTLVHSGDVITAMYFLSRGSIEILREDIVVAILGKNDIFGEPVNQYSRPGK---SSADVRALTYCDLHKIVREDMLEVLDMYPEFSEHFWPSLEITFNLR 563          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcnh5b (potassium voltage-gated channel, subfamily H (eag-related), member 5b [Source:ZFIN;Acc:ZDB-GENE-090319-1])

HSP 1 Score: 322.783 bits (826), Expect = 1.171e-100
Identity = 190/396 (47.98%), Postives = 253/396 (63.89%), Query Frame = 3
Query:  471 LWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMI---SEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQ--------------PETTQ---------SAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMH-YRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIG 1577
            +WL  QVSP+RNE +E+ LFL  F++IT  K     ED S+  ++FARL R +  +RS+L  +STS         G A  AK             G +T E++   +E LP Y+QEAPKTP +IILHY  FK  WDW+ILILT YTA+MVPYN +F++R   ++ +LVVDS+VD +F +DIV NFHTT+VG  GEVISDP +IR  YLK WF+IDLLSCLPYD+ NAF+              P   Q           ISSLFSALKVVRLLR+GRV RKLD Y+EY A  L+L++  F L+AHWLACIWFSIG A+   +  YGW+ +L++     YR   +     +  P +  +Y+++LY+T+S +TS+GFGN++ NT  EK+ +V  M+IG
Sbjct:    3 VWLHMQVSPVRNELNEVVLFLSIFRDITIFKQPI--EDDSRGWARFARLTRALATSRSVLHQLSTSGAR------GEAAGAK-------------GLRTAEVVQLNTEVLPAYKQEAPKTPRNIILHYCAFKTTWDWLILILTFYTAIMVPYNVSFRTRQ-SNVAWLVVDSVVDAIFLVDIVLNFHTTYVGSAGEVISDPALIRTKYLKTWFLIDLLSCLPYDIINAFENADEYSSATNGFLTPACAQIPPHKGGEAQGISSLFSALKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLVAHWLACIWFSIGDAEAARE--YGWLHQLAHSVGQPYRYSGDGGGRWEGGPSRRTLYVSALYFTMSSLTSVGFGNIAPNTDAEKMFAVAMMMIG 374          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcnh5b (potassium voltage-gated channel, subfamily H (eag-related), member 5b [Source:ZFIN;Acc:ZDB-GENE-090319-1])

HSP 1 Score: 322.398 bits (825), Expect = 2.250e-100
Identity = 191/401 (47.63%), Postives = 255/401 (63.59%), Query Frame = 3
Query:  471 LWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMI---SEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQ--PETTQSA--------------------------ISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMH-YRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIG 1577
            +WL  QVSP+RNE +E+ LFL  F++IT  K     ED S+  ++FARL R +  +RS+L  +STS         G A  AK             G +T E++   +E LP Y+QEAPKTP +IILHY  FK  WDW+ILILT YTA+MVPYN +F++R   ++ +LVVDS+VD +F +DIV NFHTT+VG  GEVISDP +IR  YLK WF+IDLLSCLPYD+ NAF+   E T +A                          ISSLFSALKVVRLLR+GRV RKLD Y+EY A  L+L++  F L+AHWLACIWFSIG A+   +  YGW+ +L++     YR   +     +  P +  +Y+++LY+T+S +TS+GFGN++ NT  EK+ +V  M+IG
Sbjct:    3 VWLHMQVSPVRNELNEVVLFLSIFRDITIFKQPI--EDDSRGWARFARLTRALATSRSVLHQLSTSGAR------GEAAGAK-------------GLRTAEVVQLNTEVLPAYKQEAPKTPRNIILHYCAFKTTWDWLILILTFYTAIMVPYNVSFRTRQ-SNVAWLVVDSVVDAIFLVDIVLNFHTTYVGSAGEVISDPALIRTKYLKTWFLIDLLSCLPYDIINAFENADEDTTAASTHHHLLSQSSSVGQAAARSLHVAEGISSLFSALKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLVAHWLACIWFSIGDAEAARE--YGWLHQLAHSVGQPYRYSGDGGGRWEGGPSRRTLYVSALYFTMSSLTSVGFGNIAPNTDAEKMFAVAMMMIG 379          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005922.1 (pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-1 gene:ENSPMAG00000005344.1 transcript:ENSPMAT00000005922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 329.717 bits (844), Expect = 7.230e-99
Identity = 193/485 (39.79%), Postives = 293/485 (60.41%), Query Frame = 3
Query:  789 LPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKS--RNMXXXXXXXXXXXXXXXX-XXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLV--LTYDLKH 2228
            LP Y+  A +    I+LHY  FKA WD +IL+ T Y AV VPYN  F     N+ D     V  I   +   IDI+ NF TT+V  +G+V+ D   I ++Y+  WF IDL++ LP+D+  AF       ++++L   LK VRLLR+ R+ + LD+Y +Y  V L L++F F LLAHW+ACIW+ IG A+++    + W     ++          TN     P     YI SLY+ LS +TS+GFGNVSANT  EK+ SV  MLIGA  +A +FG +T I Q+M S R++YH    ++KDFI+ H +P+ L +R+++Y  ++W++  GIDT ++L   P +++AD+ +H+N+ +  +   F  AS GCLRSL+++ +    APG+ +  QG+++    FV SGS+EV++DD ++AILG+GD+ G       +++  + A V+ALTYCDL CI    L  +LD Y  + + F  ++   LTY+L+ 
Sbjct:   36 LPEYKVAAIQKSRFILLHYGTFKAGWDLLILLATFYVAVTVPYNVCFSETVENISDPRSTAVVDISVEILFIIDILLNFRTTYVSKSGQVVYDGRSICVHYVTTWFFIDLIAALPFDLLYAFN-----VSVTTLVHLLKTVRLLRLLRLLQNLDRYSQYSTVVLTLLMFMFGLLAHWMACIWYKIGRAEIEINDRHSWDIGWLHELGKKLETPFHTNNTGGGPSTRSAYIASLYFALSSLTSVGFGNVSANTDAEKIFSVCAMLIGALMHAVVFGNVTAIIQRMYSRRSQYHTRTKDLKDFIRVHRLPKQLKQRMLEYFQTTWSVNNGIDTHELLKDFPDELRADIAMHMNKEIL-QLAIFESASRGCLRSLSLSIKPSFCAPGEFLIRQGDALQAFYFVCSGSMEVLKDDMVLAILGKGDLIGSDL-SSKDQVLKTNADVKALTYCDLQCIHLRGLYDVLDLYPEYSHQFHEDIQGELTYNLRE 513          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO36780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHR1])

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 301/697 (43.19%), Postives = 434/697 (62.27%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDT-MHYRNWKNIT--NIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRI 2234
            M   RRGLV PQNTFL+ I+RR N  H NF L N+ I   PI+Y+S+GFCK++G+S++EV+ + + C F+HG+ T+NE       A       Q+E++ YKK+   +W++  + PI NEK E+ LFL+T K+IT  K        +K    +ARL +++T+++++L                VA   KS S      +    T    +  + +P Y+QE P+TPP +ILHY  FK  WDW+ILILT YT V VP+   F   +       ++D IVD +F  DIV NFHTT+VG +GE+I DP +IR+NYLK WFV+DL+S LPY V         +  I++L S L+V RLLR+GRV RK+D+YLEY A +  L++  F L+AHW+AC+++ I     +  V + W+  L++   M Y+   N T  +  +  P  +  Y+++LYYTL+ +T+IGFGN+S NT  EKL   V ML+G+  ++ IFG+++ I QQ     A+YH ++ N++ F K + +P  LA+R+IDY  S+WA  KGIDT +VL YCPKD++AD+C+HLNR+V   + AFR A  G  R++A NF   H AP D I H GES+D L F+  GSLEV Q + +V +LG+GD+FG+    +P  +  S   V ALTYCDLHCI+RD LL +L+FY  F   FA+NL L+Y+L+  +
Sbjct:    1 MPAGRRGLVVPQNTFLENIVRRSNGLHPNFILGNAQILGNPIVYASDGFCKLTGFSRSEVMKKSSDCTFLHGEHTSNESMKEIHDALINKQALQLEIIIYKKDGLAMWVLLHIGPIVNEKGEVVLFLMTIKDITEYKDPIPGTGGAKG---WARLNKSLTRHKTVL----------------VAFKQKSASQKNAQQI----THLMSLNDDIIPQYKQEIPETPPRVILHYNTFKTSWDWVILILTLYTTVSVPFMVCFAYNS---EPLNILDMIVDWLFIADIVLNFHTTYVGKDGEIIDDPRLIRLNYLKTWFVLDLVSSLPYGVLYFIPKSEMEQTIANLLSFLRVFRLLRLGRVARKIDKYLEYGASTFFLLMLSFCLVAHWMACMFYVIATKYDKYDV-HCWLYILADQIGMQYKKNGNSTEYDYTNTGPTIAARYVSALYYTLTSLTTIGFGNISPNTTAEKLFGCVTMLLGSILFSLIFGQVSAILQQSQKNTAKYHSIIDNMRQFSKLYKLPSVLADRIIDYFMSTWASNKGIDTDEVLKYCPKDLQADICVHLNRVVLENNLAFRDAPMGVKRAIARNFWICHVAPNDRIIHHGESLDVLYFIARGSLEVKQGEAVVGLLGEGDVFGDNVCNEPT-VGQSAVDVHALTYCDLHCIQRDALLEVLEFYPEFAMKFAKNLQLSYNLRDEV 669          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO45888 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU8])

HSP 1 Score: 446.432 bits (1147), Expect = 8.792e-143
Identity = 251/699 (35.91%), Postives = 397/699 (56.80%), Query Frame = 3
Query:  165 RRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYN-YPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTS---TNDED---SSKDSSKFARLARTVTK--NRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMI----SEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDL 2222
            RRG  APQNTFL+ I ++ +  +SNF L ++   N YPI+Y S+GFC+++G+++TE++ +   CNF++G  T  E     + A +     + EV+FY+KN +  + +  + PI+NEK  + LFLV+ K++T  K S   T+D D   S +      +L R+ ++  +R +L H+S                        +Y   +  T+ +       S +LP Y++E  K    + LHY N K++WDW +LILT Y A+MVPYN AF SR+      ++VD ++++ F +DIV +F TTFV   G ++ +   I I+YLKGWF++D L+ LP++            +   L   LK  RLLR+ RV RKL +Y EY  V L L++  F ++AHWLACIW+ IG  ++ +     W+ +             I    D  P +   Y+T+LY+ L+ +T++GFGNVSANT  EK  +VV MLIGA  +A IFG +  I Q++ + R RYH   + +K FI+ H +  DLA R+ D   ++W+++ G+DT ++L   P +++AD+C+HL R + +    F  A  G  R +++    ++  PG+ +  Q + I+ + ++ SGS+EV+Q + + AILG+GD+FGE   +  + +  S   VRALTYCD++ I RD L  ++  Y  F   F+  L LTYDL
Sbjct:    4 RRGRFAPQNTFLETIAQKFDHGNSNFVLGSAQEKNNYPIVYCSDGFCELTGFTRTELMRRTCACNFLYGLETNQEDVRNIQNALKTQKELKKEVIFYRKNGSHFFCLLDIVPIKNEKGTVVLFLVSHKDVTKRKQSGEATHDRDENASGRTGPGERKLTRSRSRKFSRDVLLHLSR-----------------------QYQQSNSATKPQSRRPTKRSRRLPLYKRETTKKSKLLFLHYSNVKSLWDWWVLILTFYIAIMVPYNVAF-SRHGKARDLIIVDMVIELFFILDIVVHFRTTFVNKAGRIVYEQKAIAIHYLKGWFILDFLAALPFEALYFIN-----KSWGFLVQLLKCGRLLRLFRVVRKLHRYTEYSTVLLTLLMLAFAMVAHWLACIWYVIGLEEVSHNSTISWLYQFGETI----QMPFIAFSPDTGPDEGSAYVTALYFILTSMTTVGFGNVSANTRAEKAFAVVVMLIGALMHAAIFGNVAAIIQKLYANRVRYHSRSNEIKQFIRVHHIEADLANRLEDCFHTTWSLSGGVDTREILTTFPYELQADVCMHLYRGLLDL-PVFSQAPRGLFRMVSLKVSPVYIGPGEYLLTQNDVINSIYYIASGSMEVLQGESVAAILGKGDLFGEDISRK-SPIRRSNGDVRALTYCDVYYITRDKLQEVMHLYPDFSYKFSEKLELTYDL 667          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO30140 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1M9])

HSP 1 Score: 433.335 bits (1113), Expect = 2.654e-136
Identity = 273/750 (36.40%), Postives = 395/750 (52.67%), Query Frame = 3
Query:  165 RRGLVAPQNTFLDKIIRRCN-SQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEK--------------LPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAF-----------------------KSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYD--VFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQ-NKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQ-------------------GDIFGEAFWKDPNK-LSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHR 2231
            +RGLVAPQNTF+  II++ + S   NF L N+     PIIY +EGFC+++GYS+ E++ +  +C+F+ G GT    K   K A +      IE+L+Y+K+ +       V+P+++E   +++++V  +++T    S N +D    SS        VT+                     V  +    S ++   +E  G   +   +E+              LP Y+ +AP   P  ILHY  FKA WDW+IL L  YTA++ PY A+F                        +R +     +++D +VDV+F +DI  NF TTFV  N EV+S P  I ++Y K WFVIDL++ +P++  +      ETT     +L   LK  RLLR+ RV RKLD Y EY    L L++  F LLAHWLACIW++IG+ + Q     +GW+  L+       + K +    D+ P     YIT+LY+TLS +TS+GFGNVS NT  EK+ S+  MLIG+  YA IFG +  I  ++ S  ARYH  M  V++FI+ H +P  L +R+ DY    W+ T GI           DM  D    LN  V   + AF  AS GCLRSLA+  +T H  PGD I +QG+ I  L F+V G++EV++DD I+AILG+                   GD FGE F   PN+   +S  ++RALTYCDL  I RD L++ +  Y  F  +F ++L +TY L+ R
Sbjct:    4 KRGLVAPQNTFIQTIIKKFDGSPDRNFVLGNAQADGLPIIYCNEGFCELTGYSRAELVQRNCSCDFLCGQGTNEVAKQDVKNALKGTVERHIEILYYRKDGSPFLCSVLVAPVKDEAGRVSMYIVNHEDVT---WSPNRDDVINHSS--------VTR---------------------VVCNINFYSAFVARKIEYRGLAKRNRRNEQRKKSALVMSLGADVLPEYKLQAPNIHPWTILHYSVFKAFWDWLILFLVIYTAIVTPYMASFILTRDKMRDELNKDPETRRDYGSGAREVYSDPLVILDYLVDVMFIVDIFINFRTTFVDSNDEVVSHPCRIAVHYFKTWFVIDLMAAIPFELLIMVGNTDETT-----TLIGLLKTARLLRLVRVARKLDHYSEYGMAVLCLLMCSFALLAHWLACIWYAIGNLERQRTNSTHGWLDVLAEQIHRPFDEKEV----DSGPDIESKYITALYFTLSSLTSVGFGNVSPNTNAEKIFSICVMLIGSLFYAAIFGNVAAIIARLYSNTARYHAQMQRVREFIRFHQIPNPLRQRIEDYSHHIWSYTNGI-----------DMDQD----LNANVLTTYRAFTSASQGCLRSLALKLRTTHLPPGDFIIYQGDEISHLYFLVRGTVEVLKDDTIMAILGEQEDEIMMLCLQFSIYLQGKGDSFGENFGLSPNRPPGNSHVSIRALTYCDLRAISRDDLVNTMRMYPNFQQTFNQDLEITYLLRER 697          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO47044 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RND4])

HSP 1 Score: 305.449 bits (781), Expect = 1.529e-92
Identity = 171/489 (34.97%), Postives = 274/489 (56.03%), Query Frame = 3
Query:  831 IILHYLNFKAVWDWIILILTGYTAVMVPYNAAF---------KSRNMXXXXXXXXXXXXXXXXXXXXXX-----NFHTTFVGPN-GEVISDPNVIRINYLKGWFVIDLLSCLPYD---------VFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFW-KDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDL 2222
            II H   FKAVWDW+IL+   YTA  +P++A F         KS +    +       +  +    +       NF +T+V     E+I +P  I +NY K WF+IDLLS +P++         V N           ++L   LK  RLLR+ R+ RK D+Y EY    +IL+   F+L+AHWLACIW +IG A L +     WI +LS  + H  +  N+T+     P     YIT+LY+T++ ++S+GFGNVS NT  EK+ S++ M++GA  YA+IFG +T I Q++ S  +R+   +  ++DF++ + +PR+L + + +Y    W+ TKG+D   VL   P+ ++AD+C+HL++ +F + +AF+ AS+GCLR+LA  F      PG  +  QG+ + +L F+  G +EV++D     +LG+GD+    +  +   + + + A++   TYC +H +    LL +L  Y+ F  SF  +L L Y+L
Sbjct:    1 IIRHDSIFKAVWDWVILVFVIYTAFEIPFSATFLLPQELSRMKSSSRFAALVSGSPLAICNLCVDLLFVVDIPINFRSTYVREGTDELIVNPKKIALNYFKSWFLIDLLSAIPFEFMVDHRKDGVSNQGVSMPLTGLATTLMGLLKTARLLRLVRIVRKFDRYSEYGQAVIILLTCFFLLVAHWLACIWHAIGQAQLGDH--NSWIEKLSRHSQHVSS-GNVTHT----PGLQTRYITALYFTMTSLSSVGFGNVSPNTNAEKVFSILVMIVGALMYASIFGNMTAIIQRLYSRTSRHRRNLRIIQDFVRFYKIPRNLRDDLEEYFRHEWSYTKGMDIDTVLKRFPESLQADICVHLHKKLFAECSAFQCASEGCLRALARRFDIRRHLPGQYLIKQGDEVKKLYFIAKGFVEVLKDGHCELVLGKGDVISCDYTSRQSLRTAKANASLLIQTYCQIHVVDWQDLLSVLRVYSKFRESFTNHLKLAYNL 482          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO47043 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RND2])

HSP 1 Score: 300.442 bits (768), Expect = 1.335e-90
Identity = 182/488 (37.30%), Postives = 275/488 (56.35%), Query Frame = 3
Query:  801 RQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXX------------XXXXXXXXXXXXXXXXNFHTTFVGPNG-EVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWK-DPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDL 2222
            R +A K  P  I H   FKA+WDW+ILIL  YTA+ +PY   F                       V +  VD++F +DI  NF +T+V  +  E+IS+P  I ++YLK WFV+D  + +P++    F    T+   ++L    K  RLLR+ RV RKLD+Y EY    ++L+   F+LLAHWLACIW +IGH ++ N    GWI  L+ +  +   +    +     P  +  Y+TSLY+TL+ +T++GFGNVS NT  EK  SV  ML+GA  YA IFG +T I Q++ S  +R+H  +  +++F K + VP  L + + ++    W  TKG+D   VL   P+ ++AD+  HL++ +FN+  AF  A DGCLR+L++ F   H  PG  +  QG+ ID+L F+V GS+EVI+D E   +LG+GD     +   + + +  + A++   T+ ++H I    LL +L  Y  F   F  +L L Y+L
Sbjct:   10 RTQA-KIHPWTIRHDSLFKAIWDWLILILVMYTAIEIPYTVVFSLPYQVIKENTPIWFLSDVTPLHVCNLWVDLMFIVDIFINFRSTYVAQDSDEIISNPKNIVLHYLKTWFVVDFFAAIPFE----FMINPTKEGAATLMGLFKTARLLRLVRVARKLDRYSEYGLAVVVLLTCLFMLLAHWLACIWHAIGHHEIHNT--NGWIWLLAMEGKNALKYN--ASDHTTWPNVNSRYVTSLYFTLTSLTTVGFGNVSPNTNAEKAFSVCVMLVGALFYAAIFGNMTAIIQRLYSRTSRFHRDLRVIEEFSKFNKVPPSLRDDLEEFFRHEWIYTKGVDVDHVLKRFPECLQADVRHHLHKKLFNECMAFANADDGCLRALSLRFTIQHFLPGHFVVKQGDQIDRLLFLVKGSIEVIKDKETCLVLGKGDTISCDYSSINSSYIPKANASLLIQTHSEIHSITWSDLLIVLKAYPTFQEDFLDHLELAYNL 488          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000036780.1 (potassium voltage-gated channel subfamily H member 1 [Source:NCBI gene;Acc:101170816])

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 413/740 (55.81%), Postives = 540/740 (72.97%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADL----QNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M G RRGLVAPQNTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ T  E  ++ +  FE       EVL YKKN+  +W   +++PIRNE+D++ LFL TF +ITA K    DE SSK   KFARL R +T +R +LQ ++ +               +S+  + +        +  ++ S+ LP Y+QE PKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NY+K WFVIDLLSCLPYDV NAF  E     ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHWLACIW+SIG  ++     N V       L  +T+      N +   +  P K  VYITSLY+T++ +TSIGFGN++ NT GEK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI S+W++T+GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQTIH+APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+ S A VRALTYCDLH IKRD L  +L+FY+ F N FARNLVLTY+L+ RIIFRK+ DVKRE+E + KRK++ L  +L P+HPVR++  + R+
Sbjct:    1 MAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKETTEKVRLTFENYEMNSFEVLMYKKNRMPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDE-SSKGWGKFARLTRALTSSRGVLQQLAPAVHK-----------GESIHKHSRL------AEVLQLGSDILPQYKQETPKTPPHIILHYCLFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYVKTWFVIDLLSCLPYDVINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEETNSVRMDSWLYLLGETVGRPYRLNSSGRWEGGPSKDSVYITSLYFTMTSLTSIGFGNIAPNTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMTRGIDTDKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTIHSAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEMT-LAQSCANVRALTYCDLHVIKRDELQKVLEFYSNFANHFARNLVLTYNLRKRIIFRKIVDVKREEEEKLKRKDEALL-NLPPDHPVRRLFQRFRQ 715          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000001433.2 (potassium voltage-gated channel subfamily H member 1 [Source:NCBI gene;Acc:101170816])

HSP 1 Score: 798.89 bits (2062), Expect = 0.000e+0
Identity = 413/740 (55.81%), Postives = 540/740 (72.97%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADL----QNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M G RRGLVAPQNTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ T  E  ++ +  FE       EVL YKKN+  +W   +++PIRNE+D++ LFL TF +ITA K    DE SSK   KFARL R +T +R +LQ ++ +               +S+  + +        +  ++ S+ LP Y+QE PKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NY+K WFVIDLLSCLPYDV NAF  E     ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHWLACIW+SIG  ++     N V       L  +T+      N +   +  P K  VYITSLY+T++ +TSIGFGN++ NT GEK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI S+W++T+GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQTIH+APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+ S A VRALTYCDLH IKRD L  +L+FY+ F N FARNLVLTY+L+ RIIFRK+ DVKRE+E + KRK++ L  +L P+HPVR++  + R+
Sbjct:    4 MAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKETTEKVRLTFENYEMNSFEVLMYKKNRMPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDE-SSKGWGKFARLTRALTSSRGVLQQLAPAVHK-----------GESIHKHSRL------AEVLQLGSDILPQYKQETPKTPPHIILHYCLFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYVKTWFVIDLLSCLPYDVINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEETNSVRMDSWLYLLGETVGRPYRLNSSGRWEGGPSKDSVYITSLYFTMTSLTSIGFGNIAPNTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMTRGIDTDKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTIHSAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEMT-LAQSCANVRALTYCDLHVIKRDELQKVLEFYSNFANHFARNLVLTYNLRKRIIFRKIVDVKREEEEKLKRKDEALL-NLPPDHPVRRLFQRFRQ 718          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnh1a (potassium voltage-gated channel subfamily H member 1-like [Source:NCBI gene;Acc:101155792])

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 409/742 (55.12%), Postives = 539/742 (72.64%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLSNDTMH-YRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M G RRGLVAPQNTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  ++ +  FE       E+L YKKN+  +W   +++PIRNE++++ LFL TF +ITA K    D DSSK   KFARL R +T +R +LQ +  +      V              +K+   S   +  ++ S+ LP Y+QE PKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYDV NAF  E     ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHWLACIW+SIG  ++ ++         W+  L+      YR     +   +  P K  VYITSLY+T++ +TSIGFGN++  T GEK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI+S+W++++GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQTIH APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+ S A VRALTYCDLH IKRD L  +L+FY AF N F+RNL+LTY+L+ RI+FRK+SDVKRE+E  ++RKN+    +L P+HPVRK+  + R+
Sbjct:    1 MAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTTEKVRLTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQEKVVLFLCTFSDITAFKQPIED-DSSKGWGKFARLTRALTSSRGVLQQLQPTVHKGENV--------------LKH---SRLAEVLQLGSDILPQYKQETPKTPPHIILHYCLFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEETNLVRTDSWLYILAETVGRPYRFNTTGSGKWEGGPNKDSVYITSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMINSVRDFLKLYQVPKGLSERVMDYIASTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTIHCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEVT-LAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSNHFSRNLLLTYNLRKRIVFRKISDVKREEEERQRRKNEAPL-NLPPDHPVRKLFQRFRQ 717          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnh5b (potassium voltage-gated channel subfamily H member 5 [Source:NCBI gene;Acc:101172862])

HSP 1 Score: 790.801 bits (2041), Expect = 0.000e+0
Identity = 408/745 (54.77%), Postives = 545/745 (73.15%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMI---SEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKV-----FYGWIPRLS-NDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M G +RGLVAPQNTFL+ I+RR  S  ++F L N+ I  +P++YS++GFCK+SG+ + EV+ + +TC+FM+G+ T  +  D+ +  F+       EVL Y+KN++ +W   QV+PIRNE D++ LFL TFK+IT  K    DE S+K  +KFARL R +T NR+ LQ ++                        K++V    ++  E++   S+ LP Y+QEAPKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  ++I +LV+DS+VDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYD+ NAF  E     ISSLFS+LKVVRLLR+GRV RKLD YLEY A  L+L++  F L+AHWLACIW+SIG  ++ ++V        W+ +L+ +    YR   + +   +  P K  +YITSLY+T++ +T+IGFGN++  T GEK+ SV  M++G+  YATIFG +TTIFQQM +   RYHEM++NV+DF+K + VP+ L+ERV+DYI S+W++TKGIDT KVL+ CPKDM+AD+C+HLNR VFN+H AFRLASDGCLRSLA+ FQTIH APGDLIFH GES+D LCFVVSGSLEVIQDDE++AILG+GD+FG+ FWK+   L+H+ A VRALTYCDLH IKR+ LL +L+FY AF NSF+RNLVLT +L+ RIIFRK+ +VK+E+E  ++ KN+     +  +HPVRK+  K ++
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVEWPVVYSNDGFCKLSGFHRAEVMQKSSTCSFMYGELTDKKTIDKVRQTFDNYESNCFEVLLYRKNRSPVWFYMQVAPIRNENDKVVLFLCTFKDITLFKQPIEDE-STKGWTKFARLTRALTTNRNTLQQLAPMG---------------------KHEVSHKPSRLAEVLQLNSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPCGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAF--ENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKMDSWLYQLAISIGSPYRYNVSGSGRWEGGPGKDSLYITSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMTKGIDTEKVLSICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRSLAVEFQTIHCAPGDLIFHAGESVDTLCFVVSGSLEVIQDDEVIAILGKGDVFGDVFWKE-TTLAHACANVRALTYCDLHVIKREALLKVLEFYTAFANSFSRNLVLTCNLRKRIIFRKIIEVKKEEEERQRAKNEVQLT-IPQDHPVRKLFQKFKQ 716          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnh1a (potassium voltage-gated channel subfamily H member 1-like [Source:NCBI gene;Acc:101155792])

HSP 1 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 408/749 (54.47%), Postives = 539/749 (71.96%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQ-------PETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFY-----GWIPRLSNDTMH-YRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M G RRGLVAPQNTFL+ I+RR N   +NF L N+ I ++PI+YS++GFCK+SGY + EV+ + +TC+FM+G+ T  +  ++ +  FE       E+L YKKN+  +W   +++PIRNE++++ LFL TF +ITA K    D DSSK   KFARL R +T +R +LQ +  +      V              +K+   S   +  ++ S+ LP Y+QE PKTPPHIILHY  FK  WDW+ILILT YTA+MVPYN +FK++  +++ +LVVDSIVDV+F +DIV NFHTTFVGP GEVISDP +IR+NYLK WFVIDLLSCLPYDV NAF+              ISSLFS+LKVVRLLR+GRV RKLD Y+EY A  L+L++  F L AHWLACIW+SIG  ++ ++         W+  L+      YR     +   +  P K  VYITSLY+T++ +TSIGFGN++  T GEK+ +V  M+IG+  YATIFG +TTIFQQM +   RYHEM+++V+DF+K + VP+ L+ERV+DYI+S+W++++GIDT KVL  CPKDM+AD+C+HLNR VF +H AFRLASDGCLR+LA+ FQTIH APGDLI+H GES+D LCFVVSGSLEVIQDDE+VAILG+GD+FG+ FWK+   L+ S A VRALTYCDLH IKRD L  +L+FY AF N F+RNL+LTY+L+ RI+FRK+SDVKRE+E  ++RKN+    +L P+HPVRK+  + R+
Sbjct:    1 MAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTTEKVRLTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQEKVVLFLCTFSDITAFKQPIED-DSSKGWGKFARLTRALTSSRGVLQQLQPTVHKGENV--------------LKH---SRLAEVLQLGSDILPQYKQETPKTPPHIILHYCLFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFENVDENWNHHAVTQGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEETNLVRTDSWLYILAETVGRPYRFNTTGSGKWEGGPNKDSVYITSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMINSVRDFLKLYQVPKGLSERVMDYIASTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTIHCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEVT-LAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSNHFSRNLLLTYNLRKRIVFRKISDVKREEEERQRRKNEAPL-NLPPDHPVRKLFQRFRQ 726          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000035416.1 (SMESG000035416.1)

HSP 1 Score: 2167.89 bits (5616), Expect = 0.000e+0
Identity = 1116/1116 (100.00%), Postives = 1116/1116 (100.00%), Query Frame = 3
Query:  138 MSALSMYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQESENNNCVSKVSPAPDQSKQRQPSKMLWQRLKHPEPIREVEEVSPLPDKNFEEELISIQSADIAEGNVNNGDISKLLNAMQNRFSMEISSLHDHMLLIINRLDDLCSQIKSQKDSGLMDMEITSPMYANSNSSSEESQRLVTKYSFKKSFQRRKSIFKNLFSSSKSTSEPEPCKGNDIKYKRRLFSHNRHNMFKPQIIDQYYSQTTDNDVENIEDEDSSLSPLPIKPIKDQNEVNXXXXXXXXXXXXIDEDTGXXXXXXXXXXXXDVWQRRSFNIHNQVGNCPQKSIFATDKLSFRKIFNKPRSLSKIKTPKYVTTRDI 3485
            MSALSMYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMDDIVFLVVDSIVDVVFFIDIVFNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVKREKELEEKRKNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQESENNNCVSKVSPAPDQSKQRQPSKMLWQRLKHPEPIREVEEVSPLPDKNFEEELISIQSADIAEGNVNNGDISKLLNAMQNRFSMEISSLHDHMLLIINRLDDLCSQIKSQKDSGLMDMEITSPMYANSNSSSEESQRLVTKYSFKKSFQRRKSIFKNLFSSSKSTSEPEPCKGNDIKYKRRLFSHNRHNMFKPQIIDQYYSQTTDNDVENIEDEDSSLSPLPIKPIKDQNEVNFSSFKSSVPSSPIDEDTGSKYSESYSHSNSDVWQRRSFNIHNQVGNCPQKSIFATDKLSFRKIFNKPRSLSKIKTPKYVTTRDI
Sbjct:    1 MSALSMYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMDDIVFLVVDSIVDVVFFIDIVFNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVKREKELEEKRKNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQESENNNCVSKVSPAPDQSKQRQPSKMLWQRLKHPEPIREVEEVSPLPDKNFEEELISIQSADIAEGNVNNGDISKLLNAMQNRFSMEISSLHDHMLLIINRLDDLCSQIKSQKDSGLMDMEITSPMYANSNSSSEESQRLVTKYSFKKSFQRRKSIFKNLFSSSKSTSEPEPCKGNDIKYKRRLFSHNRHNMFKPQIIDQYYSQTTDNDVENIEDEDSSLSPLPIKPIKDQNEVNFSSFKSSVPSSPIDEDTGSKYSESYSHSNSDVWQRRSFNIHNQVGNCPQKSIFATDKLSFRKIFNKPRSLSKIKTPKYVTTRDI 1116          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000035416.1 (SMESG000035416.1)

HSP 1 Score: 2159.03 bits (5593), Expect = 0.000e+0
Identity = 1111/1111 (100.00%), Postives = 1111/1111 (100.00%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQESENNNCVSKVSPAPDQSKQRQPSKMLWQRLKHPEPIREVEEVSPLPDKNFEEELISIQSADIAEGNVNNGDISKLLNAMQNRFSMEISSLHDHMLLIINRLDDLCSQIKSQKDSGLMDMEITSPMYANSNSSSEESQRLVTKYSFKKSFQRRKSIFKNLFSSSKSTSEPEPCKGNDIKYKRRLFSHNRHNMFKPQIIDQYYSQTTDNDVENIEDEDSSLSPLPIKPIKDQNEVNXXXXXXXXXXXXIDEDTGXXXXXXXXXXXXDVWQRRSFNIHNQVGNCPQKSIFATDKLSFRKIFNKPRSLSKIKTPKYVTTRDI 3485
            MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMDDIVFLVVDSIVDVVFFIDIVFNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVKREKELEEKRKNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQESENNNCVSKVSPAPDQSKQRQPSKMLWQRLKHPEPIREVEEVSPLPDKNFEEELISIQSADIAEGNVNNGDISKLLNAMQNRFSMEISSLHDHMLLIINRLDDLCSQIKSQKDSGLMDMEITSPMYANSNSSSEESQRLVTKYSFKKSFQRRKSIFKNLFSSSKSTSEPEPCKGNDIKYKRRLFSHNRHNMFKPQIIDQYYSQTTDNDVENIEDEDSSLSPLPIKPIKDQNEVNFSSFKSSVPSSPIDEDTGSKYSESYSHSNSDVWQRRSFNIHNQVGNCPQKSIFATDKLSFRKIFNKPRSLSKIKTPKYVTTRDI
Sbjct:    1 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMDDIVFLVVDSIVDVVFFIDIVFNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVKREKELEEKRKNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQESENNNCVSKVSPAPDQSKQRQPSKMLWQRLKHPEPIREVEEVSPLPDKNFEEELISIQSADIAEGNVNNGDISKLLNAMQNRFSMEISSLHDHMLLIINRLDDLCSQIKSQKDSGLMDMEITSPMYANSNSSSEESQRLVTKYSFKKSFQRRKSIFKNLFSSSKSTSEPEPCKGNDIKYKRRLFSHNRHNMFKPQIIDQYYSQTTDNDVENIEDEDSSLSPLPIKPIKDQNEVNFSSFKSSVPSSPIDEDTGSKYSESYSHSNSDVWQRRSFNIHNQVGNCPQKSIFATDKLSFRKIFNKPRSLSKIKTPKYVTTRDI 1111          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000035416.1 (SMESG000035416.1)

HSP 1 Score: 2129.75 bits (5517), Expect = 0.000e+0
Identity = 1100/1111 (99.01%), Postives = 1101/1111 (99.10%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQESENNNCVSKVSPAPDQSKQRQPSKMLWQRLKHPEPIREVEEVSPLPDKNFEEELISIQSADIAEGNVNNGDISKLLNAMQNRFSMEISSLHDHMLLIINRLDDLCSQIKSQKDSGLMDMEITSPMYANSNSSSEESQRLVTKYSFKKSFQRRKSIFKNLFSSSKSTSEPEPCKGNDIKYKRRLFSHNRHNMFKPQIIDQYYSQTTDNDVENIEDEDSSLSPLPIKPIKDQNEVNXXXXXXXXXXXXIDEDTGXXXXXXXXXXXXDVWQRRSFNIHNQVGNCPQKSIFATDKLSFRKIFNKPRSLSKIKTPKYVTTRDI 3485
            MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMDDIVFLVVDSIVDVVFFIDIVFNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLE  Q    +    QGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVKREKELEEKRKNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQESENNNCVSKVSPAPDQSKQRQPSKMLWQRLKHPEPIREVEEVSPLPDKNFEEELISIQSADIAEGNVNNGDISKLLNAMQNRFSMEISSLHDHMLLIINRLDDLCSQIKSQKDSGLMDMEITSPMYANSNSSSEESQRLVTKYSFKKSFQRRKSIFKNLFSSSKSTSEPEPCKGNDIKYKRRLFSHNRHNMFKPQIIDQYYSQTTDNDVENIEDEDSSLSPLPIKPIKDQNEVNFSSFKSSVPSSPIDEDTGSKYSESYSHSNSDVWQRRSFNIHNQVGNCPQKSIFATDKLSFRKIFNKPRSLSKIKTPKYVTTRDI
Sbjct:    1 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMDDIVFLVVDSIVDVVFFIDIVFNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLETRQ----INSSSQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVKREKELEEKRKNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTNSTVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQESENNNCVSKVSPAPDQSKQRQPSKMLWQRLKHPEPIREVEEVSPLPDKNFEEELISIQSADIAEGNVNNGDISKLLNAMQNRFSMEISSLHDHMLLIINRLDDLCSQIKSQKDSGLMDMEITSPMYANSNSSSEESQRLVTKYSFKKSFQRRKSIFKNLFSSSKSTSEPEPCKGNDIKYKRRLFSHNRHNMFKPQIIDQYYSQTTDNDVENIEDEDSSLSPLPIKPIKDQNEVNFSSFKSSVPSSPIDEDTGSKYSESYSHSNSDVWQRRSFNIHNQVGNCPQKSIFATDKLSFRKIFNKPRSLSKIKTPKYVTTRDI 1107          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000017777.1 (SMESG000017777.1)

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 437/741 (58.97%), Postives = 561/741 (75.71%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDS-SKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKE-----MISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLR 2357
            M G+RRGLVAPQNT LD IIRRCNSQHS+F LAN+ I ++PIIY +E F K++G+++ EV+ + + C F+HG+ T  ++ D++ +A       Q+E+L +KKN + LW++ Q+ PI NEK E+ L L+TF +ITA+K  ++DE   K   SKFA+LA++V +NRS++  ++                     D+ + + ES   +T       M S+ +P Y+ E PKTPPHIILHY  FK +WDW+IL+LT YTAVMVP+NAAF +++MD ++FL+VDSIVDV+FF+DIV NFHTTFVG  GEVISD  +IRINYLKGWF+IDL+SCLPYDVFNAFQP  +Q  IS L  ALKVVRLLR+GRV RKLDQYLEYMA  L+LMIF F+LLAHW ACIW+++G+ DL+N   YGWIP++  D   ++   N T    N   K L Y TSLY+T+SL+TSIGFGNVSANT  EK   V+FML GA  YAT+FG +TTI  QM S++ARY EMM+N+K+FI+ H VP++L ERV+DY++SSWAITKGIDT KVLNYCPKDMKADL +HLNRMVFN H AFRLASDGCLR+LA+NF T+HTAPGDLIFHQGESIDQLCFVVSGSLEVIQD+E+VAI+G+GD+FG+  W + + L  S +TVR LTYC+LHCIKR+ LL +L+FY +F NSF+RNLVLT +L++R +FRK++D+ +EKEL+E+RK D         HPVRK+ISK R
Sbjct:    1 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVLLLLLTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLT--------------------QDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQP-GSQEGISQLLGALKVVRLLRLGRVLRKLDQYLEYMATMLVLMIFVFLLLAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDC--HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGALIYATVFGNVTTILHQMYSSKARYQEMMNNIKEFIRIHDVPQELGERVLDYVTSSWAITKGIDTEKVLNYCPKDMKADLSVHLNRMVFNSHPAFRLASDGCLRALAVNFTTMHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDEEVVAIMGKGDVFGDNVWVEKS-LGQSASTVRVLTYCNLHCIKREKLLFVLNFYASFANSFSRNLVLTVNLRNRFVFRKINDMNKEKELQERRKEDFNLSKFSNEHPVRKLISKFR 717          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000021280.1 (SMESG000021280.1)

HSP 1 Score: 794.653 bits (2051), Expect = 0.000e+0
Identity = 403/743 (54.24%), Postives = 555/743 (74.70%), Query Frame = 3
Query:  153 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDS-SKFARLARTVTKNRSLL-QHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMXXXXXXXXXXXXXXXXXXXXXXNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNW-----KNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNSTRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLNYCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDLIFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSHSTATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRIIFRKLSDVXXXXXXXXXXXNDNLFEDLDPNHPVRKMISKLRK 2360
            M G+RRGLVAPQNTFLD IIRRCN+QH +F LA++ I +YP++Y +EGF K++GY++ E++ +   C FM G+ T  E     + A E    EQ+E++ YKKN+ +L L+ ++SPI N+K  + LFL+TF++++A K  T +E   +++ SKF +LA++VT+N+ ++ ++    +   S     +++D    +++ K+       +  + + E LP Y+QE PKTPPHIILHY  FK +WDW+IL+L GY A++VP    +     +   F++VDSI+D++FFIDIV NFHTTFVGPNGEV+SDP +IRINY KGWF++D+LSCLPYD+      +++ +  SS+F  +KV RLLR+ R+ R+++ YLEY+   L LMIF F++LAHWLACIW+ +G +DLQN + YGWIPR+ N ++  RN             D L    +VY+TSLYYT+SL+T+IGFGNVSA+T  E+++++  MLIGA  YA IFG +TTI  +M + R+RY+EMM ++KDF+K H V ++L ERVIDY++S+WAITKGID  KVLNYCPKDMKADLC+HLNRMVFN+H AFRLASDGCLR+LAINF T+HTAPGDLI+HQGES+DQLCF+VSGSLEVIQDDEIVAILG+ DIFG+  WKD +  S STAT+RALTYCDLHCIKRD L  +L+F++ F NSF+RNL+LTY+L+ RI+FRK++DVK+E+EL E+RKND    +L  +H VRK++S+ +K
Sbjct:    1 MSGSRRGLVAPQNTFLDNIIRRCNAQHCSFLLASAKILDYPVVYCNEGFNKLTGYNRVEIMQKGGLCTFMQGENTNKEFVALLEKAMEKGETEQVELILYKKNRTQLSLLVRMSPIYNDKKCVTLFLLTFRDVSAFKMPTEEEQIYQENVSKFVKLAKSVTRNKQIISENYPIENGPKSDQNHTISMDDFMKNEFPKF-------EEIDNLMEDLPLYKQETPKTPPHIILHYSPFKTMWDWMILVLVGYNAIVVPLYLTYLFTTSELTKFIIVDSIIDIIFFIDIVLNFHTTFVGPNGEVVSDPVIIRINYFKGWFIVDVLSCLPYDLLTT--GQSSSNQNSSVFKDIKVARLLRLFRILRRMEMYLEYVVSVLALMIFAFLILAHWLACIWYKVGISDLQNGILYGWIPRMFNSSLITRNLDPAFISEAVTTNDTL----MVYLTSLYYTISLVTTIGFGNVSASTQNEQIMTIFCMLIGALIYAAIFGNVTTIVSEMYANRSRYNEMMKSIKDFLKIHDVKKELCERVIDYVTSTWAITKGIDPAKVLNYCPKDMKADLCVHLNRMVFNEHPAFRLASDGCLRALAINFTTLHTAPGDLIYHQGESVDQLCFIVSGSLEVIQDDEIVAILGKDDIFGDYSWKDKHT-SPSTATIRALTYCDLHCIKRDKLQSVLEFHHTFANSFSRNLLLTYNLRQRILFRKIADVKKERELAERRKNDPPLNNLAADHAVRKLLSRFKK 729          
The following BLAST results are available for this feature:
BLAST of Voltage gated potassium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNH50.000e+050.47potassium voltage-gated channel subfamily H member... [more]
KCNH10.000e+054.84potassium voltage-gated channel subfamily H member... [more]
KCNH10.000e+054.84potassium voltage-gated channel subfamily H member... [more]
KCNH10.000e+054.84potassium voltage-gated channel subfamily H member... [more]
KCNH10.000e+054.84potassium voltage-gated channel subfamily H member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-20.000e+051.00pep chromosome:WBcel235:V:1288841:1299208:-1 gene:... [more]
egl-20.000e+051.00pep chromosome:WBcel235:V:1289373:1299332:-1 gene:... [more]
egl-20.000e+050.86pep chromosome:WBcel235:V:1288841:1299208:-1 gene:... [more]
unc-1031.317e-11937.69Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1032.144e-11936.12Potassium voltage-gated channel unc-103 [Source:U... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eag0.000e+057.93gene:FBgn0000535 transcript:FBtr0310016[more]
eag0.000e+054.77gene:FBgn0000535 transcript:FBtr0303286[more]
eag0.000e+054.64gene:FBgn0000535 transcript:FBtr0111009[more]
eag0.000e+056.50gene:FBgn0000535 transcript:FBtr0073955[more]
eag0.000e+054.10gene:FBgn0000535 transcript:FBtr0310014[more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnh1b0.000e+049.32potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh1a0.000e+050.29potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh5b0.000e+054.99potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh5b0.000e+054.99potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh5a0.000e+051.91potassium voltage-gated channel, subfamily H (eag-... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem50b0.000e+053.63transmembrane protein 50B [Source:Xenbase;Acc:XB-G... [more]
tmem50b0.000e+053.63transmembrane protein 50B [Source:Xenbase;Acc:XB-G... [more]
tmem50b0.000e+053.63transmembrane protein 50B [Source:Xenbase;Acc:XB-G... [more]
tmem50b0.000e+047.99transmembrane protein 50B [Source:Xenbase;Acc:XB-G... [more]
tmem50b0.000e+053.63transmembrane protein 50B [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnh50.000e+050.24potassium voltage-gated channel, subfamily H (eag-... [more]
Kcnh10.000e+047.67potassium voltage-gated channel, subfamily H (eag-... [more]
Kcnh10.000e+053.06potassium voltage-gated channel, subfamily H (eag-... [more]
Kcnh65.017e-15738.81potassium voltage-gated channel, subfamily H (eag-... [more]
Kcnh69.316e-15638.81potassium voltage-gated channel, subfamily H (eag-... [more]
back to top
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q02280|KCNAE_DROME0.000e+056.50Potassium voltage-gated channel protein eag OS=Dro... [more]
sp|Q8NCM2|KCNH5_HUMAN0.000e+050.47Potassium voltage-gated channel subfamily H member... [more]
sp|Q9EPI9|KCNH5_RAT0.000e+052.03Potassium voltage-gated channel subfamily H member... [more]
sp|Q920E3|KCNH5_MOUSE0.000e+050.24Potassium voltage-gated channel subfamily H member... [more]
sp|Q63472|KCNH1_RAT0.000e+047.67Potassium voltage-gated channel subfamily H member... [more]
back to top
BLAST of Voltage gated potassium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DCB70.000e+064.51Potassium voltage-gated channel subfamily H member... [more]
A0A4S2M2L10.000e+065.53Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7YRZ90.000e+064.75Potassium voltage-gated channel subfamily H member... [more]
A0A4E0S3G10.000e+061.16Ether a go-go isoform C OS=Fasciola hepatica OX=61... [more]
A0A267DWF60.000e+063.14Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnh5a0.000e+054.72potassium voltage-gated channel subfamily H member... [more]
kcnh5b0.000e+053.91potassium voltage-gated channel subfamily H member... [more]
kcnh5b0.000e+053.91potassium voltage-gated channel subfamily H member... [more]
kcnh5a0.000e+052.79potassium voltage-gated channel subfamily H member... [more]
kcnh1b0.000e+048.58potassium voltage-gated channel, subfamily H (eag-... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnh1b0.000e+052.75potassium voltage-gated channel, subfamily H (eag-... [more]
ENSPMAT00000005594.13.305e-12242.24pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1... [more]
kcnh5b1.171e-10047.98potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh5b2.250e-10047.63potassium voltage-gated channel, subfamily H (eag-... [more]
ENSPMAT00000005922.17.230e-9939.79pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367800.000e+043.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458888.792e-14335.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301402.654e-13636.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470441.529e-9234.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470431.335e-9037.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000036780.10.000e+055.81potassium voltage-gated channel subfamily H member... [more]
ENSORLT00000001433.20.000e+055.81potassium voltage-gated channel subfamily H member... [more]
kcnh1a0.000e+055.12potassium voltage-gated channel subfamily H member... [more]
kcnh5b0.000e+054.77potassium voltage-gated channel subfamily H member... [more]
kcnh1a0.000e+054.47potassium voltage-gated channel subfamily H member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035416.10.000e+0100.00SMESG000035416.1[more]
SMESG000035416.10.000e+0100.00SMESG000035416.1[more]
SMESG000035416.10.000e+099.01SMESG000035416.1[more]
SMESG000017777.10.000e+058.97SMESG000017777.1[more]
SMESG000021280.10.000e+054.24SMESG000021280.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035575 ID=SMED30035575|Name=Voltage gated potassium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=3550bp
ATGATTAACTGGATTTAAAATAAAATTTTTTGAAAGTCATGCGTTGCGAC
TATCTAAACCAACAGATTTATTTCTCCAAATCCGAATCCGAAAAATTTTA
GTGTGATTTAATTCCTCTTTTCTCTTTTTCTAATTCCATGTCAGCTCTGT
CAATGTATGGAAACAGAAGAGGTCTAGTTGCTCCTCAAAATACTTTTTTG
GATAAAATTATCAGACGTTGCAATAGCCAACACTCGAACTTTTTCCTGGC
AAACTCAAACATTTACAACTATCCAATTATCTATTCCAGTGAAGGATTTT
GCAAAATGAGCGGCTACAGCAAAACCGAAGTAATTCATCAGCAAGCCACT
TGTAACTTTATGCACGGGGACGGCACTACTAATGAAATGAAGGACAGATT
CAAAGCGGCCTTTGAAATGTTACATTATGAACAGATTGAAGTTTTATTTT
ACAAAAAAAATAAAAATGAACTGTGGCTAATGTTTCAAGTTAGCCCTATA
AGAAATGAAAAAGACGAAATAAATCTGTTTTTAGTAACATTCAAAAATAT
TACTGCCTTAAAAACTTCCACAAATGATGAAGATAGCTCAAAAGATTCAA
GCAAATTCGCTAGACTTGCTAGGACAGTGACAAAAAACAGGTCGCTATTG
CAGCACATGTCAACGTCAAGTACGAGTTTATCCAAAGTTGGAATTGGGGT
TGCGGTTGACGCAAAAAGCGTTTCTGACTACATAAAATATGACGTTGAAA
GCTGTGGAACACAGACTAAAGAAATGATATCAGAAAAGCTACCTTTCTAT
CGACAGGAAGCTCCAAAAACACCGCCCCACATCATTTTGCATTATCTTAA
TTTCAAAGCTGTTTGGGATTGGATTATTTTAATCCTTACGGGATATACAG
CAGTTATGGTTCCTTATAATGCTGCCTTCAAAAGTCGTAATATGGATGAT
ATTGTCTTTCTAGTTGTCGACAGTATAGTTGATGTTGTATTCTTCATTGA
TATCGTTTTCAATTTCCACACAACCTTTGTCGGACCGAATGGAGAGGTTA
TCTCAGATCCGAATGTTATTCGAATAAATTATCTCAAAGGATGGTTTGTT
ATAGATCTTCTTTCGTGTCTTCCTTATGATGTGTTCAATGCGTTTCAACC
AGAAACTACTCAAAGTGCCATAAGCAGTCTTTTTAGTGCTCTAAAGGTGG
TGAGATTATTACGAATAGGAAGAGTTACTAGAAAACTTGATCAATATTTA
GAATACATGGCTGTATCTTTAATTTTGATGATTTTTGGATTTGTTTTACT
TGCTCATTGGTTGGCCTGTATTTGGTTTAGTATTGGTCACGCAGATTTAC
AAAATAAAGTATTTTACGGTTGGATACCTCGCTTGTCAAACGACACGATG
CATTATCGAAATTGGAAAAATATAACAAATATACAAGACAATCTACCTCC
GAAGAGTCTAGTTTATATAACTTCCTTATATTATACATTATCTTTGATTA
CAAGTATTGGTTTCGGAAATGTCTCCGCAAATACATTTGGAGAGAAGTTG
GTATCAGTCGTATTCATGTTGATTGGAGCGTTTGGATATGCGACAATATT
TGGGAAAATAACAACGATTTTCCAACAAATGAATTCTACAAGAGCAAGAT
ATCACGAAATGATGTCGAACGTAAAAGATTTTATCAAAACACACAGCGTT
CCAAGAGATTTGGCCGAAAGAGTAATTGACTACATCTCTTCTTCTTGGGC
AATCACCAAAGGAATTGACACTGGAAAGGTTCTTAATTACTGCCCGAAAG
ACATGAAAGCAGATTTGTGTATTCATCTAAATCGGATGGTTTTTAATAAA
CATACGGCTTTTCGGTTGGCCAGTGATGGGTGTCTGCGATCTTTGGCCAT
CAACTTCCAAACTATTCATACGGCTCCAGGGGATTTGATTTTTCATCAAG
GAGAAAGCATAGATCAGTTGTGCTTTGTTGTGTCGGGGTCCTTGGAGGTG
ATTCAGGATGATGAGATAGTTGCAATTCTCGGTCAAGGAGATATTTTTGG
TGAAGCTTTCTGGAAAGATCCCAACAAACTCAGTCATTCAACTGCTACAG
TCAGAGCTCTAACATACTGTGATCTGCATTGCATCAAGAGAGACTGTTTG
CTCCACATACTCGATTTTTACAATGCCTTTGGAAATAGTTTTGCGAGAAA
TCTAGTTTTAACGTATGACTTAAAACATCGAATAATATTCCGAAAACTTT
CAGATGTTAAGCGAGAAAAGGAATTGGAAGAAAAACGAAAAAATGATAAC
TTATTCGAAGATCTCGATCCAAATCATCCAGTACGGAAAATGATATCCAA
ACTCAGGAAAGGTCTTCATTCCACAGATCAAACGAACAGTACAGTAGACA
ACAGTCCAGAGCCTTCAGCAAATACTACTGATCGAAAGTCTAGCTATGAT
TCTTTGGCAAATAAATGGACTAGTCTAATGAATAAAGACAAGGTTGGGCC
TGAAACACTCATAAAACTACCTCTGCAAGAATCTGAAAATAATAATTGTG
TTTCAAAGGTTTCACCAGCACCAGATCAGTCTAAACAAAGACAACCTTCT
AAAATGTTGTGGCAAAGACTTAAACATCCCGAGCCGATAAGAGAAGTAGA
AGAAGTATCGCCTCTTCCAGATAAAAATTTTGAAGAAGAATTAATATCAA
TTCAATCTGCAGATATTGCGGAAGGAAACGTTAACAATGGTGACATTTCT
AAATTATTAAACGCAATGCAGAACAGATTCAGCATGGAAATATCTTCCCT
CCATGATCACATGTTATTAATAATAAATCGGCTGGATGATTTGTGTTCCC
AAATAAAATCTCAAAAAGATTCTGGTTTGATGGATATGGAAATTACGTCT
CCAATGTATGCAAATTCAAACAGTTCTTCAGAGGAATCTCAAAGGTTGGT
TACGAAATATTCATTCAAAAAAAGCTTTCAACGTCGCAAATCCATTTTCA
AAAATTTATTCTCTTCTTCAAAATCGACCTCAGAGCCTGAGCCTTGTAAA
GGAAATGACATCAAATACAAGCGACGCCTCTTTAGTCACAACCGTCACAA
CATGTTTAAGCCTCAAATCATTGACCAATATTATAGTCAAACAACAGACA
ACGATGTGGAAAATATCGAAGATGAAGACAGTTCATTGTCTCCACTTCCA
ATAAAACCTATCAAAGACCAAAATGAAGTTAACTTTTCCAGTTTCAAATC
TTCTGTTCCCTCATCTCCGATTGACGAAGACACAGGATCAAAGTATTCAG
AAAGCTATTCACATTCTAACAGCGACGTTTGGCAACGTCGCTCTTTCAAC
ATCCATAATCAGGTTGGTAACTGTCCACAGAAATCCATTTTTGCTACCGA
TAAATTGTCTTTCAGAAAGATTTTCAACAAACCTCGATCTTTATCAAAAA
TAAAAACGCCCAAGTATGTGACAACAAGAGATATTTAACCTTTTCCACCT
GTGACTGAAATATTTCAGTCAAATGAACATATCTCATAGATTACTTCGAG
back to top

protein sequence of SMED30035575-orf-1

>SMED30035575-orf-1 ID=SMED30035575-orf-1|Name=SMED30035575-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1117bp
MSALSMYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYS
SEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQI
EVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDS
SKDSSKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIK
YDVESCGTQTKEMISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILIL
TGYTAVMVPYNAAFKSRNMDDIVFLVVDSIVDVVFFIDIVFNFHTTFVGP
NGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFS
ALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIG
HADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYT
LSLITSIGFGNVSANTFGEKLVSVVFMLIGAFGYATIFGKITTIFQQMNS
TRARYHEMMSNVKDFIKTHSVPRDLAERVIDYISSSWAITKGIDTGKVLN
YCPKDMKADLCIHLNRMVFNKHTAFRLASDGCLRSLAINFQTIHTAPGDL
IFHQGESIDQLCFVVSGSLEVIQDDEIVAILGQGDIFGEAFWKDPNKLSH
STATVRALTYCDLHCIKRDCLLHILDFYNAFGNSFARNLVLTYDLKHRII
FRKLSDVKREKELEEKRKNDNLFEDLDPNHPVRKMISKLRKGLHSTDQTN
STVDNSPEPSANTTDRKSSYDSLANKWTSLMNKDKVGPETLIKLPLQESE
NNNCVSKVSPAPDQSKQRQPSKMLWQRLKHPEPIREVEEVSPLPDKNFEE
ELISIQSADIAEGNVNNGDISKLLNAMQNRFSMEISSLHDHMLLIINRLD
DLCSQIKSQKDSGLMDMEITSPMYANSNSSSEESQRLVTKYSFKKSFQRR
KSIFKNLFSSSKSTSEPEPCKGNDIKYKRRLFSHNRHNMFKPQIIDQYYS
QTTDNDVENIEDEDSSLSPLPIKPIKDQNEVNFSSFKSSVPSSPIDEDTG
SKYSESYSHSNSDVWQRRSFNIHNQVGNCPQKSIFATDKLSFRKIFNKPR
SLSKIKTPKYVTTRDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
GO:0000155phosphorelay sensor kinase activity
Vocabulary: biological process
TermDefinition
GO:0034765regulation of ion transmembrane transport
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0000160phosphorelay signal transduction system
GO:0006810transport
GO:0023014signal transduction by protein phosphorylation
GO:0034220ion transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR027359Volt_channel_dom_sf
IPR030171EAG2
IPR035965PAS-like_dom_sf
IPR003949K_chnl_volt-dep_EAG
IPR003938K_chnl_volt-dep_EAG/ELK/ERG
IPR000595cNMP-bd_dom
IPR001610PAC
IPR005821Ion_trans_dom
IPR014710RmlC-like_jellyroll
IPR000014PAS
IPR000700PAS-assoc_C
IPR018490cNMP-bd-like
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005622intracellular
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003938Potassium channel, voltage-dependent, EAG/ELK/ERGPRINTSPR01463EAGCHANLFMLYcoord: 469..480
score: 52.08
coord: 253..260
score: 75.39
coord: 487..496
score: 58.75
coord: 537..544
score: 61.33
coord: 443..460
score: 62.67
coord: 387..397
score: 78.98
coord: 655..663
score: 92.01
coord: 278..288
score: 59.09
coord: 235..244
score: 66.88
coord: 289..298
score: 72.81
IPR003949Potassium channel, voltage-dependent, EAGPRINTSPR01464EAGCHANNELcoord: 729..740
score: 46.3
coord: 696..710
score: 72.59
coord: 676..691
score: 69.44
coord: 321..329
score: 97.53
coord: 545..557
score: 73.5
coord: 119..132
score: 63.49
coord: 134..145
score: 51.85
coord: 22..29
score: 51.39
coord: 344..353
score: 80.0
IPR001610PAC motifSMARTSM00086pac_2coord: 99..141
e-value: 1.1E-5
score: 34.8
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 574..693
e-value: 7.0E-18
score: 75.4
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 595..676
e-value: 1.6E-14
score: 53.7
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 574..675
score: 17.218
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 574..686
e-value: 3.05273E-24
score: 96.6261
NoneNo IPR availableGENE3DG3DSA:1.10.1200.260coord: 498..537
e-value: 9.6E-13
score: 50.1
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 377..497
e-value: 1.1E-5
score: 27.2
NoneNo IPR availableGENE3DG3DSA:3.30.450.20coord: 8..152
e-value: 6.9E-34
score: 118.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 740..769
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 802..830
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 802..822
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 742..769
NoneNo IPR availablePANTHERPTHR10217VOLTAGE AND LIGAND GATED POTASSIUM CHANNELcoord: 8..789
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 238..499
NoneNo IPR availableTMHMMTMhelixcoord: 471..488
NoneNo IPR availableTMHMMTMhelixcoord: 242..264
NoneNo IPR availableTMHMMTMhelixcoord: 442..464
NoneNo IPR availableTMHMMTMhelixcoord: 378..400
IPR000014PAS domainPFAMPF13426PAS_9coord: 44..140
e-value: 7.7E-14
score: 51.8
IPR000014PAS domainTIGRFAMTIGR00229TIGR00229coord: 47..145
e-value: 5.7E-9
score: 34.1
IPR000014PAS domainCDDcd00130PAScoord: 47..138
e-value: 3.36634E-8
score: 50.3243
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 241..501
e-value: 8.1E-32
score: 110.4
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 239..376
e-value: 3.5E-5
score: 25.5
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 541..718
e-value: 4.9E-68
score: 230.0
IPR030171Potassium voltage-gated channel subfamily H member 5PANTHERPTHR10217:SF533POTASSIUM VOLTAGE-GATED CHANNEL SUBFAMILY H MEMBER 5coord: 8..789
IPR000700PAS-associated, C-terminalPROSITEPS50113PACcoord: 98..150
score: 11.411
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 500..689
IPR035965PAS domain superfamilySUPERFAMILYSSF55785PYP-like sensor domain (PAS domain)coord: 44..140