Protein disulfide-isomerase A5

Overview
NameProtein disulfide-isomerase A5
Smed IDSMED30035571
Length (bp)1773
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein disulfide-isomerase A5 (SMED30035571) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein disulfide-isomerase A5 (SMED30035571) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein disulfide-isomerase A5 (SMED30035571) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein disulfide-isomerase A5 (SMED30035571) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035571

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 49

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig5753uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig5753newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000046440.1 SMESG000027652.1 Contig5038GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig4522uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig4522newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000008704.1 Contig5753uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000008704.1 Contig5753newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000043394.1 Contig4522uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000043394.1 Contig4522newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig5038GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30035571SMESG000005268.1 dd_Smed_v6_1537_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035571SMESG000005268.1 dd_Smed_v6_1537_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30035571SMESG000005268.1 dd_Smed_v6_1537_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035571SMESG000005268.1 dd_Smed_v6_1537_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035571SMESG000005268.1 dd_Smed_v6_1537_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30035571SMESG000005268.1 dd_Smed_v6_1537_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30035571SMESG000005268.1 dd_Smed_v6_1537_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035571SMESG000005268.1 Contig3820uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035571SMESG000005268.1 Contig3820newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035571SMESG000070925.1 Contig3820uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035571SMESG000070925.1 Contig3820newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30035571SMESG000005268.1 dd_Smed_v4_1537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035571SMESG000005268.1 dd_Smed_v4_1537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035571SMESG000005268.1 dd_Smed_v4_1537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035571SMESG000005268.1 dd_Smed_v4_1537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035571SMESG000005268.1 dd_Smed_v4_1537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035571SMESG000005268.1 dd_Smed_v4_1537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30035571SMESG000005268.1 dd_Smed_v4_1537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035571SMESG000005268.1 dd_Smed_v4_1537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035571SMESG000005268.1 dd_Smed_v4_1537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035571SMESG000005268.1 dd_Smed_v4_2070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035571SMESG000005268.1 dd_Smed_v4_2070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30035571SMESG000005268.1 dd_Smed_v4_2070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035571SMESG000005268.1 dd_Smed_v4_2070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035571SMESG000005268.1 dd_Smed_v4_2070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig27064uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig27064newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig12369uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig12369newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig3820uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig3820newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000070925.1 Contig3820uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000070925.1 Contig3820newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig50702uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig50702newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig41933uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig41933newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig36861uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035571SMESG000005268.1 Contig36861newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Human
Match: PDIA5 (protein disulfide isomerase family A member 5 [Source:HGNC Symbol;Acc:HGNC:24811])

HSP 1 Score: 167.933 bits (424), Expect = 9.497e-45
Identity = 109/338 (32.25%), Postives = 179/338 (52.96%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEG-DNSKEALIKFVHNPTQPPPQK-DVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQM---AENKKVAFIGVDCT-DESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETH--LAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFYAPWC  CK+M P F  AAT L+G ++  G+N   S  +++K+ +++ G+P++   + G  +F+Y+   ++ E +++++ NP  P PQ  + PW++E   +  LTD +F +++ +H SV+VMF+APWCGHCK  KP+F  AA  +   A++  V    VD T +++ A+      I+ FP  +YF   KN       + R +  F+ +M NP  P         +     +++ L  +NF +  +      LVMFY+PWC HC  + P F   A+  +        AAVD   + +  L  Q  V G+PT  Y+       KY  +RT+   T ++
Sbjct:  176 MFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFEKAAEALHGEADSSGV-LAAVDATVNKALAE---RFHISEFPTLKYF---KNGEKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQ---QTSVLHLVGDNF-RETLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKDDR-KIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYHYGKFAEKYDSDRTELGFTNYI 501          

HSP 2 Score: 126.331 bits (316), Expect = 3.240e-30
Identity = 95/322 (29.50%), Postives = 153/322 (47.52%), Query Frame = 1
Query:   49 FAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPS-----VFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHES-VIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRH-WRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSC-LIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
             +  A  +KG+     ++   + +  L +   +   P      +F  QDG    +Y    + ++++ F+ +P  PP  ++ P +++   +D  ++ +F   L + E  +++MFYAPWC  CK   P F  AA Q+  +  +A  G++     F +I     + GFP   YF  G+     + +     +D V ++ NP  PQ       W    G  ++  L   +F Q +  H+S  LVMF++PWCGHC  MKP F  AA  L     S  ++AAVDAT    LA ++ +S FPTL YF  NG+       RT     E+M
Sbjct:   67 LSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLD--SEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLA--GMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYD-NYGSTAEDIVEWLKNPQPPQPQVPETPWADEGG--SVYHLTDEDFDQFVKEHSS-VLVMFHAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFK-NGEKYAVPVLRTKKKFLEWM 379          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Human
Match: TXNDC5 (thioredoxin domain containing 5 [Source:HGNC Symbol;Acc:HGNC:21073])

HSP 1 Score: 154.451 bits (389), Expect = 1.478e-40
Identity = 96/358 (26.82%), Postives = 167/358 (46.65%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQF---AAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFV-----HNPTQPPPQKDVPWSEETNEIDF-LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSN-------------SEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
            MF+APWCG+C++++P +        +++   +++    D +   D+  A  + GYP++ L + G +  KY+G    + L  ++       P  P P+ + P + E  +  + L+ +NF  ++ Q +  I  F+APWCGHCKA  P +   A  +  ++ V    VDCT     ++C+   + G+P   +F  GK                  E  L+R E      +T    P L A     +      ++ L +NNF   I    +   + FY+PWCGHC  + P++   + K    L    IA VD T E ++ ++Y V G+PTL+ F       ++ G R  D++  F++ +  D
Sbjct:   83 MFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVA-KVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFI-KFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHY--ELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADK----GTVLALTENNFDDTIAEGIT--FIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAKD 430          

HSP 2 Score: 102.449 bits (254), Expect = 1.273e-22
Identity = 63/233 (27.04%), Postives = 111/233 (47.64%), Query Frame = 1
Query:  310 LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQM--AENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPG----HEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            L  A+ + +  Q  +  VMF+APWCGHC+  +P +    ++    E+ KV    VDCT  S  D+C+++G+ G+P  + F  G+     +Y   R+      +M    N +          P      + +  L  +NF  ++        + F++PWCGHC A+ P++   A  L+    +  I  VD T    L +  +V G+PTL++F       +Y G+R  +++ E++
Sbjct:   65 LYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHS--DVCSAQGVRGYPTLKLFKPGQEA--VKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQ--GDHFIKFFAPWCGHCKALAPTWEQLALGLEH-SETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYV 290          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Human
Match: TXNDC5 (thioredoxin domain containing 5 [Source:HGNC Symbol;Acc:HGNC:21073])

HSP 1 Score: 134.42 bits (337), Expect = 2.242e-34
Identity = 87/320 (27.19%), Postives = 145/320 (45.31%), Query Frame = 1
Query:  106 DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFV-----HNPTQPPPQKDVPWSEETNEIDF-LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSN-------------SEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
            D +   D+  A  + GYP++ L + G +  KY+G    + L  ++       P  P P+ + P + E  +  + L+ +NF  ++ Q +  I  F+APWCGHCKA  P +   A  +  ++ V    VDCT     ++C+   + G+P   +F  GK                  E  L+R E      +T    P L A     +      ++ L +NNF   I    +   + FY+PWCGHC  + P++   + K    L    IA VD T E ++ ++Y V G+PTL+ F       ++ G R  D++  F++ +  D
Sbjct:   12 DCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFI-KFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHY--ELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADK----GTVLALTENNFDDTIAEGIT--FIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAKD 322          

HSP 2 Score: 97.0561 bits (240), Expect = 2.223e-21
Identity = 67/228 (29.39%), Postives = 110/228 (48.25%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLK-GKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHN--------------PTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTS-AANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQL 639
            F+APWCG+CK + P +   A  L+  +++ IG   D +   +L     + GYP++   +DG KV +Y+G    E+L ++V +              P++ P     P +++   +  LT+ NF + + +  + I  FYAPWCGHCK   P +   +  +      V    VDCT E   +IC+   + G+P    F  GK    SE+S  R+ D    F+ + A  +L
Sbjct:  104 FFAPWCGHCKALAPTWEQLALGLEHSETVKIG-KVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGT-VLALTENNFDDTIAEGITFI-KFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAER--NICSKYSVRGYPTLLLFRGGKKV--SEHSGGRDLDSLHRFVLSQAKDEL 324          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Human
Match: PDIA4 (protein disulfide isomerase family A member 4 [Source:HGNC Symbol;Acc:HGNC:30167])

HSP 1 Score: 134.035 bits (336), Expect = 1.701e-32
Identity = 77/236 (32.63%), Postives = 120/236 (50.85%), Query Frame = 1
Query:  295 NEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAE-NKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKK 999
            N +  L DANF  ++   ++V++ FYAPWCGHCK   P++   AN + + +  +    +D T  S   + +   ++G+P  +    G+     +Y   R +++ VA +   + P       W   P  E  ++L K NF   +V+     LV FY+PWCGHC  + P +  AA +L    P   +A VDAT ET LA ++ VSG+PTL  F   G    Y G R    I ++MI++
Sbjct:   62 NGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASV--LASRFDVSGYPTIKILKKGQAV---DYEGSRTQEEIVAKVREVSQPD------W--TPPPEVTLVLTKENF-DEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFR-KGRPYDYNGPREKYGIVDYMIEQ 282          

HSP 2 Score: 124.405 bits (311), Expect = 2.981e-29
Identity = 94/353 (26.63%), Postives = 157/353 (44.48%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAE-NKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKY----------MGERTDDAITEFMIKKHSDIIRHEE 1026
            FYAPWCG+CKQ  P++   A  LK K   I +   D ++   L   F+++GYP++ +++ G  V  YEG  ++E ++  V   +QP       W+        LT  NF E ++  + ++V FYAPWCGHCK   P++  AA ++++ +  +    VD T E+  D+     ++G+P  + F  G+     +Y+  RE+   V +M   + P           P  E + + +   F+++      G  V+    + G        + +AAN L+             T  T +A   KVS    LV   P     KY           G   D AI +F++K    ++ H +
Sbjct:   86 FYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAV-DYEGSRTQEEIVAKVREVSQPD------WTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAET--DLAKRFDVSGYPTLKIFRKGRPY---DYNGPREKYGIVDYMIEQSGP-----------PSKEILTLKQVQEFLKD------GDDVIIIGVFKGESDPAYQQYQDAANNLREDY------KFHHTFSTEIAKFLKVSQG-QLVVMQPEKFQSKYEPRSHMMDVQQGSTQDSAIKDFVLKYALPLVGHRK 402          

HSP 3 Score: 67.3958 bits (163), Expect = 4.289e-11
Identity = 49/168 (29.17%), Postives = 87/168 (51.79%), Query Frame = 1
Query:  556 NTSNSEYSLEREEDD------FV-AFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDW---VKYM-GERTDDAITEFMIKKHSDIIRHEE 1026
            + S  ++++E EE D      FV AF      P + ++   +   G   +V+     F   ++      L+ FY+PWCGHC  ++P + + A K +      +IA +DAT     + +YKV GFPT +YF+P+GD    VK+  G+R  + +++F+ +  + + R +E
Sbjct:  481 DESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVV--GKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKG-QKGLVIAKMDATANDVPSDRYKVEGFPT-IYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKE 644          

HSP 4 Score: 59.3066 bits (142), Expect = 1.440e-8
Identity = 28/83 (33.73%), Postives = 45/83 (54.22%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNK--VFKYE-GDNSKEALIKFVH 243
            FYAPWCG+CKQ++P + + A   KG+   +    D +  D     + + G+P+++    G+K    K+E GD   E L KF+ 
Sbjct:  551 FYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIE 633          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Human
Match: PDIA4 (protein disulfide isomerase family A member 4 [Source:HGNC Symbol;Acc:HGNC:30167])

HSP 1 Score: 134.035 bits (336), Expect = 1.739e-32
Identity = 77/236 (32.63%), Postives = 120/236 (50.85%), Query Frame = 1
Query:  295 NEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAE-NKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKK 999
            N +  L DANF  ++   ++V++ FYAPWCGHCK   P++   AN + + +  +    +D T  S   + +   ++G+P  +    G+     +Y   R +++ VA +   + P       W   P  E  ++L K NF   +V+     LV FY+PWCGHC  + P +  AA +L    P   +A VDAT ET LA ++ VSG+PTL  F   G    Y G R    I ++MI++
Sbjct:   62 NGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASV--LASRFDVSGYPTIKILKKGQAV---DYEGSRTQEEIVAKVREVSQPD------W--TPPPEVTLVLTKENF-DEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFR-KGRPYDYNGPREKYGIVDYMIEQ 282          

HSP 2 Score: 126.331 bits (316), Expect = 7.582e-30
Identity = 91/351 (25.93%), Postives = 157/351 (44.73%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAE-NKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVY--------FSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEE 1026
            FYAPWCG+CKQ  P++   A  LK K   I +   D ++   L   F+++GYP++ +++ G  V  YEG  ++E ++  V   +QP       W+        LT  NF E ++  + ++V FYAPWCGHCK   P++  AA ++++ +  +    VD T E+  D+     ++G+P  + F  G+     +Y+  RE+   V +M   + P           P  E + + +   F+++      G  V+    + G        + +AAN L+             T  T +A   KVS    +V         + P    +   G   D AI +F++K    ++ H +
Sbjct:   86 FYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAV-DYEGSRTQEEIVAKVREVSQPD------WTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAET--DLAKRFDVSGYPTLKIFRKGRPY---DYNGPREKYGIVDYMIEQSGP-----------PSKEILTLKQVQEFLKD------GDDVIIIGVFKGESDPAYQQYQDAANNLREDY------KFHHTFSTEIAKFLKVSQGQLVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRK 401          

HSP 3 Score: 67.3958 bits (163), Expect = 4.397e-11
Identity = 49/168 (29.17%), Postives = 87/168 (51.79%), Query Frame = 1
Query:  556 NTSNSEYSLEREEDD------FV-AFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDW---VKYM-GERTDDAITEFMIKKHSDIIRHEE 1026
            + S  ++++E EE D      FV AF      P + ++   +   G   +V+     F   ++      L+ FY+PWCGHC  ++P + + A K +      +IA +DAT     + +YKV GFPT +YF+P+GD    VK+  G+R  + +++F+ +  + + R +E
Sbjct:  480 DESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVV--GKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKG-QKGLVIAKMDATANDVPSDRYKVEGFPT-IYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKE 643          

HSP 4 Score: 59.3066 bits (142), Expect = 1.414e-8
Identity = 28/83 (33.73%), Postives = 45/83 (54.22%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNK--VFKYE-GDNSKEALIKFVH 243
            FYAPWCG+CKQ++P + + A   KG+   +    D +  D     + + G+P+++    G+K    K+E GD   E L KF+ 
Sbjct:  550 FYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIE 632          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Celegans
Match: C14B9.2 (Probable protein disulfide-isomerase A4 [Source:UniProtKB/Swiss-Prot;Acc:P34329])

HSP 1 Score: 131.724 bits (330), Expect = 4.239e-32
Identity = 76/227 (33.48%), Postives = 116/227 (51.10%), Query Frame = 1
Query:  310 LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            LTD NF  +L ++ SV+V FYAPWCGHCK   P++  A+++++    +    VD T E+  ++     I G+P  +++  GK  ++  Y   R+E   V ++ +  +P           P  E +V L   NF  + +S+    LV FY+PWCGHC  + P +  AA KL+       +  VDAT E  L  +Y VSG+PT+     NG    Y G R    I ++M
Sbjct:   41 LTDKNFDAFLKKNPSVLVKFYAPWCGHCKHLAPEYEKASSKVS----IPLAKVDATVET--ELGKRFEIQGYPTLKFWKDGKGPND--YDGGRDEAGIVEWVESRVDPNYK--------PPPEEVVTLTTENF-DDFISNNELVLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDATIEKDLGTKYGVSGYPTMKIIR-NGRRFDYNGPREAAGIIKYM 249          

HSP 2 Score: 121.324 bits (303), Expect = 1.075e-28
Identity = 72/238 (30.25%), Postives = 122/238 (51.26%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPT----QPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQM-AENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTN---PANPQLDARRHWRRIPGHEAIVIL 693
            FYAPWCG+CK + P++  A++ +   SI +    D +   +L + F I GYP++   +DG     Y+G   +  ++++V +      +PPP+          E+  LT  NF +++  +E V+V FYAPWCGHCK   P++  AA ++ A+  KV    VD T E   D+ T  G++G+P  +    G+     +Y+  RE    + +MT+   PA  +L   +   R    + + I+
Sbjct:   60 FYAPWCGHCKHLAPEYEKASSKV---SIPLA-KVDATVETELGKRFEIQGYPTLKFWKDGKGPNDYDGGRDEAGIVEWVESRVDPNYKPPPE----------EVVTLTTENFDDFISNNELVLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDATIEK--DLGTKYGVSGYPTMKIIRNGRRF---DYNGPREAAGIIKYMTDQSKPAAKKLPKLKDVERFMSKDDVTII 278          

HSP 3 Score: 72.7886 bits (177), Expect = 3.425e-13
Identity = 42/142 (29.58%), Postives = 76/142 (53.52%), Query Frame = 1
Query:  592 EDDFVAFMTNPANPQLDARRHWRRIPGHE----AIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNG---DWVKYMGERTDDAITEFMIK 996
            +++  AFM   ++ +  A+ H +  P  +     +  +  +NF + +   +   L+ FY+PWCGHC + +  +V  A  L+   P+ ++A +DAT      +Q+ V GFPT +YF+P G   + +KY G R  + + +FM K
Sbjct:  469 DENLEAFMKQISSGK--AKAHVKSAPAPKDDKGPVKTVVGSNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQALKKTQPNVVLAKMDATI-NDAPSQFAVEGFPT-IYFAPAGKKSEPIKYSGNRDLEDLKKFMTK 606          

HSP 4 Score: 60.077 bits (144), Expect = 2.868e-9
Identity = 42/152 (27.63%), Postives = 70/152 (46.05%), Query Frame = 1
Query:  193 FKYEGDNSKEALIKFV-------HNPTQPPPQKDVPWSEETNEIDFLTDANFYEYL-DQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENK-KVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTN 621
            F  E D + EA +K +       H  + P P+ D         +  +  +NF + + D+ + V++ FYAPWCGHCK+ + K+   A  + + +  V    +D T     D  +   + GFP   +   GK +   +YS  R+ +D   FMT 
Sbjct:  464 FDGELDENLEAFMKQISSGKAKAHVKSAPAPKDD------KGPVKTVVGSNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQALKKTQPNVVLAKMDAT---INDAPSQFAVEGFPTIYFAPAGKKSEPIKYSGNRDLEDLKKFMTK 606          

HSP 5 Score: 51.9878 bits (123), Expect = 9.611e-7
Identity = 26/81 (32.10%), Postives = 41/81 (50.62%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKV--FKYEGDNSKEALIKFV 240
            FYAPWCG+CK  + ++   A  LK     + +    +T +D    F + G+P+++    G K    KY G+   E L KF+
Sbjct:  524 FYAPWCGHCKSFESKYVELAQALKKTQPNVVLAKMDATINDAPSQFAVEGFPTIYFAPAGKKSEPIKYSGNRDLEDLKKFM 604          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 108.227 bits (269), Expect = 2.484e-25
Identity = 100/343 (29.15%), Postives = 152/343 (44.31%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLK--GKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVA-FIGVDCTDE--SFADICTSEGITGF-PIFRYF---NYGKNTSNSEYSLEREEDDFVAFMTNPANPQL---DARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGD--WVKYMGERTDDAITEFM 990
            FYAPWCG+CK + P++A AAT LK  G  I +G   D +   ++   F + GYP++ L ++G K  +Y G    +++I ++   T P  +              L DA+  + L +   V+V+      G+ K T      A   + EN ++  F G+   DE  +   I   E +T F P F      N  K T N              ++     P L   D    W + P    + IL   NF Q    +T   LV FY+PWCGHC  + P++     K      S +IA +D+T   +     K+  FPT+ +F P G    V Y G+RT +  T+F+
Sbjct:   47 FYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLG-KLDATVHGEVSSKFEVRGYPTLKLFRNG-KPQEYNGGRDHDSIIAWLKKKTGPVAKP-------------LADADAVKELQESADVVVI------GYFKDTTS--DDAKTFLEENARIMEFFGLK-KDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQN--------------YLDGSVKPHLMSEDIPEDWDKNP----VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFAD-DESIVIAKMDST--LNEVEDVKIQSFPTIKFF-PAGSNKVVDYTGDRTIEGFTKFL 343          

HSP 2 Score: 78.1814 bits (191), Expect = 2.454e-15
Identity = 38/118 (32.20%), Postives = 66/118 (55.93%), Query Frame = 1
Query:  664 IPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIR 1017
            I   E +++L K+NF   +++     LV FY+PWCGHC ++ P +  AA +L+       +  +DAT    ++++++V G+PTL  F  NG   +Y G R  D+I  ++ KK   + +
Sbjct:   19 IEEEENVIVLTKDNF-DEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFR-NGKPQEYNGGRDHDSIIAWLKKKTGPVAK 134          

HSP 3 Score: 72.0182 bits (175), Expect = 2.849e-13
Identity = 38/117 (32.48%), Postives = 61/117 (52.14%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIG-VDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP 633
            EE   +  LT  NF E ++ +E ++V FYAPWCGHCK+  P++  AA Q+ E      +G +D T     ++ +   + G+P  + F  GK     EY+  R+ D  +A++     P
Sbjct:   20 EEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDAT--VHGEVSSKFEVRGYPTLKLFRNGK---PQEYNGGRDHDSIIAWLKKKTGP 131          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 108.227 bits (269), Expect = 2.484e-25
Identity = 100/343 (29.15%), Postives = 152/343 (44.31%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLK--GKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVA-FIGVDCTDE--SFADICTSEGITGF-PIFRYF---NYGKNTSNSEYSLEREEDDFVAFMTNPANPQL---DARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGD--WVKYMGERTDDAITEFM 990
            FYAPWCG+CK + P++A AAT LK  G  I +G   D +   ++   F + GYP++ L ++G K  +Y G    +++I ++   T P  +              L DA+  + L +   V+V+      G+ K T      A   + EN ++  F G+   DE  +   I   E +T F P F      N  K T N              ++     P L   D    W + P    + IL   NF Q    +T   LV FY+PWCGHC  + P++     K      S +IA +D+T   +     K+  FPT+ +F P G    V Y G+RT +  T+F+
Sbjct:   47 FYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLG-KLDATVHGEVSSKFEVRGYPTLKLFRNG-KPQEYNGGRDHDSIIAWLKKKTGPVAKP-------------LADADAVKELQESADVVVI------GYFKDTTS--DDAKTFLEENARIMEFFGLK-KDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQN--------------YLDGSVKPHLMSEDIPEDWDKNP----VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFAD-DESIVIAKMDST--LNEVEDVKIQSFPTIKFF-PAGSNKVVDYTGDRTIEGFTKFL 343          

HSP 2 Score: 78.1814 bits (191), Expect = 2.454e-15
Identity = 38/118 (32.20%), Postives = 66/118 (55.93%), Query Frame = 1
Query:  664 IPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIR 1017
            I   E +++L K+NF   +++     LV FY+PWCGHC ++ P +  AA +L+       +  +DAT    ++++++V G+PTL  F  NG   +Y G R  D+I  ++ KK   + +
Sbjct:   19 IEEEENVIVLTKDNF-DEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFR-NGKPQEYNGGRDHDSIIAWLKKKTGPVAK 134          

HSP 3 Score: 72.0182 bits (175), Expect = 2.849e-13
Identity = 38/117 (32.48%), Postives = 61/117 (52.14%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIG-VDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP 633
            EE   +  LT  NF E ++ +E ++V FYAPWCGHCK+  P++  AA Q+ E      +G +D T     ++ +   + G+P  + F  GK     EY+  R+ D  +A++     P
Sbjct:   20 EEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDAT--VHGEVSSKFEVRGYPTLKLFRNGK---PQEYNGGRDHDSIIAWLKKKTGP 131          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 108.227 bits (269), Expect = 6.164e-25
Identity = 100/375 (26.67%), Postives = 161/375 (42.93%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLK--GKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQP--PPQKDVPWSEETNE------IDFLTD---------------ANFYEYLDQHESVI---------VMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITG--FPIFRYFNYGKNTSNSEYSLEREEDDFVA-----FMTNPANPQL---DARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGD--WVKYMGERTDDAITEFM 990
            FYAPWCG+CK + P++A AAT LK  G  I +G   D +   ++   F + GYP++ L ++G K  +Y G    +++I ++   T P   P  D    +E  E      I +  D               A   E+  +  SVI         ++F +         + +F +AA Q     KV F+ ++   E  A I    G+     P  R  +  ++ +  +   E    + ++     ++     P L   D    W + P    + IL   NF Q    +T   LV FY+PWCGHC  + P++     K      S +IA +D+T   +     K+  FPT+ +F P G    V Y G+RT +  T+F+
Sbjct:   47 FYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLG-KLDATVHGEVSSKFEVRGYPTLKLFRNG-KPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDTTSDDAKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQF--KGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNP----VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFAD-DESIVIAKMDST--LNEVEDVKIQSFPTIKFF-PAGSNKVVDYTGDRTIEGFTKFL 409          

HSP 2 Score: 78.1814 bits (191), Expect = 3.773e-15
Identity = 38/118 (32.20%), Postives = 66/118 (55.93%), Query Frame = 1
Query:  664 IPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIR 1017
            I   E +++L K+NF   +++     LV FY+PWCGHC ++ P +  AA +L+       +  +DAT    ++++++V G+PTL  F  NG   +Y G R  D+I  ++ KK   + +
Sbjct:   19 IEEEENVIVLTKDNF-DEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFR-NGKPQEYNGGRDHDSIIAWLKKKTGPVAK 134          

HSP 3 Score: 72.0182 bits (175), Expect = 3.709e-13
Identity = 38/117 (32.48%), Postives = 61/117 (52.14%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIG-VDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP 633
            EE   +  LT  NF E ++ +E ++V FYAPWCGHCK+  P++  AA Q+ E      +G +D T     ++ +   + G+P  + F  GK     EY+  R+ D  +A++     P
Sbjct:   20 EEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDAT--VHGEVSSKFEVRGYPTLKLFRNGK---PQEYNGGRDHDSIIAWLKKKTGP 131          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 108.227 bits (269), Expect = 6.164e-25
Identity = 100/375 (26.67%), Postives = 161/375 (42.93%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLK--GKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQP--PPQKDVPWSEETNE------IDFLTD---------------ANFYEYLDQHESVI---------VMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITG--FPIFRYFNYGKNTSNSEYSLEREEDDFVA-----FMTNPANPQL---DARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGD--WVKYMGERTDDAITEFM 990
            FYAPWCG+CK + P++A AAT LK  G  I +G   D +   ++   F + GYP++ L ++G K  +Y G    +++I ++   T P   P  D    +E  E      I +  D               A   E+  +  SVI         ++F +         + +F +AA Q     KV F+ ++   E  A I    G+     P  R  +  ++ +  +   E    + ++     ++     P L   D    W + P    + IL   NF Q    +T   LV FY+PWCGHC  + P++     K      S +IA +D+T   +     K+  FPT+ +F P G    V Y G+RT +  T+F+
Sbjct:   47 FYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLG-KLDATVHGEVSSKFEVRGYPTLKLFRNG-KPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDTTSDDAKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQF--KGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNP----VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFAD-DESIVIAKMDST--LNEVEDVKIQSFPTIKFF-PAGSNKVVDYTGDRTIEGFTKFL 409          

HSP 2 Score: 78.1814 bits (191), Expect = 3.773e-15
Identity = 38/118 (32.20%), Postives = 66/118 (55.93%), Query Frame = 1
Query:  664 IPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIR 1017
            I   E +++L K+NF   +++     LV FY+PWCGHC ++ P +  AA +L+       +  +DAT    ++++++V G+PTL  F  NG   +Y G R  D+I  ++ KK   + +
Sbjct:   19 IEEEENVIVLTKDNF-DEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFR-NGKPQEYNGGRDHDSIIAWLKKKTGPVAK 134          

HSP 3 Score: 72.0182 bits (175), Expect = 3.709e-13
Identity = 38/117 (32.48%), Postives = 61/117 (52.14%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIG-VDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP 633
            EE   +  LT  NF E ++ +E ++V FYAPWCGHCK+  P++  AA Q+ E      +G +D T     ++ +   + G+P  + F  GK     EY+  R+ D  +A++     P
Sbjct:   20 EEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDAT--VHGEVSSKFEVRGYPTLKLFRNGK---PQEYNGGRDHDSIIAWLKKKTGP 131          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Fly
Match: CG9302 (gene:FBgn0032514 transcript:FBtr0080470)

HSP 1 Score: 217.238 bits (552), Expect = 2.733e-63
Identity = 128/341 (37.54%), Postives = 180/341 (52.79%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTL--KGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNP-TQPPPQKDVP-WSEETN-EIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFI-GVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLE---REEDDFVAFMTNPANPQLDARRHWRRIPGHEA--IVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFY PWCG+CK+MKP++  A+T L  KG  I   +N +      +++ FNITG+P++   ++G   F YEG+N+KEAL+ F+ NP  +P P+   P WS +TN EI  LT   F   L   +S +VMFYAPWCGHCK  KP++  AA +M + K    +  +D T E    I     + G+P  ++F      SN  +  E   RE    V FM +P  P              ++  ++ L+ +NF  + +     ALVMFY+PWCGHC   KP F  AA  LQ   P     A+D T    L A+Y V G+PT++YFS     + Y G RT      +M
Sbjct:  168 MFYVPWCGFCKKMKPEYGKASTELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGENNKEALVSFMLNPNAKPTPKPKEPEWSADTNSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEP--SIAEKYKVKGYPTVKFF------SNGVFKFEVNVREASKIVEFMRDPKEPPPPPPPEKSWEEEEDSKEVLFLDDDNF-SSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQD-DPRIAFVAIDCTKLAALCAKYNVRGYPTILYFSYLKTKLDYNGGRTSKDFIAYM 498          

HSP 2 Score: 152.14 bits (383), Expect = 1.827e-39
Identity = 86/216 (39.81%), Postives = 131/216 (60.65%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDD--LKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEA--LIKFVHNPTQPPPQKDVPWSE----ETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNP 624
            MFYAPWCG+CK+MKP++  AA  +K K I  G+   L  T +  + + + + GYP+V    +G  VFK+E  N +EA  +++F+ +P +PPP      S     ++ E+ FL D NF   L + +  +VMFYAPWCGHCK TKP+FT+AA  + ++ ++AF+ +DCT    A +C    + G+P   YF+Y K  +  +Y+  R   DF+A+M NP
Sbjct:  294 MFYAPWCGHCKRMKPEYEKAALEMKQKKI-PGLLAALDATKEPSIAEKYKVKGYPTVKFFSNG--VFKFEV-NVREASKIVEFMRDPKEPPPPPPPEKSWEEEEDSKEVLFLDDDNFSSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDCT--KLAALCAKYNVRGYPTILYFSYLK--TKLDYNGGRTSKDFIAYMNNP 501          

HSP 3 Score: 144.436 bits (363), Expect = 8.255e-37
Identity = 100/320 (31.25%), Postives = 154/320 (48.12%), Query Frame = 1
Query:   49 FAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYP-SVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFL---TDANFYEYLDQH-ESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNP-ANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            F  AA  ++G    + ++        L +   ++  P ++   +DG+    Y+   S  ++I F+ +P+      D+PW E+    D L     A+F ++L +    ++VMFY PWCG CK  KP++  A+ ++          ++   +  A I     ITGFP   YF  GK      Y  E  ++  V+FM NP A P    +        +  IV L    F   +    S ALVMFY+PWCGHC  MKP +  AA +++      L+AA+DAT E  +A +YKV G+PT+ +FS NG +   +  R    I EFM
Sbjct:   63 FREAAEAIRGTGTMLLLDCGQQDRKKLCKKLKVSPDPYAIKHYKDGDFHKDYDRQLSVSSMITFMRDPSG-----DLPWEEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGK--LRFTYEGENNKEALVSFMLNPNAKPTPKPKEPEWSADTNSEIVHLTSQGFEPALKDEKS-ALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFS-NGVFKFEVNVREASKIVEFM 373          

HSP 4 Score: 74.3294 bits (181), Expect = 1.031e-13
Identity = 45/178 (25.28%), Postives = 78/178 (43.82%), Query Frame = 1
Query:  466 VDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIP-GHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAA-VDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMI 993
            +DC  +    +C    ++  P +   +Y     + +Y  +      + FM +P+         W   P G + +   +  +F +++       LVMFY PWCG C  MKP +  A+ +L+T     L A  V+      +   + ++GFPTL+YF        Y GE   +A+  FM+
Sbjct:   79 LDCGQQDRKKLCKKLKVSPDP-YAIKHYKDGDFHKDYDRQLSVSSMITFMRDPS-----GDLPWEEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGENNKEALVSFML 250          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Fly
Match: prtp (gene:FBgn0030329 transcript:FBtr0303334)

HSP 1 Score: 117.087 bits (292), Expect = 6.123e-28
Identity = 90/362 (24.86%), Postives = 149/362 (41.16%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKP---QFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNK-VFKYEGDNSKEALIKFVHNPTQPPPQKDVP--WSEETNEIDF-----LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILE------------------KNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATT--ETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIK 996
            F+APWCG+CK+++P   Q A        K I   +  D +    L     +TGYP++ L + G +   K++G     A+  F++     P + D+     E+   ++      LT+  F +++       V F+APWC HC+   P +   A ++ +   V    +DCT   F  IC    + G+P   +   GK      YS  R+      ++       L+         G E +VI E                  ++ F Q I      A + FY+PWCGHC  ++P++   A +      S  IA VD T      +    +V G+PTL  +       +Y G R+   +  ++ K
Sbjct:   60 FFAPWCGHCKRIQPLWEQLAEIMNVDNPKVIIAKV--DCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPAEADLGEVKREQVENLNIGKVVDLTEDTFAKHVSTGNH-FVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCT--QFRSICQDFEVKGYPTLLWIEDGKKIEK--YSGARDLSTLKTYVEKMVGVPLEKTAG---EAGDEKVVIEEVAGEEDAAKKLTPQQLTGEDEFDQAIAEGV--AFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSLPELQAYLKK 409          

HSP 2 Score: 102.064 bits (253), Expect = 6.191e-23
Identity = 62/210 (29.52%), Postives = 101/210 (48.10%), Query Frame = 1
Query:  352 SVIVMFYAPWCGHCKATKPKFTSAANQM-AENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAF----MTNPANPQL-DARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGER 963
            +V V F+APWCGHCK  +P +   A  M  +N KV    VDCT      +C +  +TG+P  R F  G+  S  ++   R+      F    ++ PA   L + +R          +V L ++ F +++   T    V F++PWC HC  + P++ + A +L    P+  I+ +D T    +   ++V G+PTL++        KY G R
Sbjct:   55 NVFVKFFAPWCGHCKRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQ--GLCATHQVTGYPTLRLFKLGEEES-VKFKGTRDLPAITDFINKELSAPAEADLGEVKREQVENLNIGKVVDLTEDTFAKHV--STGNHFVKFFAPWCSHCQRLAPTWEDLAKEL-IKEPTVTISKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGAR 258          

HSP 3 Score: 65.0846 bits (157), Expect = 7.244e-11
Identity = 34/89 (38.20%), Postives = 50/89 (56.18%), Query Frame = 1
Query:  742 LVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFS-PNGDWVKYMGERTDDAITEFMIKKHS 1005
             V F++PWCGHC  ++P +   A  +    P  +IA VD T    L A ++V+G+PTL  F     + VK+ G R   AIT+F+ K+ S
Sbjct:   57 FVKFFAPWCGHCKRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELS 145          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Fly
Match: prtp (gene:FBgn0030329 transcript:FBtr0303335)

HSP 1 Score: 117.087 bits (292), Expect = 6.123e-28
Identity = 90/362 (24.86%), Postives = 149/362 (41.16%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKP---QFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNK-VFKYEGDNSKEALIKFVHNPTQPPPQKDVP--WSEETNEIDF-----LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILE------------------KNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATT--ETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIK 996
            F+APWCG+CK+++P   Q A        K I   +  D +    L     +TGYP++ L + G +   K++G     A+  F++     P + D+     E+   ++      LT+  F +++       V F+APWC HC+   P +   A ++ +   V    +DCT   F  IC    + G+P   +   GK      YS  R+      ++       L+         G E +VI E                  ++ F Q I      A + FY+PWCGHC  ++P++   A +      S  IA VD T      +    +V G+PTL  +       +Y G R+   +  ++ K
Sbjct:   60 FFAPWCGHCKRIQPLWEQLAEIMNVDNPKVIIAKV--DCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPAEADLGEVKREQVENLNIGKVVDLTEDTFAKHVSTGNH-FVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCT--QFRSICQDFEVKGYPTLLWIEDGKKIEK--YSGARDLSTLKTYVEKMVGVPLEKTAG---EAGDEKVVIEEVAGEEDAAKKLTPQQLTGEDEFDQAIAEGV--AFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSLPELQAYLKK 409          

HSP 2 Score: 102.064 bits (253), Expect = 6.191e-23
Identity = 62/210 (29.52%), Postives = 101/210 (48.10%), Query Frame = 1
Query:  352 SVIVMFYAPWCGHCKATKPKFTSAANQM-AENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAF----MTNPANPQL-DARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGER 963
            +V V F+APWCGHCK  +P +   A  M  +N KV    VDCT      +C +  +TG+P  R F  G+  S  ++   R+      F    ++ PA   L + +R          +V L ++ F +++   T    V F++PWC HC  + P++ + A +L    P+  I+ +D T    +   ++V G+PTL++        KY G R
Sbjct:   55 NVFVKFFAPWCGHCKRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQ--GLCATHQVTGYPTLRLFKLGEEES-VKFKGTRDLPAITDFINKELSAPAEADLGEVKREQVENLNIGKVVDLTEDTFAKHV--STGNHFVKFFAPWCSHCQRLAPTWEDLAKEL-IKEPTVTISKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGAR 258          

HSP 3 Score: 65.0846 bits (157), Expect = 7.244e-11
Identity = 34/89 (38.20%), Postives = 50/89 (56.18%), Query Frame = 1
Query:  742 LVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFS-PNGDWVKYMGERTDDAITEFMIKKHS 1005
             V F++PWCGHC  ++P +   A  +    P  +IA VD T    L A ++V+G+PTL  F     + VK+ G R   AIT+F+ K+ S
Sbjct:   57 FVKFFAPWCGHCKRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELS 145          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Fly
Match: prtp (gene:FBgn0030329 transcript:FBtr0073551)

HSP 1 Score: 117.087 bits (292), Expect = 6.123e-28
Identity = 90/362 (24.86%), Postives = 149/362 (41.16%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKP---QFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNK-VFKYEGDNSKEALIKFVHNPTQPPPQKDVP--WSEETNEIDF-----LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILE------------------KNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATT--ETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIK 996
            F+APWCG+CK+++P   Q A        K I   +  D +    L     +TGYP++ L + G +   K++G     A+  F++     P + D+     E+   ++      LT+  F +++       V F+APWC HC+   P +   A ++ +   V    +DCT   F  IC    + G+P   +   GK      YS  R+      ++       L+         G E +VI E                  ++ F Q I      A + FY+PWCGHC  ++P++   A +      S  IA VD T      +    +V G+PTL  +       +Y G R+   +  ++ K
Sbjct:   60 FFAPWCGHCKRIQPLWEQLAEIMNVDNPKVIIAKV--DCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPAEADLGEVKREQVENLNIGKVVDLTEDTFAKHVSTGNH-FVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCT--QFRSICQDFEVKGYPTLLWIEDGKKIEK--YSGARDLSTLKTYVEKMVGVPLEKTAG---EAGDEKVVIEEVAGEEDAAKKLTPQQLTGEDEFDQAIAEGV--AFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSLPELQAYLKK 409          

HSP 2 Score: 102.064 bits (253), Expect = 6.191e-23
Identity = 62/210 (29.52%), Postives = 101/210 (48.10%), Query Frame = 1
Query:  352 SVIVMFYAPWCGHCKATKPKFTSAANQM-AENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAF----MTNPANPQL-DARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGER 963
            +V V F+APWCGHCK  +P +   A  M  +N KV    VDCT      +C +  +TG+P  R F  G+  S  ++   R+      F    ++ PA   L + +R          +V L ++ F +++   T    V F++PWC HC  + P++ + A +L    P+  I+ +D T    +   ++V G+PTL++        KY G R
Sbjct:   55 NVFVKFFAPWCGHCKRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQ--GLCATHQVTGYPTLRLFKLGEEES-VKFKGTRDLPAITDFINKELSAPAEADLGEVKREQVENLNIGKVVDLTEDTFAKHV--STGNHFVKFFAPWCSHCQRLAPTWEDLAKEL-IKEPTVTISKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGAR 258          

HSP 3 Score: 65.0846 bits (157), Expect = 7.244e-11
Identity = 34/89 (38.20%), Postives = 50/89 (56.18%), Query Frame = 1
Query:  742 LVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFS-PNGDWVKYMGERTDDAITEFMIKKHS 1005
             V F++PWCGHC  ++P +   A  +    P  +IA VD T    L A ++V+G+PTL  F     + VK+ G R   AIT+F+ K+ S
Sbjct:   57 FVKFFAPWCGHCKRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELS 145          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Fly
Match: prtp (gene:FBgn0030329 transcript:FBtr0332954)

HSP 1 Score: 105.145 bits (261), Expect = 2.521e-24
Identity = 86/357 (24.09%), Postives = 144/357 (40.34%), Query Frame = 1
Query:   19 CGYCKQMKP---QFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNK-VFKYEGDNSKEALIKFVHNPTQPPPQKDVP--WSEETNEIDF-----LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILE------------------KNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATT--ETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIK 996
            CG+CK+++P   Q A        K I   +  D +    L     +TGYP++ L + G +   K++G     A+  F++     P + D+     E+   ++      LT+  F +++       V F+APWC HC+   P +   A ++ +   V    +DCT   F  IC    + G+P   +   GK      YS  R+      ++       L+         G E +VI E                  ++ F Q I      A + FY+PWCGHC  ++P++   A +      S  IA VD T      +    +V G+PTL  +       +Y G R+   +  ++ K
Sbjct:    2 CGHCKRIQPLWEQLAEIMNVDNPKVIIAKV--DCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPAEADLGEVKREQVENLNIGKVVDLTEDTFAKHVSTGNH-FVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCT--QFRSICQDFEVKGYPTLLWIEDGKKIEK--YSGARDLSTLKTYVEKMVGVPLEKTAG---EAGDEKVVIEEVAGEEDAAKKLTPQQLTGEDEFDQAIAEGV--AFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSLPELQAYLKK 346          

HSP 2 Score: 90.5077 bits (223), Expect = 2.529e-19
Identity = 57/221 (25.79%), Postives = 91/221 (41.18%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQK--------DVPWSEETNEIDF--------LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENK-KVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFM 615
            F+APWC +C+++ P +   A  L  +        D +    + Q F + GYP++  I+DG K+ KY G      L  +V      P +K         V   E   E D         LT  + ++         + FYAPWCGHC+  +P +   A +  + +  V    VDCT      +C  + + G+P    F Y      +EY   R   +  A++
Sbjct:  126 FFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGARDLSTLKTYVEKMVGVPLEKTAGEAGDEKVVIEEVAGEEDAAKKLTPQQLTGEDEFDQAIAEGVAFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDCTAPENKQVCIDQQVEGYPTL--FLYKNGQRQNEYEGSRSLPELQAYL 344          

HSP 3 Score: 52.7582 bits (125), Expect = 4.977e-7
Identity = 30/81 (37.04%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  766 CGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFS-PNGDWVKYMGERTDDAITEFMIKKHS 1005
            CGHC  ++P +   A  +    P  +IA VD T    L A ++V+G+PTL  F     + VK+ G R   AIT+F+ K+ S
Sbjct:    2 CGHCKRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELS 82          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Zebrafish
Match: pdia5 (protein disulfide isomerase family A, member 5 [Source:ZFIN;Acc:ZDB-GENE-030521-5])

HSP 1 Score: 201.445 bits (511), Expect = 3.728e-57
Identity = 125/339 (36.87%), Postives = 179/339 (52.80%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYE--GDNSKEALIKFVHNPTQPPPQK-DVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSE--GITGFPIFRYFNYGKNTSNSEYSLE--REEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATT-ETH-LAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFYAPWCG CK+M+P F  AAT  KGK +  G+N   +  D +KQ F++ GYP+    + G  +  YE  G  SK+ +  ++ NP  P P+  +VPWSE  + +  LTD +F  +L++H S ++MFYAPWCGHCK  KP++  AA  +  NK     GV    ++     T E   I+GFP  +YF  G+     +Y+L   R +D  + ++ NP  P     + W  +P   ++  L   +F +++      ALVMFY+PWC HC    P F  AA   +        AAVD T  + H L  Q  V G+PT  Y++      KY GER +   T FM
Sbjct:  184 MFYAPWCGVCKRMQPIFQQAATETKGKYVLAGMNVHPAEFDGVKQEFSVKGYPTFCYFEKGKFLHHYENYGATSKD-ITDWLKNPQPPQPKTPEVPWSESGSAVFHLTDDSFDSFLEEHPSALIMFYAPWCGHCKKMKPEYDDAAETL--NKDPNSPGVLAAVDTTIHKSTGERFKISGFPTVKYFEKGEE----KYTLPHLRSKDKIIEWLKNPQAPP-PPEKSWDEMPS--SVSHLGAEDFRESL-KKKKHALVMFYAPWCPHCKNAVPHFTTAAEMFKEDR-KIAYAAVDCTKGQNHELCKQEGVEGYPTFNYYNYGKFSEKYNGERGEAGFTGFM 510          

HSP 2 Score: 169.088 bits (427), Expect = 2.642e-45
Identity = 82/209 (39.23%), Postives = 120/209 (57.42%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTT--DDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTN 621
            MFYAPWCG+CK+MKP++  AA TL       G+   + TT      + F I+G+P+V   + G + +      SK+ +I+++ NP  PPP +   W E  + +  L   +F E L + +  +VMFYAPWC HCK   P FT+AA    E++K+A+  VDCT     ++C  EG+ G+P F Y+NYGK +   +Y+ ER E  F  FM N
Sbjct:  307 MFYAPWCGHCKKMKPEYDDAAETLNKDPNSPGVLAAVDTTIHKSTGERFKISGFPTVKYFEKGEEKYTLPHLRSKDKIIEWLKNPQAPPPPEKS-WDEMPSSVSHLGAEDFRESLKKKKHALVMFYAPWCPHCKNAVPHFTTAAEMFKEDRKIAYAAVDCTKGQNHELCKQEGVEGYPTFNYYNYGKFS--EKYNGERGEAGFTGFMRN 512          

HSP 3 Score: 124.79 bits (312), Expect = 7.518e-30
Identity = 83/277 (29.96%), Postives = 136/277 (49.10%), Query Frame = 1
Query:  175 QDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHES-VIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHE---AIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPS-CLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            +DG    +Y    + ++++ F+ +P   P  ++ P +++   I+  ++ +F + L + E  +++MFYAPWCG CK  +P F  AA +     K    G++     F  +     + G+P F YF  GK   + E +      D   ++ NP  PQ         +P  E   A+  L  ++F   +  H S AL+MFY+PWCGHC  MKP + +AA  L     S  ++AAVD T       ++K+SGFPT+ YF    +       R+ D I E++
Sbjct:  122 KDGTFHTEYNRPATIKSMVAFLKDPAGAPLWEENPEAKDVVHIE--SEKDFRKLLKREERPILMMFYAPWCGVCKRMQPIFQQAATET--KGKYVLAGMNVHPAEFDGVKQEFSVKGYPTFCYFEKGKFLHHYE-NYGATSKDITDWLKNPQPPQPKT----PEVPWSESGSAVFHLTDDSFDSFLEEHPS-ALIMFYAPWCGHCKKMKPEYDDAAETLNKDPNSPGVLAAVDTTIHKSTGERFKISGFPTVKYFEKGEEKYTLPHLRSKDKIIEWL 388          

HSP 4 Score: 57.3806 bits (137), Expect = 2.960e-8
Identity = 42/162 (25.93%), Postives = 71/162 (43.83%), Query Frame = 1
Query:  466 VDCTDESFADICT------SEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILE-KNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTET--HLAAQYKVSGFPTLVYF 924
            V+C D     +C       S    G  +  Y +    T ++EY+        VAF+ +PA   L     W   P  + +V +E + +F + +       L+MFY+PWCG C  M+P F  AA + +      ++A ++        +  ++ V G+PT  YF
Sbjct:   91 VNCGDSEGRKLCKKVKVDPSSKTKGVELLHYKD---GTFHTEYNRPATIKSMVAFLKDPAGAPL-----WEENPEAKDVVHIESEKDFRKLLKREERPILMMFYAPWCGVCKRMQPIFQQAATETKG---KYVLAGMNVHPAEFDGVKQEFSVKGYPTFCYF 241          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Zebrafish
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 140.584 bits (353), Expect = 6.929e-35
Identity = 86/261 (32.95%), Postives = 131/261 (50.19%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKK-VAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQEEKKKAD 1065
            +E N +  LTDANF  +++  ++V+V FYAPWCGHCK   P++   A  + EN   +    VD T  S   + +   ++G+P  +    G+     +Y  +R E   V  +   A P       W+  P  EA ++L K+NF  ++V++    LV FY+PWCGHC  + P +  AA +L    P   +A VDAT E+ LA ++ VSG+PTL  F   G    Y G R    I ++M  +     +  +  K  QE  +  D
Sbjct:   56 KEENGVLVLTDANFDTFIEGKDTVLVEFYAPWCGHCKQFAPEYEKIAQTLKENDPPIPVAKVDATKAS--GLGSRFEVSGYPTIKILKKGEPL---DYDGDRSEHAIVERVKEVAQPD------WK--PPPEATLVLTKDNF-DDVVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPIPLAKVDATAESDLATRFGVSGYPTLKIFR-KGKAFDYNGPREKFGIVDYMSDQAGPPSKQVQTLKQVQELLRDGD 301          

HSP 2 Score: 126.331 bits (316), Expect = 3.755e-30
Identity = 70/212 (33.02%), Postives = 111/212 (52.36%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMA-ENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP 633
            FYAPWCG+CKQ  P++   A TLK     I +   D +    L   F ++GYP++ +++ G  +  Y+GD S+ A+++ V    QP       W         LT  NF + ++  + ++V FYAPWCGHCK   P++  AA +++     +    VD T ES  D+ T  G++G+P  + F  GK     +Y+  RE+   V +M++ A P
Sbjct:   83 FYAPWCGHCKQFAPEYEKIAQTLKENDPPIPVAKVDATKASGLGSRFEVSGYPTIKILKKGEPL-DYDGDRSEHAIVERVKEVAQPD------WKPPPEATLVLTKDNFDDVVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPIPLAKVDATAES--DLATRFGVSGYPTLKIFRKGKAF---DYNGPREKFGIVDYMSDQAGP 282          

HSP 3 Score: 68.1662 bits (165), Expect = 1.807e-11
Identity = 46/169 (27.22%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  562 SNSEYSLEREEDD-------FVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDW---VKYMGERTDDAITEF--MIKKHSDIIRHEEAE 1032
               +Y++E EE D        +AF      P + ++   +   G   +V+     F + ++      L+ FY+PWCGHC  ++P +++   K +    + +IA +DAT        YKV GFPT +YF+P+ +    +K+ G + D  + EF   ++KH+  + H++ E
Sbjct:  479 GGKKYAMEPEEFDSDVLRSFVMAFKKGKLKPIVKSQPLPKNNKGPVKVVV--GKTFDEIVMDSKKDVLIEFYAPWCGHCKKLEPDYISLGKKYKN-EKNLVIAKMDATANDVPHDSYKVEGFPT-IYFAPSNNKQNPIKFEGGKRD--VEEFSKFVEKHATKLSHKKDE 641          

HSP 4 Score: 64.6994 bits (156), Expect = 1.797e-10
Identity = 29/90 (32.22%), Postives = 51/90 (56.67%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQK 270
            FYAPWCG+CK++ P++  AA  L  ++  I +   D +   DL   F ++GYP++ + + G K F Y G   K  ++ ++ +   PP ++
Sbjct:  198 FYAPWCGHCKRLAPEYEKAAKELSNRTPPIPLAKVDATAESDLATRFGVSGYPTLKIFRKG-KAFDYNGPREKFGIVDYMSDQAGPPSKQ 286          

HSP 5 Score: 50.8322 bits (120), Expect = 3.736e-6
Identity = 24/84 (28.57%), Postives = 41/84 (48.81%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKV--FKYEGDNSK-EALIKFVHN 246
            FYAPWCG+CK+++P + +     K +   +    D +  D    ++ + G+P+++     NK    K+EG     E   KFV  
Sbjct:  547 FYAPWCGHCKKLEPDYISLGKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTIYFAPSNNKQNPIKFEGGKRDVEEFSKFVEK 630          

HSP 6 Score: 50.447 bits (119), Expect = 6.053e-6
Identity = 25/77 (32.47%), Postives = 35/77 (45.45%), Query Frame = 1
Query:  337 LDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSN 567
            +D  + V++ FYAPWCGHCK  +P + S   +    K +    +D T         S  + GFP   YF    N  N
Sbjct:  537 MDSKKDVLIEFYAPWCGHCKKLEPDYISLGKKYKNEKNLVIAKMDATANDVPH--DSYKVEGFPTI-YFAPSNNKQN 610          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Zebrafish
Match: txndc5 (thioredoxin domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1951])

HSP 1 Score: 132.494 bits (332), Expect = 3.480e-33
Identity = 93/359 (25.91%), Postives = 158/359 (44.01%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQA---FNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFV------HNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPAN-------PQLDARRHWRRIP-------GHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
            MF+APWCG+C++++  +   A               +  T D K       I GYP++ L +   +  KY+G    +AL  ++               +     E    +  LT  NF  ++ +  S  V F+APWCGHCKA  P +   A+    +  +    VDCT     ++C+   + G+P   +F  G+     +Y  +R+ D F  F+ N          P+ +   H   IP           +++L ++NF + +    S   + FY+PWCGHC  + P++ + + K    L    IA VD T E  L  ++ V G+PTL+ F       ++ G R  +++  F++K+  D
Sbjct:   51 MFFAPWCGHCQRLQGTWNELADKYNSMEAPPAYVVKVDCTKDTKFCSIEHGIRGYPTLKLFKPEQEAVKYQGPRDLQALENWMLKTLQEEPEEPQSEPEPPKVPEPKQGLYELTATNFKSHIAK-GSHFVKFFAPWCGHCKAMAPTWEQLASSFEHSDSIKISKVDCTQH--YEVCSDNQVRGYPTLLFFTDGEKID--QYKGKRDLDSFKEFVDNHVKAAESKDEPEKE-EEHTHEIPPSAEPEKQESNVLVLTESNFDETVAKGLS--FIKFYAPWCGHCKNLAPTWDDLSQKEFPGLTDVKIAKVDCTVERTLCNRFSVRGYPTLLMFRAGQQGEEHNGGRDLESLHSFIMKQARD 401          

HSP 2 Score: 88.9669 bits (219), Expect = 1.706e-18
Identity = 59/216 (27.31%), Postives = 96/216 (44.44%), Query Frame = 1
Query:  358 IVMFYAPWCGHCKATKPKFTSAANQM--AENKKVAFIGVDCT-DESFADICTSEGITGFPIFRYFNYGKNTSNSE--YSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
             VMF+APWCGHC+  +  +   A++    E      + VDCT D  F  I    GI G+P  + F   +     +    L+  E+  +  +              +     + +  L   NF  +I        V F++PWCGHC AM P++   A+  +    S  I+ VD T    + +  +V G+PTL++F+      +Y G+R  D+  EF+
Sbjct:   49 FVMFFAPWCGHCQRLQGTWNELADKYNSMEAPPAYVVKVDCTKDTKFCSI--EHGIRGYPTLKLFKPEQEAVKYQGPRDLQALENWMLKTLQEEPEEPQSEPEPPKVPEPKQGLYELTATNFKSHIAK--GSHFVKFFAPWCGHCKAMAPTWEQLASSFEHS-DSIKISKVDCTQHYEVCSDNQVRGYPTLLFFTDGEKIDQYKGKRDLDSFKEFV 259          

HSP 3 Score: 66.6254 bits (161), Expect = 2.643e-11
Identity = 31/91 (34.07%), Postives = 52/91 (57.14%), Query Frame = 1
Query:  730 TSGALVMFYSPWCGHCIAMKPSFVNAANKLQTL-LPSCLIAAVDATTETHLAA-QYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIK 996
            T+   VMF++PWCGHC  ++ ++   A+K  ++  P   +  VD T +T   + ++ + G+PTL  F P  + VKY G R   A+  +M+K
Sbjct:   45 TAPHFVMFFAPWCGHCQRLQGTWNELADKYNSMEAPPAYVVKVDCTKDTKFCSIEHGIRGYPTLKLFKPEQEAVKYQGPRDLQALENWMLK 135          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Zebrafish
Match: pdia6 (protein disulfide isomerase family A, member 6 [Source:ZFIN;Acc:ZDB-GENE-030131-879])

HSP 1 Score: 109.383 bits (272), Expect = 3.907e-25
Identity = 75/266 (28.20%), Postives = 122/266 (45.86%), Query Frame = 1
Query:  292 TNEIDFLTDANFYEYLDQHESV-IVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDAR-------RHWRRIPGHEA-----IVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCL-IAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQE 1047
            ++++  L  +NF   + Q +S+ +V FYAPWCGHCK+  P++  AA  +    KV  +  D        +    G+ GFP  + F  G      +Y   R     V    N     +  R         + R  G  A     +V L  +NF + ++      LV F++PWCGHC  ++P +  AA +++      + +AAVDAT    LA+++ + GFPT+  F    +   Y G RT   I    ++ +SD I   E +++  E
Sbjct:   24 SDDVVELNPSNFNREVIQSDSLWLVEFYAPWCGHCKSLAPEWKKAATALKGIVKVGAVDAD----QHNSLGGQYGVRGFPTIKIFG-GNKHKPEDYQGGRTNQAIVDAALNALRSLVKDRLGGKTGGSDYSRQSGGGAGNKKDVVELTDDNFDRTVLESDDVWLVEFFAPWCGHCKNLEPEWTAAATEVKEQTKGKVKLAAVDATVHQGLASRFGIRGFPTIKVFRKGEEPEDYQGGRTRSDIVARALELYSDNIPAPELQEVLNE 284          

HSP 2 Score: 98.2117 bits (243), Expect = 2.159e-21
Identity = 67/223 (30.04%), Postives = 106/223 (47.53%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNK--VFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDF----------------LTDANFYEYLDQHESV-IVMFYAPWCGHCKATKPKFTSAANQMAEN--KKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVA 609
            FYAPWCG+CK + P++  AAT LKG      ++ D    + L   + + G+P++ +   GNK     Y+G  + +A++    N  +   +  +    +T   D+                LTD NF   + + + V +V F+APWCGHCK  +P++T+AA ++ E    KV    VD T      + +  GI GFP  + F  G+   +  Y   R   D VA
Sbjct:   50 FYAPWCGHCKSLAPEWKKAATALKGIVKVGAVDAD--QHNSLGGQYGVRGFPTIKIF-GGNKHKPEDYQGGRTNQAIVDAALNALRSLVKDRL--GGKTGGSDYSRQSGGGAGNKKDVVELTDDNFDRTVLESDDVWLVEFFAPWCGHCKNLEPEWTAAATEVKEQTKGKVKLAAVDAT--VHQGLASRFGIRGFPTIKVFRKGEEPED--YQGGRTRSDIVA 263          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Zebrafish
Match: dnajc10 (DnaJ (Hsp40) homolog, subfamily C, member 10 [Source:ZFIN;Acc:ZDB-GENE-070327-1])

HSP 1 Score: 99.7525 bits (247), Expect = 2.068e-21
Identity = 80/357 (22.41%), Postives = 145/357 (40.62%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQH---ESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQEEKKKAD 1065
            F+APWC  C+ + P+   A+  L G+  F  +  D +  + L   +NI  YP+  +I + + + +YEG +S + +++F+ +   P              +  L   +F E + +    E+ +V FYAPWCG C+A  P++   A  ++    V    VDC  +     C SE +  +P  R F    N  +   +      D  +             + W       A V L   +F + ++      ++ FY+PWCG C    P F   A  ++  + +     VD            +  +PT+ ++   G   +  G    ++    +I   +DI+R    +   Q + K  D
Sbjct:  471 FFAPWCPPCRALLPELRKASIQLFGQLKFGTL--DCTIHEGLCNTYNIHAYPTT-VIFNKSSIHEYEGHHSADGILEFIEDLVNPV-------------VVTLGPESFQELVKRRKSSETWMVDFYAPWCGPCQALLPEWRRMARMLSGIVNVG--TVDC--QKHHSFCQSESVRAYPEIRLFPQNSNRRDQYQTYNGWHRDAFSL------------KAWALSSLPRASVDLSPEDFKRKVLGGKDHWVLDFYAPWCGPCQQFAPEFEVLARMMKGTVRA---GKVDCQAHYQTCQSAGIKAYPTVRFYPTLGTTRRDQGGEHINSRDATVI---ADILRQRLQQLALQGKSKLKD 789          

HSP 2 Score: 68.1662 bits (165), Expect = 1.650e-11
Identity = 50/201 (24.88%), Postives = 81/201 (40.30%), Query Frame = 1
Query:  343 QHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGA--LVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGD 939
            + E  +V F+APWC  C+A  P+   A+ Q+    ++ F  +DCT      +C +  I  +P    FN    +S  EY      D  + F+ +  NP                +V L   +F + +    S    +V FY+PWCG C A+ P +   A  L  ++    +  VD            V  +P +  F  N +
Sbjct:  463 EKEPWLVDFFAPWCPPCRALLPELRKASIQLF--GQLKFGTLDCTIHE--GLCNTYNIHAYPTTVIFN---KSSIHEYEGHHSADGILEFIEDLVNP---------------VVVTLGPESFQELVKRRKSSETWMVDFYAPWCGPCQALLPEWRRMARMLSGIVN---VGTVDCQKHHSFCQSESVRAYPEIRLFPQNSN 638          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Xenopus
Match: txndc5 (thioredoxin domain containing 5 [Source:NCBI gene;Acc:394794])

HSP 1 Score: 142.51 bits (358), Expect = 1.557e-36
Identity = 92/363 (25.34%), Postives = 165/363 (45.45%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQA--FNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFV-----HNPTQPPPQKDVPWSEETNEIDF----LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREED---DFVAFMTNPAN-------------PQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
            MF+APWCG+C++++P +          S        +  T D+       + GYP++ L + G +  KY+G    ++L  ++       P +P  ++ V    +  E+      LT ANF E++ +    I  F+APWCGHCKA  P +   A    ++  +    VDCT  +   +C+   + G+P   +F  G+     +Y  +R+ D   ++      PA              PQ++     + +     ++ L ++NF Q + +  S   + FY+PWCGHC  + P + + + K  + +    IA VD T E  L  ++ V G+PTL+ F       ++ G R  + +  F+++   D
Sbjct:   53 MFFAPWCGHCQRLQPTWNELGDKYNRMSKTPAYIAKVDCTTDMPTCTEHGVRGYPTLKLFRPGQEAVKYQGPRDLQSLENWMLQTLNDEPEKPKVEEKVEEPAKVPELKQGLYELTAANFKEHIAEGNHFI-KFFAPWCGHCKALAPAWEQLAATFQDSNSIKIAKVDCTQHN--GLCSDNQVRGYPTLLWFRNGEKVD--QYKGKRDLDSLKEYAESQLKPAEEKKEEEQKEDATPPQVE-----KPVAVESKVLSLSESNFDQTVATGVS--FIKFYAPWCGHCKNLVPIWEDLSKKEFSGMSDVKIAKVDCTAERALCNRFSVRGYPTLLLFRAGEKIGEHEGARDLETLQNFVLRHSRD 403          

HSP 2 Score: 108.227 bits (269), Expect = 8.391e-25
Identity = 73/250 (29.20%), Postives = 122/250 (48.80%), Query Frame = 1
Query:  277 PWSEETNEIDF---LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKV-AFIG-VDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTN-----PANPQLDAR-RHWRRIPG-HEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWV-KYMGERTDDAITEF 987
            PW E  +E      L  A+ +++  + E   +MF+APWCGHC+  +P +    ++     K  A+I  VDCT +     CT  G+ G+P  + F  G+     +Y   R+      +M       P  P+++ +     ++P   + +  L   NF ++I        + F++PWCGHC A+ P++   A   Q    S  IA VD T    L +  +V G+PTL++F  NG+ V +Y G+R  D++ E+
Sbjct:   21 PWEEGADEDPHKKNLYTADMFDHAIKQEPHFIMFFAPWCGHCQRLQPTWNELGDKYNRMSKTPAYIAKVDCTTD--MPTCTEHGVRGYPTLKLFRPGQEA--VKYQGPRDLQSLENWMLQTLNDEPEKPKVEEKVEEPAKVPELKQGLYELTAANFKEHIAE--GNHFIKFFAPWCGHCKALAPAWEQLAATFQD-SNSIKIAKVDCTQHNGLCSDNQVRGYPTLLWFR-NGEKVDQYKGKRDLDSLKEY 262          

HSP 3 Score: 69.707 bits (169), Expect = 4.745e-12
Identity = 36/125 (28.80%), Postives = 64/125 (51.20%), Query Frame = 1
Query:  694 EKNNFVQNIVSHT---SGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPS-CLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQEEKK 1056
            +KN +  ++  H        +MF++PWCGHC  ++P++    +K   +  +   IA VD TT+     ++ V G+PTL  F P  + VKY G R   ++  +M++  +D     + E+  +E  K
Sbjct:   32 KKNLYTADMFDHAIKQEPHFIMFFAPWCGHCQRLQPTWNELGDKYNRMSKTPAYIAKVDCTTDMPTCTEHGVRGYPTLKLFRPGQEAVKYQGPRDLQSLENWMLQTLNDEPEKPKVEEKVEEPAK 156          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Xenopus
Match: chst13 (carbohydrate (chondroitin 4) sulfotransferase 13 [Source:Xenbase;Acc:XB-GENE-945720])

HSP 1 Score: 136.732 bits (343), Expect = 1.871e-33
Identity = 81/255 (31.76%), Postives = 127/255 (49.80%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKK-VAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQE 1047
            ++ N +  LTD NF  ++   + V++ FYAPWCGHCK   P++   A+ + +N   +    +D T+ +  D+     I+G+P  +    G+     +Y   R ++  V  +   A P       W+  P  EA ++L K+NF   +VS     LV FY+PWCGHC  + P +  AA +L    P   +A VDAT E+ L ++Y V+GFPTL  F   G    Y G R    I ++M ++     +  +A K   E
Sbjct:   25 KDENGVLVLTDKNFDTFITDKDIVLLEFYAPWCGHCKQFVPEYEKIASALNQNDPPIPVAKIDATEAT--DVAGRYDISGYPTIKILKKGQPI---DYDGARTQEAIVTKVKEIAQPD------WK--PPPEATIVLTKDNF-DEVVSDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKYGVTGFPTLKIFR-KGKVFDYNGPREKYGIVDYMTEQAGPPSKQIQAVKQVHE 264          

HSP 2 Score: 121.324 bits (303), Expect = 2.507e-28
Identity = 69/212 (32.55%), Postives = 109/212 (51.42%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENK-KVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP 633
            FYAPWCG+CKQ  P++   A+ L      I +   D +   D+   ++I+GYP++ +++ G  +  Y+G  ++EA++  V    QP       W         LT  NF E +   + ++V FYAPWCGHCK   P++  AA ++++    +    VD T ES   + +  G+TGFP  + F  GK     +Y+  RE+   V +MT  A P
Sbjct:   52 FYAPWCGHCKQFVPEYEKIASALNQNDPPIPVAKIDATEATDVAGRYDISGYPTIKILKKGQPI-DYDGARTQEAIVTKVKEIAQPD------WKPPPEATIVLTKDNFDEVVSDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVES--SLGSKYGVTGFPTLKIFRKGKVF---DYNGPREKYGIVDYMTEQAGP 251          

HSP 3 Score: 66.6254 bits (161), Expect = 6.673e-11
Identity = 46/161 (28.57%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  556 NTSNSEYSLEREEDD-------FVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDW---VKYMGERTD-DAITEFMIKKHS 1005
            + S  +Y+ E EE D        +AF      P + ++   +   G   +V+     F Q ++   S  L+ FY+PWCGHC +++P + +   K ++     +IA +DAT     + +YK  GFPT +YF+P  +    +K+ G   D +++++F I++HS
Sbjct:  446 DASGKKYAKEPEEFDSDGLREFVMAFKKGKLTPIIKSQPVPKNNKGPVKVVV--GKTFDQIVMDPKSDVLIEFYAPWCGHCKSLEPIYNDLGKKYRS-AEGLIIAKMDATANDITSDKYKAEGFPT-IYFAPRNNKQNPIKFSGGNRDLESLSKF-IEEHS 601          

HSP 4 Score: 63.1586 bits (152), Expect = 8.696e-10
Identity = 29/90 (32.22%), Postives = 50/90 (55.56%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQK 270
            FYAPWCG+CK++ P++  AA  L  +S  I +   D +    L   + +TG+P++ + + G KVF Y G   K  ++ ++     PP ++
Sbjct:  167 FYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKYGVTGFPTLKIFRKG-KVFDYNGPREKYGIVDYMTEQAGPPSKQ 255          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Xenopus
Match: chst13 (carbohydrate (chondroitin 4) sulfotransferase 13 [Source:Xenbase;Acc:XB-GENE-945720])

HSP 1 Score: 136.732 bits (343), Expect = 2.129e-33
Identity = 81/255 (31.76%), Postives = 127/255 (49.80%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKK-VAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQE 1047
            ++ N +  LTD NF  ++   + V++ FYAPWCGHCK   P++   A+ + +N   +    +D T+ +  D+     I+G+P  +    G+     +Y   R ++  V  +   A P       W+  P  EA ++L K+NF   +VS     LV FY+PWCGHC  + P +  AA +L    P   +A VDAT E+ L ++Y V+GFPTL  F   G    Y G R    I ++M ++     +  +A K   E
Sbjct:   44 KDENGVLVLTDKNFDTFITDKDIVLLEFYAPWCGHCKQFVPEYEKIASALNQNDPPIPVAKIDATEAT--DVAGRYDISGYPTIKILKKGQPI---DYDGARTQEAIVTKVKEIAQPD------WK--PPPEATIVLTKDNF-DEVVSDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKYGVTGFPTLKIFR-KGKVFDYNGPREKYGIVDYMTEQAGPPSKQIQAVKQVHE 283          

HSP 2 Score: 121.324 bits (303), Expect = 2.432e-28
Identity = 69/212 (32.55%), Postives = 109/212 (51.42%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENK-KVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP 633
            FYAPWCG+CKQ  P++   A+ L      I +   D +   D+   ++I+GYP++ +++ G  +  Y+G  ++EA++  V    QP       W         LT  NF E +   + ++V FYAPWCGHCK   P++  AA ++++    +    VD T ES   + +  G+TGFP  + F  GK     +Y+  RE+   V +MT  A P
Sbjct:   71 FYAPWCGHCKQFVPEYEKIASALNQNDPPIPVAKIDATEATDVAGRYDISGYPTIKILKKGQPI-DYDGARTQEAIVTKVKEIAQP------DWKPPPEATIVLTKDNFDEVVSDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVES--SLGSKYGVTGFPTLKIFRKGKVF---DYNGPREKYGIVDYMTEQAGP 270          

HSP 3 Score: 66.6254 bits (161), Expect = 5.990e-11
Identity = 46/161 (28.57%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  556 NTSNSEYSLEREEDD-------FVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDW---VKYMGERTD-DAITEFMIKKHS 1005
            + S  +Y+ E EE D        +AF      P + ++   +   G   +V+     F Q ++   S  L+ FY+PWCGHC +++P + +   K ++     +IA +DAT     + +YK  GFPT +YF+P  +    +K+ G   D +++++F I++HS
Sbjct:  465 DASGKKYAKEPEEFDSDGLREFVMAFKKGKLTPIIKSQPVPKNNKGPVKVVV--GKTFDQIVMDPKSDVLIEFYAPWCGHCKSLEPIYNDLGKKYRS-AEGLIIAKMDATANDITSDKYKAEGFPT-IYFAPRNNKQNPIKFSGGNRDLESLSKF-IEEHS 620          

HSP 4 Score: 63.1586 bits (152), Expect = 7.996e-10
Identity = 29/90 (32.22%), Postives = 50/90 (55.56%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQK 270
            FYAPWCG+CK++ P++  AA  L  +S  I +   D +    L   + +TG+P++ + + G KVF Y G   K  ++ ++     PP ++
Sbjct:  186 FYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKYGVTGFPTLKIFRKG-KVFDYNGPREKYGIVDYMTEQAGPPSKQ 274          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Xenopus
Match: chst13 (carbohydrate (chondroitin 4) sulfotransferase 13 [Source:Xenbase;Acc:XB-GENE-945720])

HSP 1 Score: 136.346 bits (342), Expect = 2.287e-33
Identity = 81/255 (31.76%), Postives = 127/255 (49.80%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKK-VAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQE 1047
            ++ N +  LTD NF  ++   + V++ FYAPWCGHCK   P++   A+ + +N   +    +D T+ +  D+     I+G+P  +    G+     +Y   R ++  V  +   A P       W+  P  EA ++L K+NF   +VS     LV FY+PWCGHC  + P +  AA +L    P   +A VDAT E+ L ++Y V+GFPTL  F   G    Y G R    I ++M ++     +  +A K   E
Sbjct:   27 KDENGVLVLTDKNFDTFITDKDIVLLEFYAPWCGHCKQFVPEYEKIASALNQNDPPIPVAKIDATEAT--DVAGRYDISGYPTIKILKKGQPI---DYDGARTQEAIVTKVKEIAQPD------WK--PPPEATIVLTKDNF-DEVVSDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKYGVTGFPTLKIFR-KGKVFDYNGPREKYGIVDYMTEQAGPPSKQIQAVKQVHE 266          

HSP 2 Score: 121.324 bits (303), Expect = 2.625e-28
Identity = 69/212 (32.55%), Postives = 109/212 (51.42%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENK-KVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP 633
            FYAPWCG+CKQ  P++   A+ L      I +   D +   D+   ++I+GYP++ +++ G  +  Y+G  ++EA++  V    QP       W         LT  NF E +   + ++V FYAPWCGHCK   P++  AA ++++    +    VD T ES   + +  G+TGFP  + F  GK     +Y+  RE+   V +MT  A P
Sbjct:   54 FYAPWCGHCKQFVPEYEKIASALNQNDPPIPVAKIDATEATDVAGRYDISGYPTIKILKKGQPI-DYDGARTQEAIVTKVKEIAQP------DWKPPPEATIVLTKDNFDEVVSDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVES--SLGSKYGVTGFPTLKIFRKGKVF---DYNGPREKYGIVDYMTEQAGP 253          

HSP 3 Score: 66.6254 bits (161), Expect = 6.461e-11
Identity = 46/161 (28.57%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  556 NTSNSEYSLEREEDD-------FVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDW---VKYMGERTD-DAITEFMIKKHS 1005
            + S  +Y+ E EE D        +AF      P + ++   +   G   +V+     F Q ++   S  L+ FY+PWCGHC +++P + +   K ++     +IA +DAT     + +YK  GFPT +YF+P  +    +K+ G   D +++++F I++HS
Sbjct:  448 DASGKKYAKEPEEFDSDGLREFVMAFKKGKLTPIIKSQPVPKNNKGPVKVVV--GKTFDQIVMDPKSDVLIEFYAPWCGHCKSLEPIYNDLGKKYRS-AEGLIIAKMDATANDITSDKYKAEGFPT-IYFAPRNNKQNPIKFSGGNRDLESLSKF-IEEHS 603          

HSP 4 Score: 63.1586 bits (152), Expect = 9.260e-10
Identity = 29/90 (32.22%), Postives = 50/90 (55.56%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQK 270
            FYAPWCG+CK++ P++  AA  L  +S  I +   D +    L   + +TG+P++ + + G KVF Y G   K  ++ ++     PP ++
Sbjct:  169 FYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKYGVTGFPTLKIFRKG-KVFDYNGPREKYGIVDYMTEQAGPPSKQ 257          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Xenopus
Match: chst13 (carbohydrate (chondroitin 4) sulfotransferase 13 [Source:Xenbase;Acc:XB-GENE-945720])

HSP 1 Score: 136.346 bits (342), Expect = 2.289e-33
Identity = 81/255 (31.76%), Postives = 127/255 (49.80%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKK-VAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQE 1047
            ++ N +  LTD NF  ++   + V++ FYAPWCGHCK   P++   A+ + +N   +    +D T+ +  D+     I+G+P  +    G+     +Y   R ++  V  +   A P       W+  P  EA ++L K+NF   +VS     LV FY+PWCGHC  + P +  AA +L    P   +A VDAT E+ L ++Y V+GFPTL  F   G    Y G R    I ++M ++     +  +A K   E
Sbjct:   47 KDENGVLVLTDKNFDTFITDKDIVLLEFYAPWCGHCKQFVPEYEKIASALNQNDPPIPVAKIDATEAT--DVAGRYDISGYPTIKILKKGQPI---DYDGARTQEAIVTKVKEIAQPD------WK--PPPEATIVLTKDNF-DEVVSDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKYGVTGFPTLKIFR-KGKVFDYNGPREKYGIVDYMTEQAGPPSKQIQAVKQVHE 286          

HSP 2 Score: 121.324 bits (303), Expect = 2.840e-28
Identity = 69/212 (32.55%), Postives = 109/212 (51.42%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENK-KVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP 633
            FYAPWCG+CKQ  P++   A+ L      I +   D +   D+   ++I+GYP++ +++ G  +  Y+G  ++EA++  V    QP       W         LT  NF E +   + ++V FYAPWCGHCK   P++  AA ++++    +    VD T ES   + +  G+TGFP  + F  GK     +Y+  RE+   V +MT  A P
Sbjct:   74 FYAPWCGHCKQFVPEYEKIASALNQNDPPIPVAKIDATEATDVAGRYDISGYPTIKILKKGQPI-DYDGARTQEAIVTKVKEIAQPD------WKPPPEATIVLTKDNFDEVVSDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVES--SLGSKYGVTGFPTLKIFRKGKVF---DYNGPREKYGIVDYMTEQAGP 273          

HSP 3 Score: 66.6254 bits (161), Expect = 6.895e-11
Identity = 46/161 (28.57%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  556 NTSNSEYSLEREEDD-------FVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDW---VKYMGERTD-DAITEFMIKKHS 1005
            + S  +Y+ E EE D        +AF      P + ++   +   G   +V+     F Q ++   S  L+ FY+PWCGHC +++P + +   K ++     +IA +DAT     + +YK  GFPT +YF+P  +    +K+ G   D +++++F I++HS
Sbjct:  459 DASGKKYAKEPEEFDSDGLREFVMAFKKGKLTPIIKSQPVPKNNKGPVKVVV--GKTFDQIVMDPKSDVLIEFYAPWCGHCKSLEPIYNDLGKKYRS-AEGLIIAKMDATANDITSDKYKAEGFPT-IYFAPRNNKQNPIKFSGGNRDLESLSKF-IEEHS 614          

HSP 4 Score: 63.1586 bits (152), Expect = 8.666e-10
Identity = 29/90 (32.22%), Postives = 50/90 (55.56%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQK 270
            FYAPWCG+CK++ P++  AA  L  +S  I +   D +    L   + +TG+P++ + + G KVF Y G   K  ++ ++     PP ++
Sbjct:  189 FYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKYGVTGFPTLKIFRKG-KVFDYNGPREKYGIVDYMTEQAGPPSKQ 277          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Mouse
Match: Pdia5 (protein disulfide isomerase associated 5 [Source:MGI Symbol;Acc:MGI:1919849])

HSP 1 Score: 184.496 bits (467), Expect = 6.815e-51
Identity = 116/351 (33.05%), Postives = 182/351 (51.85%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEG-DNSKEALIKFVHNPTQPPPQ-KDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQM---AENKKVAFIGVDCT-DESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETH--LAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM-IKKHSDIIRHEE 1026
            MFYAPWC  CK++ P F  AAT ++G  +  G+N   S  +++K+ +N+ GYP++   + G  +F YE   ++ E +++++ NP  P PQ  + PW++E   +  LTD +F +++ +H SV+VMF+APWCGHCK  KP+F SAA  +   AE+  V    VD T +E+ A       I+ FP  +YF   KN         R +  F+ +M NP  P         +     +++ L  +NF ++ +      LVMFY+PWC HC  + P F   A+  +        AAVD   + +  L  Q  V  +PT  Y+       KY  +RT+   T F+   +  D+ R E+
Sbjct:  174 MFYAPWCSMCKRIMPHFQKAATQVRGHIVLAGMNVYPSEFENIKEEYNVRGYPTICYFEKGRFLFPYENYGSTAEDIVEWLKNPLPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFESAAEVLHGDAESSGV-LAAVDATVNEALAG---RFHISAFPTLKYF---KNGEQQAVPALRTKKKFIEWMQNPEAPPPPEPTWEEQ---QTSVLHLVGDNF-RDTLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKEDR-KIACAAVDCVKDKNQDLCQQEAVKAYPTFHYYHYGKLVEKYESDRTELGFTSFIRTLREGDLKRLEK 512          

HSP 2 Score: 137.502 bits (345), Expect = 2.829e-34
Identity = 95/322 (29.50%), Postives = 154/322 (47.83%), Query Frame = 1
Query:   49 FAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPS-----VFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHES-VIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDA-RRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQT-LLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
             +  A  +KG+     ++   + +  L +   +   P      +F  QDG    +Y+   + ++++ F+ +P  PP  ++ P +++   ID  ++ +F   L + E  +++MFYAPWC  CK   P F  AA Q+  +  +   G++     F +I     + G+P   YF  G+     E +     +D V ++ NP  PQ       W    G  ++  L   +F Q +  H+S  LVMF++PWCGHC  MKP F +AA  L      S ++AAVDAT    LA ++ +S FPTL YF  NG+       RT     E+M
Sbjct:   65 LSTVAQAVKGQGTVCWVDCGDAESRKLCKKMKVDLSPKDKKIELFHYQDGAFHMQYDRAVTLKSIVAFLKDPKGPPLWEEDPGAKDVVHID--SEKDFRRLLKREEKPLLMMFYAPWCSMCKRIMPHFQKAATQVRGH--IVLAGMNVYPSEFENIKEEYNVRGYPTICYFEKGRFLFPYE-NYGSTAEDIVEWLKNPLPPQPQVPETPWADEGG--SVYHLTDEDFDQFVKEHSS-VLVMFHAPWCGHCKKMKPEFESAAEVLHGDAESSGVLAAVDATVNEALAGRFHISAFPTLKYFK-NGEQQAVPALRTKKKFIEWM 377          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Mouse
Match: Txndc5 (thioredoxin domain containing 5 [Source:MGI Symbol;Acc:MGI:2145316])

HSP 1 Score: 148.288 bits (373), Expect = 1.154e-38
Identity = 94/352 (26.70%), Postives = 167/352 (47.44%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQF---AAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFV-----HNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREE-DDFVA--FMTNPANPQL----DARRHWRRIPGHEAIVI-LEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
            MF+APWCG+C++++P +        +++   +++    D +   D+  A  + GYP++   + G +  KY+G    E L  ++       P  P P+ + P + E  +  +   AN +E      +  + F+APWCGHCKA  P +   A  +  ++ V    VDCT + +A +C+   + G+P   +F  GK     +   + E   D+V      + A P+     +A        G +  V+ L + +F   I    +   V FY+PWCGHC  + P++   + K    L    IA VD T E ++ ++Y V G+PTL+ F       ++ G R  D++  F++++  D
Sbjct:   69 MFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVA-KVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPATPEPEAEPPRAPELKQGLYELSANNFELHVSQGNHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCT-QHYA-VCSEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKSFEDTIAQGIT--FVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVGEHNGGRDLDSLHSFVLRQAKD 415          

HSP 2 Score: 111.694 bits (278), Expect = 5.643e-26
Identity = 67/243 (27.57%), Postives = 123/243 (50.62%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQM--AENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTN-----PANPQLDARRHWRRIPG-HEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            E+      L  A+ + +  Q  +  VMF+APWCGHC+  +P +    ++    E+ KV    VDCT +S  D+C+++G+ G+P  ++F  G+     +Y   R+ +    +M       PA P+ +A     R P   + +  L  NNF  ++        + F++PWCGHC A+ P++   A  L+    +  I  VD T    + ++++V G+PTL++F       +Y G+R  +++ +++
Sbjct:   43 EQDPHAKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTADS--DVCSAQGVRGYPTLKFFKPGQEA--VKYQGPRDFETLENWMLQTLNEEPATPEPEAEP--PRAPELKQGLYELSANNFELHVSQ--GNHFIKFFAPWCGHCKALAPTWEQLALGLEH-SETVKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYV 276          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Mouse
Match: Txndc5 (thioredoxin domain containing 5 [Source:MGI Symbol;Acc:MGI:2145316])

HSP 1 Score: 134.42 bits (337), Expect = 2.370e-34
Identity = 90/348 (25.86%), Postives = 164/348 (47.13%), Query Frame = 1
Query:   19 CGYCKQMKPQF---AAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFV-----HNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREED---DFVA--FMTNPANPQL----DARRHWRRIPGHEAIVI-LEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
            CG+C++++P +        +++   +++    D +   D+  A  + GYP++   + G +  KY+G    E L  ++       P  P P+ + P + E  +  +   AN +E      +  + F+APWCGHCKA  P +   A  +  ++ V    VDCT + +A +C+   + G+P   +F  GK     +Y  +R+ +   D+V      + A P+     +A        G +  V+ L + +F   I    +   V FY+PWCGHC  + P++   + K    L    IA VD T E ++ ++Y V G+PTL+ F       ++ G R  D++  F++++  D
Sbjct:    2 CGHCQRLQPTWNDLGDKYNSMEDAKVYVA-KVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPATPEPEAEPPRAPELKQGLYELSANNFELHVSQGNHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCT-QHYA-VCSEHQVRGYPTLLWFRDGKKVD--QYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKSFEDTIAQGIT--FVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVGEHNGGRDLDSLHSFVLRQAKD 342          

HSP 2 Score: 92.0485 bits (227), Expect = 1.057e-19
Identity = 64/226 (28.32%), Postives = 106/226 (46.90%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLK-GKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQ---------PPPQKDVPWSEETNE---IDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTS-AANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQL 639
            F+APWCG+CK + P +   A  L+  +++ IG   D +    +     + GYP++   +DG KV +Y+G    E+L  +V +  Q          P +  V  +E T +   +  LT+ +F + + Q     V FYAPWCGHCK   P +   +  +      V    VDCT E   ++C+   + G+P    F  G+     E++  R+ D   +F+   A  +L
Sbjct:  125 FFAPWCGHCKALAPTWEQLALGLEHSETVKIG-KVDCTQHYAVCSEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKSFEDTIAQG-ITFVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAER--NVCSKYSVRGYPTLLLFRGGEKV--GEHNGGRDLDSLHSFVLRQAKDEL 344          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Mouse
Match: Txndc5 (thioredoxin domain containing 5 [Source:MGI Symbol;Acc:MGI:2145316])

HSP 1 Score: 128.257 bits (321), Expect = 2.198e-32
Identity = 85/314 (27.07%), Postives = 145/314 (46.18%), Query Frame = 1
Query:  106 DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFV-----HNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREE-DDFVA--FMTNPANPQL----DARRHWRRIPGHEAIVI-LEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
            D +   D+  A  + GYP++   + G +  KY+G    E L  ++       P  P P+ + P + E  +  +   AN +E      +  + F+APWCGHCKA  P +   A  +  ++ V    VDCT + +A +C+   + G+P   +F  GK     +   + E   D+V      + A P+     +A        G +  V+ L + +F   I    +   V FY+PWCGHC  + P++   + K    L    IA VD T E ++ ++Y V G+PTL+ F       ++ G R  D++  F++++  D
Sbjct:   12 DCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPATPEPEAEPPRAPELKQGLYELSANNFELHVSQGNHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCT-QHYA-VCSEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKSFEDTIAQGIT--FVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVGEHNGGRDLDSLHSFVLRQAKD 321          

HSP 2 Score: 92.0485 bits (227), Expect = 6.483e-20
Identity = 64/226 (28.32%), Postives = 106/226 (46.90%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLK-GKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQ---------PPPQKDVPWSEETNE---IDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTS-AANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQL 639
            F+APWCG+CK + P +   A  L+  +++ IG   D +    +     + GYP++   +DG KV +Y+G    E+L  +V +  Q          P +  V  +E T +   +  LT+ +F + + Q     V FYAPWCGHCK   P +   +  +      V    VDCT E   ++C+   + G+P    F  G+     E++  R+ D   +F+   A  +L
Sbjct:  104 FFAPWCGHCKALAPTWEQLALGLEHSETVKIG-KVDCTQHYAVCSEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKSFEDTIAQG-ITFVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAER--NVCSKYSVRGYPTLLLFRGGEKV--GEHNGGRDLDSLHSFVLRQAKDEL 323          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Mouse
Match: Pdia4 (protein disulfide isomerase associated 4 [Source:MGI Symbol;Acc:MGI:104864])

HSP 1 Score: 132.88 bits (333), Expect = 3.466e-32
Identity = 76/236 (32.20%), Postives = 122/236 (51.69%), Query Frame = 1
Query:  295 NEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKK-VAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKK 999
            N +  L D NF  ++   ++V++ FYAPWCGHCK   P++   A+ + +N   +A   +D T  S   + +   ++G+P  +    G+     +Y   R +++ VA +   + P       W   P  E  + L K+NF  ++V++    LV FY+PWCGHC  + P +  AA +L    P   +A VDAT +T LA ++ VSG+PTL  F   G    Y G R    I ++MI++
Sbjct:   58 NGVWVLNDGNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASM--LASKFDVSGYPTIKILKKGQAV---DYDGSRTQEEIVAKVREVSQPD------W--TPPPEVTLSLTKDNF-DDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIFR-KGRPFDYNGPREKYGIVDYMIEQ 278          

HSP 2 Score: 117.857 bits (294), Expect = 2.832e-27
Identity = 63/212 (29.72%), Postives = 113/212 (53.30%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAE-NKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP 633
            FYAPWCG+CKQ  P++   A+TLK     I +   D ++   L   F+++GYP++ +++ G  V  Y+G  ++E ++  V   +QP       W+        LT  NF + ++  + ++V FYAPWCGHCK   P++  AA ++++ +  +    VD T+++  D+     ++G+P  + F  G+     +Y+  RE+   V +M   + P
Sbjct:   82 FYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKGQAV-DYDGSRTQEEIVAKVREVSQP------DWTPPPEVTLSLTKDNFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQT--DLAKRFDVSGYPTLKIFRKGRPF---DYNGPREKYGIVDYMIEQSGP 281          

HSP 3 Score: 65.4698 bits (158), Expect = 1.066e-10
Identity = 45/148 (30.41%), Postives = 72/148 (48.65%), Query Frame = 1
Query:  556 NTSNSEYSLEREEDD------FV-AFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDW---VKYMGERTD 969
            + S  ++++E EE D      FV AF      P + ++   +   G   +V+     F   ++      L+ FY+PWCGHC  ++P + +   K +      +IA +DAT       QYKV GFPT +YF+P+GD    +K+ G   D
Sbjct:  476 DESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVV--GKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKG-QKDLVIAKMDATANDITNDQYKVEGFPT-IYFAPSGDKKNPIKFEGGNRD 619          

HSP 4 Score: 59.3066 bits (142), Expect = 1.019e-8
Identity = 27/82 (32.93%), Postives = 44/82 (53.66%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKV--FKYEGDNSK-EALIKFV 240
            FYAPWCG+CKQ++P + +     KG+   +    D +  D     + + G+P+++    G+K    K+EG N   E L KF+
Sbjct:  546 FYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFI 627          

HSP 5 Score: 49.6766 bits (117), Expect = 9.293e-6
Identity = 24/73 (32.88%), Postives = 36/73 (49.32%), Query Frame = 1
Query:  337 LDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSE-GITGFPIFRYFNYG 552
            +D  + V++ FYAPWCGHCK  +P +TS   +    K +    +D T     DI   +  + GFP   +   G
Sbjct:  536 MDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATAN---DITNDQYKVEGFPTIYFAPSG 605          
BLAST of Protein disulfide-isomerase A5 vs. UniProt/SwissProt
Match: sp|Q921X9|PDIA5_MOUSE (Protein disulfide-isomerase A5 OS=Mus musculus OX=10090 GN=Pdia5 PE=1 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.767e-50
Identity = 116/351 (33.05%), Postives = 182/351 (51.85%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEG-DNSKEALIKFVHNPTQPPPQ-KDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQM---AENKKVAFIGVDCT-DESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETH--LAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM-IKKHSDIIRHEE 1026
            MFYAPWC  CK++ P F  AAT ++G  +  G+N   S  +++K+ +N+ GYP++   + G  +F YE   ++ E +++++ NP  P PQ  + PW++E   +  LTD +F +++ +H SV+VMF+APWCGHCK  KP+F SAA  +   AE+  V    VD T +E+ A       I+ FP  +YF   KN         R +  F+ +M NP  P         +     +++ L  +NF ++ +      LVMFY+PWC HC  + P F   A+  +        AAVD   + +  L  Q  V  +PT  Y+       KY  +RT+   T F+   +  D+ R E+
Sbjct:  174 MFYAPWCSMCKRIMPHFQKAATQVRGHIVLAGMNVYPSEFENIKEEYNVRGYPTICYFEKGRFLFPYENYGSTAEDIVEWLKNPLPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFESAAEVLHGDAESSGV-LAAVDATVNEALAG---RFHISAFPTLKYF---KNGEQQAVPALRTKKKFIEWMQNPEAPPPPEPTWEEQ---QTSVLHLVGDNF-RDTLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKEDR-KIACAAVDCVKDKNQDLCQQEAVKAYPTFHYYHYGKLVEKYESDRTELGFTSFIRTLREGDLKRLEK 512          

HSP 2 Score: 137.502 bits (345), Expect = 1.979e-33
Identity = 95/322 (29.50%), Postives = 154/322 (47.83%), Query Frame = 1
Query:   49 FAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPS-----VFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHES-VIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDA-RRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQT-LLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
             +  A  +KG+     ++   + +  L +   +   P      +F  QDG    +Y+   + ++++ F+ +P  PP  ++ P +++   ID  ++ +F   L + E  +++MFYAPWC  CK   P F  AA Q+  +  +   G++     F +I     + G+P   YF  G+     E +     +D V ++ NP  PQ       W    G  ++  L   +F Q +  H+S  LVMF++PWCGHC  MKP F +AA  L      S ++AAVDAT    LA ++ +S FPTL YF  NG+       RT     E+M
Sbjct:   65 LSTVAQAVKGQGTVCWVDCGDAESRKLCKKMKVDLSPKDKKIELFHYQDGAFHMQYDRAVTLKSIVAFLKDPKGPPLWEEDPGAKDVVHID--SEKDFRRLLKREEKPLLMMFYAPWCSMCKRIMPHFQKAATQVRGH--IVLAGMNVYPSEFENIKEEYNVRGYPTICYFEKGRFLFPYE-NYGSTAEDIVEWLKNPLPPQPQVPETPWADEGG--SVYHLTDEDFDQFVKEHSS-VLVMFHAPWCGHCKKMKPEFESAAEVLHGDAESSGVLAAVDATVNEALAGRFHISAFPTLKYFK-NGEQQAVPALRTKKKFIEWM 377          
BLAST of Protein disulfide-isomerase A5 vs. UniProt/SwissProt
Match: sp|Q5I0H9|PDIA5_RAT (Protein disulfide-isomerase A5 OS=Rattus norvegicus OX=10116 GN=Pdia5 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 5.712e-46
Identity = 115/351 (32.76%), Postives = 183/351 (52.14%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEG-DNSKEALIKFVHNPTQPPPQK-DVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQM---AENKKVAFIGVDCT-DESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETH--LAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM-IKKHSDIIRHEE 1026
            MFYAPWC  CK++ P F  AAT ++G ++  G+N      +++K+ +N+ GYP++   + G  +F+YE   ++ E +++++ NP  P PQ  + PW++E   +  LTD +F +++ +H SV+VMF+APWCGHCK  KP+F SAA  +   AE+  V    VD T +E+ A+      I+ FP  +YF   KN         R +  F+ +M NP  P         +     +++ L  +NF + +       LVMFY+PWC HC  + P F   A+  +        AAVD   + +  L  Q  V  +PT  Y+       KY  +RT+   T F+   +  D+ R E+
Sbjct:  174 MFYAPWCSMCKRIMPHFQKAATQVRGHTVLAGMNVYPPEFENIKEEYNVRGYPTICYFEKGRFLFQYENYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFESAAEVLHGDAESSGV-LAAVDATINEALAE---RFHISAFPTLKYF---KNGEQQAVPALRTKKKFIEWMQNPEAPPPPEPTWEEQ---QTSVLHLVGDNFRETL-KKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKDDR-KIACAAVDCVKDKNQDLCQQESVKAYPTFHYYHYGKLVEKYESDRTELGFTSFIRTLREGDLKRLEK 512          

HSP 2 Score: 129.028 bits (323), Expect = 1.836e-30
Identity = 96/322 (29.81%), Postives = 155/322 (48.14%), Query Frame = 1
Query:   49 FAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPS-----VFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHES-VIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRH-WRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQT-LLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
             +  A  +KG+     ++   + +  L +   +   P      +F  QDG    +Y+   + ++++ F+ +P  PP  ++ P +++   ID  ++ +F   L + E  +++MFYAPWC  CK   P F  AA Q+  +  +A  G++     F +I     + G+P   YF  G+     E +     +D V ++ NP  PQ       W    G  ++  L   +F Q +  H+S  LVMF++PWCGHC  MKP F +AA  L      S ++AAVDAT    LA ++ +S FPTL YF  NG+       RT     E+M
Sbjct:   65 LSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKIELFHYQDGAFHMQYDRAVTLKSIVAFLKDPKGPPLWEEDPGAKDVVHID--SEKDFRRLLKKEEKPLLMMFYAPWCSMCKRIMPHFQKAATQVRGHTVLA--GMNVYPPEFENIKEEYNVRGYPTICYFEKGRFLFQYE-NYGSTAEDIVEWLKNPQPPQPQVPETPWADEGG--SVYHLTDEDFDQFVKEHSS-VLVMFHAPWCGHCKKMKPEFESAAEVLHGDAESSGVLAAVDATINEALAERFHISAFPTLKYFK-NGEQQAVPALRTKKKFIEWM 377          
BLAST of Protein disulfide-isomerase A5 vs. UniProt/SwissProt
Match: sp|Q14554|PDIA5_HUMAN (Protein disulfide-isomerase A5 OS=Homo sapiens OX=9606 GN=PDIA5 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.561e-44
Identity = 109/338 (32.25%), Postives = 179/338 (52.96%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEG-DNSKEALIKFVHNPTQPPPQK-DVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQM---AENKKVAFIGVDCT-DESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETH--LAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFYAPWC  CK+M P F  AAT L+G ++  G+N   S  +++K+ +++ G+P++   + G  +F+Y+   ++ E +++++ NP  P PQ  + PW++E   +  LTD +F +++ +H SV+VMF+APWCGHCK  KP+F  AA  +   A++  V    VD T +++ A+      I+ FP  +YF   KN       + R +  F+ +M NP  P         +     +++ L  +NF +  +      LVMFY+PWC HC  + P F   A+  +        AAVD   + +  L  Q  V G+PT  Y+       KY  +RT+   T ++
Sbjct:  176 MFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFEKAAEALHGEADSSGV-LAAVDATVNKALAE---RFHISEFPTLKYF---KNGEKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQ---QTSVLHLVGDNF-RETLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKDDR-KIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYHYGKFAEKYDSDRTELGFTNYI 501          

HSP 2 Score: 126.331 bits (316), Expect = 1.556e-29
Identity = 95/322 (29.50%), Postives = 153/322 (47.52%), Query Frame = 1
Query:   49 FAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPS-----VFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHES-VIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRH-WRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSC-LIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
             +  A  +KG+     ++   + +  L +   +   P      +F  QDG    +Y    + ++++ F+ +P  PP  ++ P +++   +D  ++ +F   L + E  +++MFYAPWC  CK   P F  AA Q+  +  +A  G++     F +I     + GFP   YF  G+     + +     +D V ++ NP  PQ       W    G  ++  L   +F Q +  H+S  LVMF++PWCGHC  MKP F  AA  L     S  ++AAVDAT    LA ++ +S FPTL YF  NG+       RT     E+M
Sbjct:   67 LSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLD--SEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLA--GMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYD-NYGSTAEDIVEWLKNPQPPQPQVPETPWADEGG--SVYHLTDEDFDQFVKEHSS-VLVMFHAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFK-NGEKYAVPVLRTKKKFLEWM 379          
BLAST of Protein disulfide-isomerase A5 vs. UniProt/SwissProt
Match: sp|Q2KIL5|PDIA5_BOVIN (Protein disulfide-isomerase A5 OS=Bos taurus OX=9913 GN=PDIA5 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 7.952e-43
Identity = 107/337 (31.75%), Postives = 171/337 (50.74%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEG-DNSKEALIKFVHNPTQPPPQK-DVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQM--AENKKVAFIGVDCT-DESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETH--LAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFYAPWC  CK++ P F  AAT L+G+ +  G+N   S  +++K+ +++ GYP++   + G  +F+Y+   ++ E +++++ NP  P PQ  + PW++E   +  L+D +F +++ +H SV+VMF+APWCGHCK  KP+F SAA  +    +       VD T +++ A+      I  FP  +YF   KN         R +  F+ +M N           W       +++ L  +NF + +      ALVMFY+PWC HC    P F  AA+  +        AA+D   E +  L  Q  V  +PT  Y+       KY    T+   T F+
Sbjct:  178 MFYAPWCSVCKRIMPHFQKAATQLRGQFVLAGMNVYPSEFENIKEEYSVRGYPTICYFEKGRFLFQYDSYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLSDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFESAAEVLHGEGDSSGVLAAVDATVNKALAE---RFHIAEFPTLKYF---KNGEKYAVPALRTKKSFIEWMRN-PESPPPPDPAWEE--QQTSVLHLSGDNFRETL-KRKKHALVMFYAPWCPHCKKAIPHFTAAADAFKDDR-KIACAAIDCVKENNKDLCQQEAVKAYPTFHYYHYGKFVEKYDTNPTELGFTSFI 503          

HSP 2 Score: 124.02 bits (310), Expect = 9.765e-29
Identity = 89/279 (31.90%), Postives = 138/279 (49.46%), Query Frame = 1
Query:  163 VFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHES-VIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRH-WRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSC-LIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            +F  QDG    +Y    + ++++ F+ +P  PP  ++ P +++   ID   + +F   L + E  +++MFYAPWC  CK   P F  AA Q+    +    G++     F +I     + G+P   YF  G+     + S     +D V ++ NP  PQ       W    G  ++  L   +F Q +  H+S  LVMF++PWCGHC  MKP F +AA  L     S  ++AAVDAT    LA ++ ++ FPTL YF  NG+       RT  +  E+M
Sbjct:  112 LFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHID--NEKDFRRLLKKEEKPILMMFYAPWCSVCKRIMPHFQKAATQL--RGQFVLAGMNVYPSEFENIKEEYSVRGYPTICYFEKGRFLFQYD-SYGSTAEDIVEWLKNPQPPQPQVPETPWADEGG--SVYHLSDEDFDQFVKEHSS-VLVMFHAPWCGHCKKMKPEFESAAEVLHGEGDSSGVLAAVDATVNKALAERFHIAEFPTLKYFK-NGEKYAVPALRTKKSFIEWM 381          
BLAST of Protein disulfide-isomerase A5 vs. UniProt/SwissProt
Match: sp|Q8NBS9|TXND5_HUMAN (Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2)

HSP 1 Score: 154.451 bits (389), Expect = 7.098e-40
Identity = 96/358 (26.82%), Postives = 167/358 (46.65%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQF---AAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFV-----HNPTQPPPQKDVPWSEETNEIDF-LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSN-------------SEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
            MF+APWCG+C++++P +        +++   +++    D +   D+  A  + GYP++ L + G +  KY+G    + L  ++       P  P P+ + P + E  +  + L+ +NF  ++ Q +  I  F+APWCGHCKA  P +   A  +  ++ V    VDCT     ++C+   + G+P   +F  GK                  E  L+R E      +T    P L A     +      ++ L +NNF   I    +   + FY+PWCGHC  + P++   + K    L    IA VD T E ++ ++Y V G+PTL+ F       ++ G R  D++  F++ +  D
Sbjct:   83 MFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVA-KVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFI-KFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHY--ELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADK----GTVLALTENNFDDTIAEGIT--FIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAKD 430          

HSP 2 Score: 102.449 bits (254), Expect = 6.114e-22
Identity = 63/233 (27.04%), Postives = 111/233 (47.64%), Query Frame = 1
Query:  310 LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQM--AENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPG----HEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            L  A+ + +  Q  +  VMF+APWCGHC+  +P +    ++    E+ KV    VDCT  S  D+C+++G+ G+P  + F  G+     +Y   R+      +M    N +          P      + +  L  +NF  ++        + F++PWCGHC A+ P++   A  L+    +  I  VD T    L +  +V G+PTL++F       +Y G+R  +++ E++
Sbjct:   65 LYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHS--DVCSAQGVRGYPTLKLFKPGQEA--VKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQ--GDHFIKFFAPWCGHCKALAPTWEQLALGLEH-SETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYV 290          
BLAST of Protein disulfide-isomerase A5 vs. TrEMBL
Match: R7UHJ2 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_224024 PE=4 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 8.077e-75
Identity = 141/344 (40.99%), Postives = 200/344 (58.14%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTD-----DLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVP--WSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP-------QLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFYAPWCG+CK MKP++  AA  +K      G+ G L+  D     +L   + + G+P+V   +DG + FK   + + + +++F+ +P +PPP       WSE  +E++ LTD NF  +  + +  +VMFYAPWCGHCKATKP+FTSAA+   +  KVAF  VDCT     D+CT   ++G+P FRYF+YGK+  + +Y+  R+E DF+AFM +P NP         +    W   PGHE +  L   NF Q  +S     LVMFY+PWCGHC +MKP++  AA  L+       +AAVDAT    LA++Y+V G+PTL YF      + Y  +R       FM
Sbjct:  297 MFYAPWCGHCKNMKPEYVQAAAAMKED----GVEGALAAVDATKAQELAGKYGVKGFPTVIYFKDGEEAFKV-NERTADKIVEFMKDPKEPPPPPPPEPEWSEVESEVNHLTDENFRSFTKKKKHTLVMFYAPWCGHCKATKPEFTSAADSFKDESKVAFAAVDCTKTK--DLCTKYDVSGYPTFRYFSYGKD--DFKYTGGRKEPDFIAFMKDPQNPPKVSPPPAANPLDMWADAPGHENVHHLTTANFAQ-FLSENPSTLVMFYAPWCGHCKSMKPAYAEAAQLLKENNKPGALAAVDATAHPDLASRYEVKGYPTLKYFKDGAFVMDYSKQRNTKEFVTFM 630          

HSP 2 Score: 225.328 bits (573), Expect = 8.638e-61
Identity = 129/334 (38.62%), Postives = 178/334 (53.29%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNP-TQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENK-KVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTN--PANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFYAPWCG+CK++KP +AAAAT LKG+++ +GIN D    + LK  FN++GYP++  I+ G    KY G N +  ++ ++ +P     P+K+  WS+E +++  L D  F E+L  + SV+VMFYAPWCGHCK  KP++  AA  M E+  + A   VD T     ++    G+ GFP   YF  G+         ER  D  V FM +     P       W  +     +  L   NF ++        LVMFY+PWCGHC A KP F +AA+  +        AAVD T    L  +Y VSG+PT  YFS   D  KY G R +     FM
Sbjct:  175 MFYAPWCGHCKRLKPDYAAAATELKGQAVLVGINADKPEFNPLKVDFNVSGYPTLHYIEKGKPKMKYGGKNDQNGIVSWMKDPQEPKEPEKEAEWSDEESDVHHLLDDTFDEFLTANPSVLVMFYAPWCGHCKNMKPEYVQAAAAMKEDGVEGALAAVDATKAQ--ELAGKYGVKGFPTVIYFKDGEEAFKVN---ERTADKIVEFMKDPKEPPPPPPPEPEWSEV--ESEVNHLTDENF-RSFTKKKKHTLVMFYAPWCGHCKATKPEFTSAADSFKD-ESKVAFAAVDCTKTKDLCTKYDVSGYPTFRYFSYGKDDFKYTGGRKEPDFIAFM 499          

HSP 3 Score: 201.83 bits (512), Expect = 2.598e-52
Identity = 117/340 (34.41%), Postives = 175/340 (51.47%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVP-------WSEETNE--IDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKV-AFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFYAPWCG+CK  KP+F +AA + K +S       D + T DL   ++++GYP+      G   FKY G   +   I F+ +P  PP     P       W++      +  LT ANF ++L ++ S +VMFYAPWCGHCK+ KP +  AA  + EN K  A   VD T  +  D+ +   + G+P  +YF  G    +  YS +R   +FV FM NP  P+L+       +   E +     +N +Q+ ++ ++  LVMFY+PWCGHC A KP+F  AA +L        IAAV+         + K+SG+P+  Y++       Y G RT +    ++
Sbjct:  420 MFYAPWCGHCKATKPEFTSAADSFKDESKVAFAAVDCTKTKDLCTKYDVSGYPTFRYFSYGKDDFKYTGGRKEPDFIAFMKDPQNPPKVSPPPAANPLDMWADAPGHENVHHLTTANFAQFLSENPSTLVMFYAPWCGHCKSMKPAYAEAAQLLKENNKPGALAAVDAT--AHPDLASRYEVKGYPTLKYFKDGAFVMD--YSKQRNTKEFVTFMENPG-PELEWSDEQNEV---EHLT----SNTMQSFLTSSADVLVMFYAPWCGHCKAAKPAFTEAA-ELLIDESDKHIAAVNCIANKAACEEAKISGYPSFKYYNRGIYVADYNGGRTAEDFANYL 746          

HSP 4 Score: 150.214 bits (378), Expect = 1.821e-34
Identity = 79/218 (36.24%), Postives = 115/218 (52.75%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARR 651
            MFYAPWCG+CK MKP +A AA  LK  +    +   D +   DL   + + GYP++   +DG  V  Y    + +  + F+ NP       ++ WS+E NE++ LT      +L     V+VMFYAPWCGHCKA KP FT AA  + +        V+C     A  C    I+G+P F+Y+N G   ++  Y+  R  +DF  ++ +P  PQLD + 
Sbjct:  550 MFYAPWCGHCKSMKPAYAEAAQLLKENNKPGALAAVDATAHPDLASRYEVKGYPTLKYFKDGAFVMDYSKQRNTKEFVTFMENPGP-----ELEWSDEQNEVEHLTSNTMQSFLTSSADVLVMFYAPWCGHCKAAKPAFTEAAELLIDESDKHIAAVNCIANKAA--CEEAKISGYPSFKYYNRGIYVAD--YNGGRTAEDFANYLKSP--PQLDKKE 756          

HSP 5 Score: 146.362 bits (368), Expect = 3.673e-33
Identity = 88/277 (31.77%), Postives = 140/277 (50.54%), Query Frame = 1
Query:  175 QDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDF--LTDANFYEYLDQHES--VIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNP-ANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            +DG     YE   + E++  F+ +PT      D+PW+E++   D   +     Y  L + E   ++VMFYAPWCGHCK  KP + +AA ++    +   +G++     F  +     ++G+P   Y   GK     +Y  + +++  V++M +P    + +    W      E+ V    ++     ++     LVMFY+PWCGHC  MKP +V AA  ++       +AAVDAT    LA +Y V GFPT++YF  +G+    + ERT D I EFM
Sbjct:  113 KDGEFNTDYERKYTVESMSNFLRDPTG-----DIPWNEDSTATDVVHIETMKAYSSLMKKEKRPMLVMFYAPWCGHCKRLKPDYAAAATEL--KGQAVLVGINADKPEFNPLKVDFNVSGYPTLHYIEKGK--PKMKYGGKNDQNGIVSWMKDPQEPKEPEKEAEWS---DEESDVHHLLDDTFDEFLTANPSVLVMFYAPWCGHCKNMKPEYVQAAAAMKEDGVEGALAAVDATKAQELAGKYGVKGFPTVIYFK-DGEEAFKVNERTADKIVEFM 376          
BLAST of Protein disulfide-isomerase A5 vs. TrEMBL
Match: A0A1X7VMG8 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 GN=100634383 PE=4 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 6.524e-71
Identity = 133/350 (38.00%), Postives = 192/350 (54.86%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVP------WSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQM-AENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM--IKKHSDIIRHE 1023
            MFYAPWCG+C+ +KP+FAAAAT+LKGK +  G+N D   T   ++ +N+TG+P++   ++G   + Y G    +++IK++ +P  PP  ++V       WS E N +  LT  NF   +D   S +V FYAPWCGHCKA KP +  AA  + +EN       VD T E   ++ +   ++GFP  +YF+ GK   +  Y   R  + FV FM NP  P  +  + W  I   E  V    +   +  +  T  ALVMFY+PWCGHC A KP F++AA  L+    + L AAVD T    +  Q  V G+PT++Y S      KYMG R  +   EF+    K+  I++ E
Sbjct:  171 MFYAPWCGHCQLLKPEFAAAATSLKGKQVLAGMNLDKPETMLTREEYNVTGFPTLLYFEEGKVKYPYSGGRDTDSIIKWLSDPQPPPSTQEVEQEAGANWSTELNNVVHLTSENFQSVIDSSPSTLVTFYAPWCGHCKAMKPDYNEAAKLLESENILGTLAAVDATAER--ELASHYQVSGFPTIKYFSNGKELYD--YGYPRTTESFVEFMKNP-QPPPEKEKDWSEI---ETGVHHLTDETYKPFIKKTKHALVMFYAPWCGHCKAAKPEFIDAAASLKEDKKTSL-AAVDCTKYAQICDQNDVQGYPTILYMSYGKKSFKYMGPRDSNGFVEFLRNPNKYVSIVKDE 511          

HSP 2 Score: 161.384 bits (407), Expect = 2.303e-39
Identity = 98/285 (34.39%), Postives = 151/285 (52.98%), Query Frame = 1
Query:  172 IQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFL---TDANFYEYL-DQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSE--GITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP------QLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
             +DG+    Y+    K +L+ F+ +PT      D PWSE+    D     +    Y++L  + + +++MFYAPWCGHC+  KP+F +AA  +   + +A + +D  +     + T E   +TGFP   YF  GK      YS  R+ D  + ++++P  P      + +A  +W     +  +V L   NF Q+++  +   LV FY+PWCGHC AMKP +  AA  L++      +AAVDAT E  LA+ Y+VSGFPT+ YFS   +   Y   RT ++  EFM
Sbjct:  108 FKDGSYHKDYDRLLRKSSLLDFMKDPTS-----DAPWSEDPTSKDVRHIESSTGLYKFLAKEKKPILLMFYAPWCGHCQLLKPEFAAAATSLKGKQVLAGMNLDKPE----TMLTREEYNVTGFPTLLYFEEGK--VKYPYSGGRDTDSIIKWLSDPQPPPSTQEVEQEAGANWSTELNN--VVHLTSENF-QSVIDSSPSTLVTFYAPWCGHCKAMKPDYNEAAKLLESENILGTLAAVDATAERELASHYQVSGFPTIKYFSNGKELYDYGYPRTTESFVEFM 378          
BLAST of Protein disulfide-isomerase A5 vs. TrEMBL
Match: A0A1S3HT50 (protein disulfide-isomerase A5-like OS=Lingula unguis OX=7574 GN=LOC106157954 PE=4 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.972e-69
Identity = 134/347 (38.62%), Postives = 198/347 (57.06%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQ-----AFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQK--DVPWSEETN-EIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQ---------LDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFYAPWCG+CK+MKP++  AA  LK +    G+ G L+  D  K+        + G+P+V   +DG   F +  + + + L++F+ +P +PPP    +  WSE+ +  ++FLT+  F  ++ + +  +VMFYAPWCGHCK  KP +T+AA    ++ K+A+  VDCT   +  +CT+  ++G+P F+Y+NYGKN    +Y   REE DFV FM +P NP+               W  + G E +  L    F +  V      LVMFY+PWCGHC AMKP++  AA KL+    + ++AAVDAT E  L  +YKV+GFPTL YF       +Y   R+   +  FM
Sbjct:  294 MFYAPWCGHCKKMKPEYVQAAAQLKEE----GVEGILAAVDATKERKAAETLKVQGFPTVKYFKDGEYAFDF-NERTADKLVEFMKDPKEPPPPPPPEAEWSEQEDIHVNFLTEETFKPFMKKKKHTLVMFYAPWCGHCKKAKPHYTNAAEIYKDDPKIAYAAVDCT--KYQSLCTANDVSGYPTFKYYNYGKNPQ--QYQGGREEADFVNFMKDPNNPEGSTPPPPPQQTPEEQWADVAGAENLNHLTSGTF-EAFVKENPSVLVMFYAPWCGHCKAMKPAYGEAAQKLKEQNINGVLAAVDATQERDLTNKYKVTGFPTLKYFRNGEVAFEYNRGRSTSDLVSFM 630          

HSP 2 Score: 223.402 bits (568), Expect = 8.586e-60
Identity = 126/335 (37.61%), Postives = 177/335 (52.84%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHN-PTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFI-GVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSL---EREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFYAPWCG+CK++KP +AAAAT LKG S+ +G++ D      ++Q +NITG+P++   ++G K + Y G N+KE +I ++ N      P+K+  W++E  E+  L D+NF EY+  H SV+VMFYAPWCGHCK  KP++  AA Q+ E      +  VD T E  A    +  + GFP  +YF  G      EY+    ER  D  V FM +P  P              +  V        +  +      LVMFY+PWCGHC   KP + NAA ++    P    AAVD T    L     VSG+PT  Y++   +  +Y G R +     FM
Sbjct:  172 MFYAPWCGFCKRLKPDYAAAATELKGHSVLVGMDVDKPEMMPVRQEYNITGFPTIVYFENGKKKYNYGGQNNKEGIISWMKNPEPPKEPEKEAEWADEETEVVHLQDSNFDEYVKDHPSVLVMFYAPWCGHCKKMKPEYVQAAAQLKEEGVEGILAAVDATKERKA--AETLKVQGFPTVKYFKDG------EYAFDFNERTADKLVEFMKDPKEPPPPPPPEAEWSEQEDIHVNFLTEETFKPFMKKKKHTLVMFYAPWCGHCKKAKPHYTNAA-EIYKDDPKIAYAAVDCTKYQSLCTANDVSGYPTFKYYNYGKNPQQYQGGREEADFVNFM 497          

HSP 3 Score: 191.43 bits (485), Expect = 1.726e-48
Identity = 123/349 (35.24%), Postives = 172/349 (49.28%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQK--------------DVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAE-NKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARR---HWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWV-KYMGERTDDAITEFM 990
            MFYAPWCG+CK+ KP +  AA   K          D +    L  A +++GYP+      G    +Y+G   +   + F+ +P  P                  DV  +E  N    LT   F  ++ ++ SV+VMFYAPWCGHCKA KP +  AA ++ E N       VD T E   D+     +TGFP  +YF  G+     EY+  R   D V+FMTNP   + +  +    W   P +  I  L +  F  +I S     LVMFY+PWCGHC   KP F  AAN LQ    +  +AAVD T  + L ++  V+G+PT  Y+S  G++V KY G R+    T+F+
Sbjct:  418 MFYAPWCGHCKKAKPHYTNAAEIYKDDPKIAYAAVDCTKYQSLCTANDVSGYPTFKYYNYGKNPQQYQGGREEADFVNFMKDPNNPEGSTPPPPPQQTPEEQWADVAGAENLNH---LTSGTFEAFVKENPSVLVMFYAPWCGHCKAMKPAYGEAAQKLKEQNINGVLAAVDATQER--DLTNKYKVTGFPTLKYFRNGEVAF--EYNRGRSTSDLVSFMTNPEEKKPEPPKPEAQWSDTPSN--IRHLTQATFTPSI-SDMEQVLVMFYAPWCGHCKRAKPEFEEAANSLQGST-TQFLAAVDCTAASELCSKEGVTGYPTFRYYS-RGEFVKKYQGGRSKQDFTDFL 754          

HSP 4 Score: 155.992 bits (393), Expect = 3.023e-36
Identity = 105/323 (32.51%), Postives = 163/323 (50.46%), Query Frame = 1
Query:   40 KPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYP-SVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETN--EIDFLTDANFYEYL--DQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARR-HWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            K   +  A  +KGK+  I +  D S    L + F I+  P  +   +DG     Y+     ++++ F+ +PT      D+PW E+++  ++  L +      L   + + ++VMFYAPWCG CK  KP + +AA ++  +     +G+D        +     ITGFP   YF  GK   N  Y  +  ++  +++M NP  P+   +   W        +V L+ +NF + +  H S  LVMFY+PWCGHC  MKP +V AA +L+      ++AAVDAT E   A   KV GFPT+ YF  +G++     ERT D + EFM
Sbjct:   66 KSLLSEVALEMKGKATVITV--DCSEAKKLCKKFKISPSPVELKHYKDGEFNKDYDRKEVVKSMVSFLQDPTG-----DLPWVEDSSAEDVTHLENPGALNKLLSKEKKPILVMFYAPWCGFCKRLKPDYAAAATELKGHS--VLVGMDVDKPEMMPVRQEYNITGFPTIVYFENGKKKYN--YGGQNNKEGIISWMKNPEPPKEPEKEAEW--ADEETEVVHLQDSNFDEYVKDHPS-VLVMFYAPWCGHCKKMKPEYVQAAAQLKEEGVEGILAAVDATKERKAAETLKVQGFPTVKYFK-DGEYAFDFNERTADKLVEFM 373          

HSP 5 Score: 153.295 bits (386), Expect = 1.890e-35
Identity = 85/223 (38.12%), Postives = 122/223 (54.71%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTD-----DLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKD---VPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDA 645
            MFYAPWCG+CK MKP +  AA  LK ++I    NG L+  D     DL   + +TG+P++   ++G   F+Y    S   L+ F+ NP +  P+       WS+  + I  LT A F   +   E V+VMFYAPWCGHCK  KP+F  AAN +  +       VDCT  S  ++C+ EG+TG+P FRY++ G+     +Y   R + DF  F+ +  +   DA
Sbjct:  550 MFYAPWCGHCKAMKPAYGEAAQKLKEQNI----NGVLAAVDATQERDLTNKYKVTGFPTLKYFRNGEVAFEYNRGRSTSDLVSFMTNPEEKKPEPPKPEAQWSDTPSNIRHLTQATFTPSISDMEQVLVMFYAPWCGHCKRAKPEFEEAANSLQGSTTQFLAAVDCTAAS--ELCSKEGVTGYPTFRYYSRGEFV--KKYQGGRSKQDFTDFLNSEKSTASDA 764          
BLAST of Protein disulfide-isomerase A5 vs. TrEMBL
Match: A0A2T7PR44 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_02829 PE=4 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 2.475e-69
Identity = 131/336 (38.99%), Postives = 194/336 (57.74%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQP-PPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQM-AENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSL---EREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFS-PNGDWVKYMGERTDDAITEFM 990
            MFYAPWCGYCK++KP+FAAAAT +KGK+  +GI+ D      ++  +N+TG+P+++  + G  +F+Y G+N+K+ +I +++NP  P  P+K+  WSEE +E+  L D+NF  Y+ +H SV+VMFYAPWCGHCK  KP +T AA  + +E        VD T      +     I GFP  +YF  G      EY+    ER++D  + F+ NP  P               ++V L + NF +  +     +LVMFY+PWCGHC   KP F++AA + +      L  AVD TT+  +   + V+G+PT  YF+  N +  KYMG R ++    FM
Sbjct:  161 MFYAPWCGYCKRLKPEFAAAATEVKGKAQLVGIDVDKPQMMGMRTQYNVTGFPTLYYFEKGRAMFRYGGENNKDGIITWLNNPRPPEEPKKEAEWSEEPSEVVHLEDSNFDTYIKEHSSVLVMFYAPWCGHCKKMKPDYTEAAETIKSEGLTSVLAAVDATKNR--KLAEDYKIKGFPTLKYFKDG------EYAFEVNERDKDKIIEFIKNPQEPPPPPAPEPSWEEIESSVVHLNEENF-KFTLKKRKHSLVMFYAPWCGHCKKAKPEFMSAAAQFKD-DSKVLFGAVDCTTQQSICTAHDVTGYPTFKYFNYLNKNSQKYMGGREENDFVNFM 486          

HSP 2 Score: 237.654 bits (605), Expect = 2.472e-65
Identity = 136/345 (39.42%), Postives = 193/345 (55.94%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNE--IDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFM-------------TNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEF 987
            MFYAPWCG+CK+MKP +  AA T+K + +   +   D +    L + + I G+P++   +DG   F+   +  K+ +I+F+ NP +PPP      S E  E  +  L + NF   L + +  +VMFYAPWCGHCK  KP+F SAA Q  ++ KV F  VDCT +    ICT+  +TG+P F+YFNY  N ++ +Y   REE+DFV FM             T P  PQ +    W  I G + I  L    F  + ++     LVMFY+PWCGHC  MKP++++AA +L T +P   +AAVDAT    LA  Y + GFPTL YF    +   Y G R+++ +  F
Sbjct:  283 MFYAPWCGHCKKMKPDYTEAAETIKSEGLTSVLAAVDATKNRKLAEDYKIKGFPTLKYFKDGEYAFEV-NERDKDKIIEFIKNPQEPPPPPAPEPSWEEIESSVVHLNEENFKFTLKKRKHSLVMFYAPWCGHCKKAKPEFMSAAAQFKDDSKVLFGAVDCTTQQ--SICTAHDVTGYPTFKYFNY-LNKNSQKYMGGREENDFVNFMRDPLSPSPTLPPATQP-QPQTNPGEDWADIEGQKNINFLTAETF-DSFIAEQPSVLVMFYAPWCGHCKKMKPAYMSAATRLMTEVPDAKLAAVDATKYRELANTYSIKGFPTLKYFEGGKEISDYGGGRSEEDLVNF 621          

HSP 3 Score: 174.096 bits (440), Expect = 1.469e-42
Identity = 106/322 (32.92%), Postives = 165/322 (51.24%), Query Frame = 1
Query:   49 FAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQ---DGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFL---TDANFYEYLDQHESV-IVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARR-HWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            F   A  +KGK+    +N      DD K    +   P  F ++   DG     Y+   + ++++ F+ +PT      D+PW E+   +D +   ++    + L + ++  +VMFYAPWCG+CK  KP+F +AA ++    K   +G+D        + T   +TGFP   YF  G+  +   Y  E  +D  + ++ NP  P+   +   W   P    +V LE +NF   I  H+S  LVMFY+PWCGHC  MKP +  AA  +++   + ++AAVDAT    LA  YK+ GFPTL YF  +G++   + ER  D I EF+
Sbjct:   58 FEQVAEEMKGKATIAFVN----CGDDKKFCKKLKINPDTFELKHYKDGEFNKDYDRKLAAKSMVNFLMDPTG-----DIPWDEDPTAVDVIHIDSEDGLNKLLKKDKAATLVMFYAPWCGYCKRLKPEFAAAATEV--KGKAQLVGIDVDKPQMMGMRTQYNVTGFPTLYYFEKGR--AMFRYGGENNKDGIITWLNNPRPPEEPKKEAEWSEEPSE--VVHLEDSNFDTYIKEHSS-VLVMFYAPWCGHCKKMKPDYTEAAETIKSEGLTSVLAAVDATKNRKLAEDYKIKGFPTLKYFK-DGEYAFEVNERDKDKIIEFI 362          

HSP 4 Score: 159.458 bits (402), Expect = 1.524e-37
Identity = 115/361 (31.86%), Postives = 165/361 (45.71%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNK-VFKYEGDNSKEALIKFVHN----------PTQPPPQKDV--PWS--EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQ-MAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFM--TNPANPQ--LDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHE 1023
            MFYAPWCG+CK+ KP+F +AA   K  S  +    D +T   +  A ++TGYP+       NK   KY G   +   + F+ +           TQP PQ +    W+  E    I+FLT   F  ++ +  SV+VMFYAPWCGHCK  KP + SAA + M E        VD T   + ++  +  I GFP  +YF  GK  S+  Y   R E+D V F   + P  P+  L +  H + +P       L   NF  + + +   ALV FY+  C  C    P F  A   L   L     A V+  T + L     +  FPT V +       +Y   +T DA   + +K  + + + E
Sbjct:  406 MFYAPWCGHCKKAKPEFMSAAAQFKDDSKVLFGAVDCTTQQSICTAHDVTGYPTFKYFNYLNKNSQKYMGGREENDFVNFMRDPLSPSPTLPPATQPQPQTNPGEDWADIEGQKNINFLTAETFDSFIAEQPSVLVMFYAPWCGHCKKMKPAYMSAATRLMTEVPDAKLAAVDAT--KYRELANTYSIKGFPTLKYFEGGKEISD--YGGGRSEEDLVNFFKGSKPPTPEESLPSFFHSKWVPS------LSGANF-SSTLRNREAALVFFYADSCPKCTKYWPEFAAAGEALVNQL-----ATVNCDTYSDLCGLEGIRKFPTFVLYMQGQRKDEYRDAKTKDAFLNY-VKTQTPLTKEE 749          
BLAST of Protein disulfide-isomerase A5 vs. TrEMBL
Match: A0A423TN25 (Protein disulfide-isomerase A5 OS=Penaeus vannamei OX=6689 GN=C7M84_003451 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 1.441e-68
Identity = 140/344 (40.70%), Postives = 195/344 (56.69%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQA-----FNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVP--WSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPAN-------PQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFYAPWCG+CK+MKP++ AAAT LK K    GI G L+  D  K+      F++ GYP++   +DG   F       K+ +I+F+ +P +PPP       WSE  + +  LTD NF  +L + + V+VMFYAPWCGHCK  KP+FT+AA++  ++ KV F  VDCT  +   +C    ++G+P F+YFNY KNT    Y+  R E DFV FM +P N       P    +  W  + G E +  L +  F   I      ALVMFY+PWCGHC AMK  +  AA +L     + ++A VDAT E  LA+++++ GFPTL +F       +Y   R    I +FM
Sbjct:  283 MFYAPWCGHCKRMKPEYTAAATVLKEK----GIPGKLAAVDATKETKLGAEFSVKGYPTIKYFKDGEYAFDVSSAREKDKIIEFMSDPKEPPPPPPPEKPWSEVESSVIHLTDENFKPFLKKKKHVLVMFYAPWCGHCKKAKPEFTAAADKFVDDPKVEFAAVDCT--AHQTLCGVNDVSGYPTFKYFNYYKNT--KPYNGGRTEIDFVKFMEDPENPLSGSPPPPPSPQEEWASVEGSELLHHLTEATFDAFIKDRE--ALVMFYAPWCGHCKAMKGDYGQAAVELAAEGQNGVLATVDATVERSLASRFQIRGFPTLKFFRRGQLVTEYNRSRKAADIIDFM 616          

HSP 2 Score: 216.083 bits (549), Expect = 2.283e-58
Identity = 120/333 (36.04%), Postives = 179/333 (53.75%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPP--PQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVA-FIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFYAPWCG+CK++KP ++AAA  LK     + ++ +       +  +NITG+P++   + G   + YEG+N+K  ++ F+ NP + P  P+++V WSE  +++  LTDA F+E++    SV+VMFYAPWCGHCK  KP++T+AA  + E         VD T E+   +     + G+P  +YF  G+   +   S  RE+D  + FM++P  P               +++ L   NF +  +      LVMFY+PWCGHC   KP F  AA+K     P    AAVD T    L     VSG+PT  YF+   +   Y G RT+    +FM
Sbjct:  161 MFYAPWCGFCKRLKPDYSAAAAELKDTHTLVAMDVNKPENSAARIKYNITGFPTLVYFEAGAPKYTYEGENNKAGIVSFMKNPGKAPEKPKEEV-WSETPSDVSHLTDATFHEFIKGEASVLVMFYAPWCGHCKRMKPEYTAAATVLKEKGIPGKLAAVDATKET--KLGAEFSVKGYPTIKYFKDGEYAFD--VSSAREKDKIIEFMSDPKEPPPPPPPEKPWSEVESSVIHLTDENF-KPFLKKKKHVLVMFYAPWCGHCKKAKPEFTAAADKFVD-DPKVEFAAVDCTAHQTLCGVNDVSGYPTFKYFNYYKNTKPYNGGRTEIDFVKFM 486          

HSP 3 Score: 147.902 bits (372), Expect = 4.849e-34
Identity = 94/285 (32.98%), Postives = 140/285 (49.12%), Query Frame = 1
Query:  157 PSVFLIQ---DGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDF--LTDAN-FYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPAN-PQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            PS ++++   DG+    Y+   + +++  F+ +P+      D+PW E+   +D   + D N   + L + ++ ++MFYAPWCG CK  KP +++AA ++ +   +  + V+  + S A I     ITGFP   YF  G       Y  E  +   V+FM NP   P+      W   P    +  L    F + I    S  LVMFY+PWCGHC  MKP +  AA  L+       +AAVDAT ET L A++ V G+PT+ YF            R  D I EFM
Sbjct:   91 PSTYVLKHYKDGDFHKDYDRRETVQSMSTFLRDPSG-----DIPWDEDEQGVDVVHINDMNALNKLLKKEKAFMMMFYAPWCGFCKRLKPDYSAAAAELKDTHTLVAMDVNKPENSAARI--KYNITGFPTLVYFEAG--APKYTYEGENNKAGIVSFMKNPGKAPEKPKEEVWSETPSD--VSHLTDATFHEFIKGEAS-VLVMFYAPWCGHCKRMKPEYTAAATVLKEKGIPGKLAAVDATKETKLGAEFSVKGYPTIKYFKDGEYAFDVSSAREKDKIIEFM 363          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Cavefish
Match: pdia5 (protein disulfide isomerase family A member 5 [Source:NCBI gene;Acc:103026706])

HSP 1 Score: 196.823 bits (499), Expect = 2.189e-55
Identity = 123/339 (36.28%), Postives = 174/339 (51.33%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYE--GDNSKEALIKFVHNPTQPPPQK-DVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSE--GITGFPIFRYFNYGKNTSNSEYSLE--REEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATT-ETH-LAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFYAPWCG CK+M+P F   AT  KGK +  G+N   +  D LKQ FN+ GYP+    + G  +  YE  G  +K+ +  ++ NP  P P+  +VPWSE  + +  LTD +F  +L++H S ++MFYAPWCGHCK  KP++  AA  +  NK     GV    ++       E   I+GFP  +YF         +Y+L   R +D  + ++ NP  P     + W   P   ++  L   +F +  +     ALVMFY+PWC HC    P F+ AA   +        AAVD T  + H L  Q  V G+PT  Y++      KY GER +   T FM
Sbjct:  185 MFYAPWCGVCKRMQPIFQQTATETKGKYVLAGMNVHPAEFDGLKQEFNVKGYPTFCYFEKGKFLHHYENYGATAKD-IADWLKNPQPPQPKTPEVPWSESDSAVFHLTDESFDGFLEEHPSALIMFYAPWCGHCKKMKPEYDEAAEVL--NKDADTPGVLAAVDTTIHKTVGERFKISGFPTVKYF----EKREEKYTLPHLRTKDKIIEWLQNPQAPP-PPEQSWEEKPS--SVSHLGAEDF-REALKKKKHALVMFYAPWCPHCKNAVPHFITAAELFKDDR-KIAYAAVDCTKGQNHELCKQEGVEGYPTFNYYNYGKFSEKYNGERGEAGFTGFM 511          

HSP 2 Score: 126.716 bits (317), Expect = 1.224e-30
Identity = 94/320 (29.38%), Postives = 150/320 (46.88%), Query Frame = 1
Query:   61 ATTLKGKSIFIGINGDLSTTDDL--KQAFNITGYPSVFLI---QDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHES-VIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHE---AIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPS-CLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            A  +KG+     +N   S    L  K   +    P+ F I   +DG    +Y    + ++++ F+ +PT  P  ++ P +++   I+  T+ +F + L + E  +++MFYAPWCG CK  +P F   A +     K    G++     F  +     + G+P F YF  GK   + E +      D   ++ NP  PQ         +P  E   A+  L   +F   +  H S AL+MFY+PWCGHC  MKP +  AA  L     +  ++AAVD T    +  ++K+SGFPT+ YF    +       RT D I E++
Sbjct:   80 AQAVKGQGTIAWVNCGDSEGRKLCKKVKVDPGSKPAGFEILHYKDGTFHTEYSRPATLKSMVAFLKDPTGAPLWEENPEAKDVVHIE--TEKDFRKLLKREERPILMMFYAPWCGVCKRMQPIFQQTATET--KGKYVLAGMNVHPAEFDGLKQEFNVKGYPTFCYFEKGKFLHHYE-NYGATAKDIADWLKNPQPPQPKT----PEVPWSESDSAVFHLTDESFDGFLEEHPS-ALIMFYAPWCGHCKKMKPEYDEAAEVLNKDADTPGVLAAVDTTIHKTVGERFKISGFPTVKYFEKREEKYTLPHLRTKDKIIEWL 389          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Cavefish
Match: pdia5 (protein disulfide isomerase family A member 5 [Source:NCBI gene;Acc:103026706])

HSP 1 Score: 186.422 bits (472), Expect = 1.298e-51
Identity = 119/339 (35.10%), Postives = 172/339 (50.74%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYE--GDNSKEALIKFVHNPTQPPPQK-DVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSE--GITGFPIFRYFNYGKNTSNSEYSLE--REEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATT-ETH-LAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            + +A WCG CK+M+P F   AT  KGK +  G+N   +  D LKQ FN+ GYP+    + G  +  YE  G  +K+ +  ++ NP  P P+  +VPWSE  + +  LTD +F  +L++H S ++MFYAPWCGHCK  KP++  AA  +  NK     GV    ++       E   I+GFP  +YF         +Y+L   R +D  + ++ NP  P     + W   P   ++  L   +F +  +     ALVMFY+PWC HC    P F+ AA   +        AAVD T  + H L  Q  V G+PT  Y++      KY GER +   T FM
Sbjct:  180 LVFAWWCGVCKRMQPIFQQTATETKGKYVLAGMNVHPAEFDGLKQEFNVKGYPTFCYFEKGKFLHHYENYGATAKD-IADWLKNPQPPQPKTPEVPWSESDSAVFHLTDESFDGFLEEHPSALIMFYAPWCGHCKKMKPEYDEAAEVL--NKDADTPGVLAAVDTTIHKTVGERFKISGFPTVKYF----EKREEKYTLPHLRTKDKIIEWLQNPQAPP-PPEQSWEEKPS--SVSHLGAEDF-REALKKKKHALVMFYAPWCPHCKNAVPHFITAAELFKDDR-KIAYAAVDCTKGQNHELCKQEGVEGYPTFNYYNYGKFSEKYNGERGEAGFTGFM 506          

HSP 2 Score: 107.842 bits (268), Expect = 2.169e-24
Identity = 87/319 (27.27%), Postives = 140/319 (43.89%), Query Frame = 1
Query:   61 ATTLKGKSIFIGINGDLSTTDDL--KQAFNITGYPSVFLI---QDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHE---AIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPS-CLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            A  +KG+     +N   S    L  K   +    P+ F I   +DG    +Y    + ++++ F+ +PT  P  ++ P +++   I+    +  +      E    + +A WCG CK  +P F   A +     K    G++     F  +     + G+P F YF  GK   + E +      D   ++ NP  PQ         +P  E   A+  L   +F   +  H S AL+MFY+PWCGHC  MKP +  AA  L     +  ++AAVD T    +  ++K+SGFPT+ YF    +       RT D I E++
Sbjct:   74 AQAVKGQGTIAWVNCGDSEGRKLCKKVKVDPGSKPAGFEILHYKDGTFHTEYSRPATLKSMVAFLKDPTGAPLWEENPEAKDVVHIETEKVSISFRRRLWTEITFPLVFAWWCGVCKRMQPIFQQTATET--KGKYVLAGMNVHPAEFDGLKQEFNVKGYPTFCYFEKGKFLHHYE-NYGATAKDIADWLKNPQPPQPKT----PEVPWSESDSAVFHLTDESFDGFLEEHPS-ALIMFYAPWCGHCKKMKPEYDEAAEVLNKDADTPGVLAAVDTTIHKTVGERFKISGFPTVKYFEKREEKYTLPHLRTKDKIIEWL 384          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Cavefish
Match: pdia4 (protein disulfide isomerase family A member 4 [Source:NCBI gene;Acc:103026638])

HSP 1 Score: 144.821 bits (364), Expect = 2.502e-36
Identity = 87/261 (33.33%), Postives = 134/261 (51.34%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAE-NKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQEEKKKAD 1065
            +E N +  LTDANF  +++  ++V+V FYAPWCGHCK   P++   A  + E +  +    VD T  +   + +   ++G+P  +    G+     EY  +R E   V  +   A P       W+  P  EA ++L K+NF  ++V++    LV FY+PWCGHC  + P +  AA +L    P  L+A VDAT E  LA+++ V+G+PTL  F   G    Y G R    I ++M ++     +  +A K  QE  K  D
Sbjct:   58 KEENGVLVLTDANFDTFMEGKDTVLVEFYAPWCGHCKQFAPEYEKIAQVLKESDPPIPVAKVDATKAT--ALGSRFEVSGYPTIKILKKGEPV---EYDGDRSEKAIVERVKEVAQPD------WK--PPPEATLVLTKDNF-DDVVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPILLAKVDATVENDLASRFDVTGYPTLKMFR-KGKVFDYNGPREKIGIVDYMSEQAGPPSKQVQALKQIQELLKDGD 303          

HSP 2 Score: 122.094 bits (305), Expect = 1.001e-28
Identity = 72/236 (30.51%), Postives = 122/236 (51.69%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMA-ENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP---QLDARRHWRRI--PGHEAIVI 690
            FYAPWCG+CKQ  P++   A  LK     I +   D +    L   F ++GYP++ +++ G  V +Y+GD S++A+++ V    QP       W         LT  NF + ++  + ++V FYAPWCGHCK   P++  AA +++     +    VD T E+  D+ +   +TG+P  + F  GK     +Y+  RE+   V +M+  A P   Q+ A +  + +   G +A+++
Sbjct:   85 FYAPWCGHCKQFAPEYEKIAQVLKESDPPIPVAKVDATKATALGSRFEVSGYPTIKILKKGEPV-EYDGDRSEKAIVERVKEVAQPD------WKPPPEATLVLTKDNFDDVVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPILLAKVDATVEN--DLASRFDVTGYPTLKMFRKGKVF---DYNGPREKIGIVDYMSEQAGPPSKQVQALKQIQELLKDGDDALIV 308          

HSP 3 Score: 64.6994 bits (156), Expect = 1.578e-10
Identity = 46/160 (28.75%), Postives = 82/160 (51.25%), Query Frame = 1
Query:  562 SNSEYSLEREEDD-------FVAFMTNPANPQLDARRHWRRIPGHEAIV-ILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDW---VKYM-GERTDDAITEFMIKKHS 1005
               +Y++E EE D        VAF      P + ++     +P ++  V ++    F + ++      L+ FY+PWCGHC  ++P ++  A K +    + +IA +DAT        YKV GFPT +YF+P+ +    +K+  GER  +  ++F I++H+
Sbjct:  481 GGKKYAMEPEEFDTEVLREFVVAFKKGKLKPIIKSQP----VPKNKGPVKVIVGKTFDEIVLDKKKDVLIEFYAPWCGHCKKLEPDYLALAKKYKN-EKNLVIAKMDATANDVPHDSYKVEGFPT-IYFAPSNNKQNPIKFEGGERNVEGFSKF-IEEHA 633          

HSP 4 Score: 54.299 bits (129), Expect = 2.578e-7
Identity = 25/83 (30.12%), Postives = 44/83 (53.01%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKV--FKYE-GDNSKEALIKFVH 243
            FYAPWCG+CK+++P + A A   K +   +    D +  D    ++ + G+P+++     NK    K+E G+ + E   KF+ 
Sbjct:  548 FYAPWCGHCKKLEPDYLALAKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTIYFAPSNNKQNPIKFEGGERNVEGFSKFIE 630          

HSP 5 Score: 52.7582 bits (125), Expect = 8.048e-7
Identity = 39/141 (27.66%), Postives = 60/141 (42.55%), Query Frame = 1
Query:  160 SVFLIQDGNKVFKYEGDN-SKEALIKFV---HNPTQPPPQKDVPWSEETNEIDFLTDANFYE-YLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSN 567
            +V ++ +G K +  E +    E L +FV         P  K  P  +    +  +    F E  LD+ + V++ FYAPWCGHCK  +P + + A +    K +    +D T         S  + GFP   YF    N  N
Sbjct:  474 NVAILGEGGKKYAMEPEEFDTEVLREFVVAFKKGKLKPIIKSQPVPKNKGPVKVIVGKTFDEIVLDKKKDVLIEFYAPWCGHCKKLEPDYLALAKKYKNEKNLVIAKMDATANDVPH--DSYKVEGFPTI-YFAPSNNKQN 611          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Cavefish
Match: txndc5 (thioredoxin domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1951])

HSP 1 Score: 115.546 bits (288), Expect = 8.083e-28
Identity = 89/356 (25.00%), Postives = 156/356 (43.82%), Query Frame = 1
Query:   19 CGYCKQMKP---QFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDF------LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTN----------PANPQLDARRHWRRIPGHE-------AIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
            CG+C++++    + A    +++   I++        T        I GYP++ L +   +  KY+G    ++L  ++    Q  P++     E     +       LT  NF  ++ +  S  V F+APWCGHCKA  P +   A     +  V    +DCT     ++C+   + G+P   +F  G+     ++  +R+ + F  F+ N          PA     A      IP  E       ++V L ++NF   +    S   + FY+PWCGHC  + P++ + + K    L    IA VD T E  L  ++ V G+PTL+ F       ++ G R  +++  F++K+  D
Sbjct:    2 CGHCQRLQGTWNELADKYNSMETPPIYVVKVDCTKDTKFCSSDHGIRGYPTLKLFKPEQEAVKYQGSRDLQSLETWMLKTLQEEPEEPESEPEPPKVPEPKHGMYELTAGNFKSHISKG-SHFVKFFAPWCGHCKAMAPTWEQLATSFEHSDLVKIGKLDCTQH--YEVCSENQVRGYPTLLFFTDGEKVD--QFRGKRDLESFKEFVDNHLADAASKDQPAAEDAKANE----IPEAEEPAKPESSVVTLTESNFDDIVAKGVS--FIKFYAPWCGHCKNLAPTWEDLSKKEFPGLTDVKIAKVDCTVERSLCNRFSVQGYPTLLIFRAGKQGEEHNGGRDLESLHSFVMKQARD 346          

HSP 2 Score: 96.6709 bits (239), Expect = 2.438e-21
Identity = 66/228 (28.95%), Postives = 102/228 (44.74%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEE--TNEID-------------FLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTS-AANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQL 639
            F+APWCG+CK M P +   AT+ +   +      D +   ++     + GYP++    DG KV ++ G    E+  +FV N       KD P +E+   NEI               LT++NF + + +  S I  FYAPWCGHCK   P +   +  +      V    VDCT E    +C    + G+P    F  GK     E++  R+ +   +F+   A  +L
Sbjct:  126 FFAPWCGHCKAMAPTWEQLATSFEHSDLVKIGKLDCTQHYEVCSENQVRGYPTLLFFTDGEKVDQFRGKRDLESFKEFVDNHLADAASKDQPAAEDAKANEIPEAEEPAKPESSVVTLTESNFDDIVAKGVSFI-KFYAPWCGHCKNLAPTWEDLSKKEFPGLTDVKIAKVDCTVER--SLCNRFSVQGYPTLLIFRAGKQ--GEEHNGGRDLESLHSFVMKQARDEL 348          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Cavefish
Match: dnajc10 (DnaJ heat shock protein family (Hsp40) member C10 [Source:NCBI gene;Acc:103021499])

HSP 1 Score: 111.309 bits (277), Expect = 3.404e-25
Identity = 89/358 (24.86%), Postives = 151/358 (42.18%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLD---QHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIR---HEEAEKLFQEEKKK 1059
            F+APWC  C+ + P+   A+  L G+  F  +  D +  + L   +NI  YP+  +I + + V +YEG +S + +++F+ +   P              +  LT   F + +    Q E+ +V FYAPWCG C+A  P++   A  ++    V    VDC  +    +C SE +  +P  R F    N  +  +S      D  +  T            W       A V L   +F + I+      ++ FY+PWCG C    P F   A  L+  + +     VD            ++ +PT V F P      Y+G +      E++  + S++I    H+  ++L  + K K
Sbjct:  478 FFAPWCPPCRALLPELRKASIQLYGQMKFGTL--DCTIHEGLCSRYNINAYPTT-VIFNKSSVHEYEGHHSADGILEFIQDLVNPA-------------VVTLTPDTFQQLVKRRKQTETWVVDFYAPWCGPCQALLPEWRRMARMLSGVINVG--TVDC--QKHHSLCQSENVRAYPEIRLFPQNSNRRDQYHSYNGWHRDAQSLKT------------WALSSLPRASVDLTPEDFKRKILEGKEHWVLDFYAPWCGPCQHFAPEFEILARMLKGTVRA---GKVDCQAHYQTCQSAGITAYPT-VRFYP------YLGTQRRQQGGEYINSRDSNVISDVIHQRLQQLALKNKSK 793          

HSP 2 Score: 75.0998 bits (183), Expect = 1.098e-13
Identity = 55/202 (27.23%), Postives = 82/202 (40.59%), Query Frame = 1
Query:  340 DQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNI--VSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGD 939
            D  E  +V F+APWC  C+A  P+   A+ Q+    K  F  +DCT      +C+   I  +P    FN    +S  EY      D  + F+ +  NP               A+V L  + F Q +     T   +V FY+PWCG C A+ P +   A  L  ++    +  VD      L     V  +P +  F  N +
Sbjct:  469 DGKEPWLVDFFAPWCPPCRALLPELRKASIQLYGQMK--FGTLDCTIHE--GLCSRYNINAYPTTVIFN---KSSVHEYEGHHSADGILEFIQDLVNP---------------AVVTLTPDTFQQLVKRRKQTETWVVDFYAPWCGPCQALLPEWRRMARMLSGVIN---VGTVDCQKHHSLCQSENVRAYPEIRLFPQNSN 645          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006474.1 (pep scaffold:Pmarinus_7.0:GL478000:14574:47610:1 gene:ENSPMAG00000005827.1 transcript:ENSPMAT00000006474.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.644 bits (457), Expect = 2.434e-50
Identity = 120/356 (33.71%), Postives = 179/356 (50.28%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYE--GDNSKEALIKFVHNPTQPPPQ-KDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAA---NQMAENKKVAFIGVDCT-----DESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLE--REEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTE--THLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMI----KKHSDI 1011
            MFYAPWCG CK+MKP F  AAT  K   +  G+N   +  D +K  +N+TGYP+    + G   F Y+  G  +K+ +++++ NP  P P   +V WSE  + +  LTD +F +++D+H +V+VMFYAPWCGHCK  KP +  AA   N   EN       VD T      E FA       I GFP  ++F  G+     +Y++   R +D  ++++ +   P       W        +  L    F +  +     AL+MFY+PWC HC   KP F  AA +L+      L AAVD T +    L +Q  V G+PT+ +++       Y G R +     F++    K HS++
Sbjct:  178 MFYAPWCGVCKRMKPVFQEAATMAKKTYVLAGMNVHPAEFDGIKSDYNVTGYPTFCYFEKGKFRFNYQSYGAQAKD-IVEWLKNPESPKPTVPEVAWSETDSAVFHLTDEDFQDFVDKHPNVLVMFYAPWCGHCKKLKPDYDEAAKILNNEEENSPGVLAAVDATIHRALAERFA-------IKGFPTMKFFQDGE----EKYTVSDLRSKDKILSWIRD-PQPPPPPEVPWDE--QENDVAHLSVATF-REFLKKKRHALLMFYAPWCFHCKQAKPHFTAAAAQLREDHKVAL-AAVDCTKQDNNELCSQEGVRGYPTMNHYTYGKFVGPYTGGRQEADFINFLLSLRGKSHSEL 516          

HSP 2 Score: 130.568 bits (327), Expect = 1.047e-32
Identity = 91/287 (31.71%), Postives = 139/287 (48.43%), Query Frame = 1
Query:  151 GYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFL---TDANFYEYLDQHES-VIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARR-HWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSC--LIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            G   +   +DG    +Y+   + ++L+ F+++PT  P      W EE +  D +   +D  F   L + E  +++MFYAPWCG CK  KP F  AA  MA+ K     G++     F  I +   +TG+P F YF  GK   N + S   +  D V ++ NP +P+       W       A+  L   +F Q+ V      LVMFY+PWCGHC  +KP +  AA  L     +   ++AAVDAT    LA ++ + GFPT+ +F    +       R+ D I  ++
Sbjct:  108 GTSKLMHYKDGEFHVEYDRAETFKSLVAFMYDPTGDPL-----WEEEPDAKDVVHVHSDKEFRLLLKKEERPILMMFYAPWCGVCKRMKPVFQEAAT-MAK-KTYVLAGMNVHPAEFDGIKSDYNVTGYPTFCYFEKGKFRFNYQ-SYGAQAKDIVEWLKNPESPKPTVPEVAWSETDS--AVFHLTDEDF-QDFVDKHPNVLVMFYAPWCGHCKKLKPDYDEAAKILNNEEENSPGVLAAVDATIHRALAERFAIKGFPTMKFFQDGEEKYTVSDLRSKDKILSWI 383          

HSP 3 Score: 58.5362 bits (140), Expect = 2.653e-9
Identity = 42/157 (26.75%), Postives = 62/157 (39.49%), Query Frame = 1
Query:  466 VDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNN-FVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAA---VDATTETHLAAQYKVSGFPTLVYF 924
            VDC +     +C    +      +  +Y     + EY         VAFM +P    L     W   P  + +V +  +  F   +       L+MFY+PWCG C  MKP F  AA    T+     + A   V       + + Y V+G+PT  YF
Sbjct:   88 VDCGNSEGRKLCKKMKVEPGGTSKLMHYKDGEFHVEYDRAETFKSLVAFMYDPTGDPL-----WEEEPDAKDVVHVHSDKEFRLLLKKEERPILMMFYAPWCGVCKRMKPVFQEAA----TMAKKTYVLAGMNVHPAEFDGIKSDYNVTGYPTFCYF 235          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Sea Lamprey
Match: pdia5 (protein disulfide isomerase family A, member 5 [Source:ZFIN;Acc:ZDB-GENE-030521-5])

HSP 1 Score: 159.458 bits (402), Expect = 1.311e-42
Identity = 102/340 (30.00%), Postives = 165/340 (48.53%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEG-DNSKEALIKFVHNPTQPPPQKD-VPWSEETNE-IDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATT--ETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHS 1005
            MFYAPWCG CK + P F  AAT LK   +  G+N      D +KQ F ITGYP+   I+ G  +F +E    +K+ ++ ++ NP  P P  + VPWS++ +  +  LT + F  +L  H S +V+FYAPWC   +  +P++ +AA  +        +       +   +  + G+T  P   YF+ G+   N   S +R  +  + F+ NP +PQ  +   W + P   ++  L   + +++ +  T  ALVMFY PWC H       F  AA +L+      L  A+D +    + +  Q  V  +PT  Y+S      +Y G R +     +M ++  
Sbjct:  197 MFYAPWCGVCKTLMPAFQEAATELKETHVLAGMNLHAPEFDGIKQDFRITGYPTFAYIEKGRHLFNFENYQATKQDIVSWLLNPRPPRPPAEMVPWSQDPDTLVHHLTASTFGPFLGTHPSTLVLFYAPWCPVSRKVRPEYEAAAAILNPRPDSPGVLAAVDGATEVGLVEAYGVTTLPSLYYFHEGRPLYNLPMSHDR--NTLLTFLRNPQDPQ-SSELPWEQRPS--SVHHLTSRD-LRDFLKKTKHALVMFYVPWCPHSQQAMLHFTGAAEQLKEDRKMGL-GAIDCSKAGNSEICGQEGVQEYPTFRYYSYGRALERYTGPRGESDFVNYMRRQRG 529          

HSP 2 Score: 101.679 bits (252), Expect = 5.394e-23
Identity = 76/253 (30.04%), Postives = 122/253 (48.22%), Query Frame = 1
Query:  175 QDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYL-DQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARR-HWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPS-CLIAAVDATTETHLAAQYKVSGFPTLVYF 924
            +DG    +Y    + +++  F+ +P   P  +D P + +   +   TD  F   + ++   + +MFYAPWCG CK   P F  AA ++ E   +A  G++     F  I     ITG+P F Y   G++  N E + +  + D V+++ NP  P+  A    W + P    +  L  + F   + +H S  LV+FY+PWC     ++P +  AA  L     S  ++AAVD  TE  L   Y V+  P+L YF
Sbjct:  135 RDGAFHIEYTRPETFKSMTAFLRDPLGAPLWEDSPSARDVKHLT--TDQEFRTLVKNEARPIFIMFYAPWCGVCKTLMPAFQEAATELKETHVLA--GMNLHAPEFDGIKQDFRITGYPTFAYIEKGRHLFNFE-NYQATKQDIVSWLLNPRPPRPPAEMVPWSQDPD-TLVHHLTASTFGPFLGTHPS-TLVLFYAPWCPVSRKVRPEYEAAAAILNPRPDSPGVLAAVDGATEVGLVEAYGVTTLPSLYYF 380          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Sea Lamprey
Match: txndc5 (thioredoxin domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1951])

HSP 1 Score: 140.198 bits (352), Expect = 1.132e-36
Identity = 92/352 (26.14%), Postives = 163/352 (46.31%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAA---TTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKF----------VHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHE---AIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
            MF+APWCG+C++++  +         +     ++    D +          + GYP++ L + G K   Y+G    + L  +          VH  ++ P   D+P  E  + +  LT  +F E++ +    I  F+APWCGHCKA  P +   A+    + KV    VDCT  +  DIC    + G+P   +F  G+     +Y  +R+ D    F+      + +     ++    E   ++++L +NNF   +    +   V FY+PWCGHC  + P++ + A K  + L    IA VD T+E  L ++  V G+PTL+ +       ++ G R  +A+  +++ +  D
Sbjct:   63 MFFAPWCGHCQKLQSTWNTLGDKYNEMPEPPAYVA-KVDCTMHAQTCSDHGVKGYPTLKLFKPGQKSILYQGQRDLDTLESWMLQTLNEDAGVHEESERP-SPDIP--EPQHGLYELTSGSFKEHVAEGYHFI-KFFAPWCGHCKALIPAWEQLASTFEYSGKVKIAKVDCT--AHQDICNENQVRGYPTLLWFKDGEKVD--QYRGKRDLDSLKVFVDTQIQIEPEDEVVTQQAGDEEEASSVLVLNENNFDATVADGIT--FVKFYAPWCGHCKNLAPTWEDLAKKEFSGLSKVTIAKVDCTSEAQLCSKQHVRGYPTLLLYVGGKQVGEHEGTRNLEALHSYVLSRARD 403          

HSP 2 Score: 93.2041 bits (230), Expect = 1.022e-20
Identity = 58/218 (26.61%), Postives = 103/218 (47.25%), Query Frame = 1
Query:  358 IVMFYAPWCGHCKATKPKFTSAANQMAEN-KKVAFIG-VDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRR----IP-GHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
             +MF+APWCGHC+  +  + +  ++  E  +  A++  VDCT    A  C+  G+ G+P  + F  G+ +    Y  +R+ D   ++M    N          R    IP     +  L   +F +++        + F++PWCGHC A+ P++   A+  +       IA VD T    +  + +V G+PTL++F       +Y G+R  D++  F+
Sbjct:   61 FIMFFAPWCGHCQKLQSTWNTLGDKYNEMPEPPAYVAKVDCT--MHAQTCSDHGVKGYPTLKLFKPGQKSIL--YQGQRDLDTLESWMLQTLNEDAGVHEESERPSPDIPEPQHGLYELTSGSFKEHVAE--GYHFIKFFAPWCGHCKALIPAWEQLASTFE-YSGKVKIAKVDCTAHQDICNENQVRGYPTLLWFKDGEKVDQYRGKRDLDSLKVFV 271          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Sea Lamprey
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 130.183 bits (326), Expect = 4.090e-32
Identity = 78/239 (32.64%), Postives = 120/239 (50.21%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKK-VAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKK 999
            +E N +  L D NF  ++   ++V++ FYAPWCGHCK    ++   A ++AEN   +    VD T      +     ++G+P  +    G+     +Y  +R +D  +A +   A+P       W+  P  EA++ L ++NF   IV+     LV FY+PWCGHC  + P +  AA +L    P   +A VDAT E+ L  ++ VSG+PTL  F   G    Y G R    I   MI++
Sbjct:   53 KEENGVLILKDLNFDFFVAGKDTVLLEFYAPWCGHCKEFASEYEKIAKELAENDPPIPVAKVDAT--VAVHLAERFSVSGYPTIKILKKGQAV---DYDGDRTQDAIIAKVKEVASPD------WK--PPPEAVLTLTESNF-DEIVNDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKNTPPIPLAKVDATVESELGKRFGVSGYPTLKLFR-KGKAYDYNGPREQYGIVSHMIEQ 276          

HSP 2 Score: 119.783 bits (299), Expect = 9.144e-29
Identity = 71/240 (29.58%), Postives = 120/240 (50.00%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENK-KVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQN 717
            FYAPWCG+CK+   ++   A  L      I +   D +    L + F+++GYP++ +++ G  V  Y+GD +++A+I  V     P       W      +  LT++NF E ++  + ++V FYAPWCGHCK   P++  AA ++++N   +    VD T ES  ++    G++G+P  + F  GK     +Y+  RE+   V+ M   A P     +  +++           N FVQN
Sbjct:   80 FYAPWCGHCKEFASEYEKIAKELAENDPPIPVAKVDATVAVHLAERFSVSGYPTIKILKKGQAV-DYDGDRTQDAIIAKVKEVASP------DWKPPPEAVLTLTESNFDEIVNDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKNTPPIPLAKVDATVES--ELGKRFGVSGYPTLKLFRKGKAY---DYNGPREQYGIVSHMIEQAGPASQELKSMKQL-----------NGFVQN 296          

HSP 3 Score: 65.0846 bits (157), Expect = 2.849e-11
Identity = 36/112 (32.14%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  682 IVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDW---VKYM-GERTDDAITEFMIKKHS 1005
            + ++    F Q ++ ++   L+ FY+PWCGHC +++P + +   K +      +IA +DAT        YK  GFPT +YFSP+G     +K+  G R  +++++F I+KH+
Sbjct:  522 VKVVVGRTFEQMVLDNSKDVLIEFYAPWCGHCKSLEPIYKDLGKKYKG-HKGLVIAKMDATVNDIPHDSYKAEGFPT-IYFSPSGAKDRPIKFADGSRDLESLSKF-IEKHA 630          

HSP 4 Score: 48.9062 bits (115), Expect = 2.702e-6
Identity = 23/84 (27.38%), Postives = 41/84 (48.81%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDG--NKVFKY-EGDNSKEALIKFVHN 246
            FYAPWCG+CK ++P +       KG    +    D +  D    ++   G+P+++    G  ++  K+ +G    E+L KF+  
Sbjct:  545 FYAPWCGHCKSLEPIYKDLGKKYKGHKGLVIAKMDATVNDIPHDSYKAEGFPTIYFSPSGAKDRPIKFADGSRDLESLSKFIEK 628          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Sea Lamprey
Match: dnajc10 (DnaJ (Hsp40) homolog, subfamily C, member 10 [Source:ZFIN;Acc:ZDB-GENE-070327-1])

HSP 1 Score: 114.775 bits (286), Expect = 6.479e-27
Identity = 87/352 (24.72%), Postives = 145/352 (41.19%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQH---ESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMG-----ERTDDAITEFMIKKHSDIIRHEEAEK 1035
            F+APWC  C+ + P+   A+  L G+  F  I  D +    +     I  YP+  +    N + +Y G +S E L+++V +   P              +  LT   +   + Q    E  +V FYAPWCG C+A  P++   A  ++   +V    VDC  +    +C SE +  +P  R F     +S+              F  N  +   ++ + W      +    L    F   ++      LV FY+PWCGHC    P F  AA  L+  L +     V+   + H+     + G+PT++++   G   +  G      R    I E ++++  DI  HE  +K
Sbjct:  476 FFAPWCPPCRALLPELRKASRLLTGQLKFGTI--DCTIHSKICNLHGIHAYPTTLIFNQSN-IHEYNGQHSAEQLMEYVQDLMSP-------------SVVTLTPETYVSLVKQRKRDEVWMVDFYAPWCGPCQALLPEWKRMARMLSGMVQVG--SVDC--QKHHALCQSEMVHAYPEIRLFPMNPASSDK------------YFKYNGWHRDANSLKGWAFGYLPQTAEDLTPQKFNSEVLEGMEHWLVDFYTPWCGHCQIFAPEFEIAARLLKGKLRT---GKVNCQNDPHVCQSAGIHGYPTVMFYQYQGRSKRSTGGEEINSRNGKDIAENLLRRVGDIPLHENTKK 792          

HSP 2 Score: 68.1662 bits (165), Expect = 3.468e-12
Identity = 51/213 (23.94%), Postives = 87/213 (40.85%), Query Frame = 1
Query:  349 ESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVM--FYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPN----GDWVKYMGERTD 969
            E  ++ F+APWC  C+A  P+   A+  +    ++ F  +DCT  S   IC   GI  +P    FN    ++  EY+ +   +  + ++ +  +P               ++V L    +V  +       + M  FY+PWCG C A+ P +   A  L  ++    + +VD      L     V  +P +  F  N      + KY G   D
Sbjct:  470 EPWLIDFFAPWCPPCRALLPELRKASRLL--TGQLKFGTIDCTIHS--KICNLHGIHAYPTTLIFN---QSNIHEYNGQHSAEQLMEYVQDLMSP---------------SVVTLTPETYVSLVKQRKRDEVWMVDFYAPWCGPCQALLPEWKRMARMLSGMVQ---VGSVDCQKHHALCQSEMVHAYPEIRLFPMNPASSDKYFKYNGWHRD 657          

HSP 3 Score: 56.225 bits (134), Expect = 1.466e-8
Identity = 53/223 (23.77%), Postives = 86/223 (38.57%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNI--VSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCL-IAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWV 945
            ++  E+  L    F   +   E   V FY+P C HC    P +   A +M    +VA   V+C D     +C S+GI  +P    +  G      +YS +R +DD V F+      +               +  L   NFV        T    ++ Y    G C++      +   KL  +L     +  VD +T+ H+ +Q  +    T+ Y  P G W+
Sbjct:  128 DDDAEVLTLDRGEFDAAVSSGELFFVNFYSPRCSHCHELAPMWREFAKEMDGVIRVA--AVNCGDNRM--MCRSKGIGSYPSLYVYRAGMQP--VKYSGDRSKDDLVRFVMKYVTSK---------------VTELWAGNFVNAFEQAGSTETGWLLSYCSDIGDCLSQ-----HTRRKLAGMLDGMANVGWVDCSTQKHICSQMNIEESKTVFY--PPGLWL 322          

HSP 4 Score: 49.6766 bits (117), Expect = 1.530e-6
Identity = 45/178 (25.28%), Postives = 76/178 (42.70%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGIN-GDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWC---GHC--KATKPKFTSAANQMAENKKVAFIG-VDCTDESFADICTSEGI 516
            FY+P C +C ++ P +   A  + G      +N GD      + ++  I  YPS+++ + G +  KY GD SK+ L++FV                 T+++  L   NF    +Q  S    +   +C   G C  + T+ K     + MA       +G VDC+ +    IC+   I
Sbjct:  155 FYSPRCSHCHELAPMWREFAKEMDGVIRVAAVNCGDNRM---MCRSKGIGSYPSLYVYRAGMQPVKYSGDRSKDDLVRFVMKYV-------------TSKVTELWAGNFVNAFEQAGSTETGWLLSYCSDIGDCLSQHTRRKLAGMLDGMAN------VGWVDCSTQKH--ICSQMNI 308          

HSP 5 Score: 48.1358 bits (113), Expect = 5.449e-6
Identity = 28/107 (26.17%), Postives = 52/107 (48.60%), Query Frame = 1
Query:  682 IVILEKNNFVQNIVSHTSGAL--VMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIK 996
            ++ L++  F   +   +SG L  V FYSP C HC  + P +   A ++  ++    +AAV+      +     +  +P+L  +      VKY G+R+ D +  F++K
Sbjct:  133 VLTLDRGEFDAAV---SSGELFFVNFYSPRCSHCHELAPMWREFAKEMDGVI---RVAAVNCGDNRMMCRSKGIGSYPSLYVYRAGMQPVKYSGDRSKDDLVRFVMK 233          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Yeast
Match: PDI1 (Protein disulfide isomerase; multifunctional oxidoreductase of the ER lumen, essential for disulfide bond formation in secretory and cell-surface proteins, processing of non-native disulfide bonds; Ero1p activator; complexes with exomannosidase, Mnl1p to facilitate the recognition of misfolded glycoproteins and the trimming of glycan Man8GlcNAc2 to Man7GlcNAc2 on substrates, thereby accelerating ERAD; PDI1 has a paralog, EUG1, that arose from the whole genome duplication [Source:SGD;Acc:S000000548])

HSP 1 Score: 77.411 bits (189), Expect = 1.620e-15
Identity = 39/125 (31.20%), Postives = 63/125 (50.40%), Query Frame = 1
Query:  265 QKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQL 639
            Q++    E++  +   TD+ F EY+  H+ V+  F+APWCGHCK   P++  AA  + E K +    +DCT+    D+C    I GFP  + F      ++ +Y   R  +  V FM   + P +
Sbjct:   23 QQEAVAPEDSAVVKLATDS-FNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVE-KNITLAQIDCTENQ--DLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAV 143          

HSP 2 Score: 73.9442 bits (180), Expect = 2.238e-14
Identity = 42/113 (37.17%), Postives = 62/113 (54.87%), Query Frame = 1
Query:  667 PGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYF--SPNGDWVKYMGERTDDAITEFMIKK 999
            P   A+V L  ++F + I SH    L  F++PWCGHC  M P +V AA  L  +  +  +A +D T    L  ++ + GFP+L  F  S   + + Y G RT +AI +FMIK+
Sbjct:   29 PEDSAVVKLATDSFNEYIQSHDL-VLAEFFAPWCGHCKNMAPEYVKAAETL--VEKNITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQ 138          

HSP 3 Score: 68.1662 bits (165), Expect = 1.323e-12
Identity = 35/87 (40.23%), Postives = 50/87 (57.47%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPS--VFLIQDGNKVFKYEGDNSKEALIKFVHNPTQP 258
            F+APWCG+CK M P++  AA TL  K+I +    D +   DL    NI G+PS  +F   D N    YEG  + EA+++F+   +QP
Sbjct:   56 FFAPWCGHCKNMAPEYVKAAETLVEKNITLA-QIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQP 141          

HSP 4 Score: 55.4546 bits (132), Expect = 1.549e-8
Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  742 LVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNG---DWVKYMGERTDDAITEFM 990
            LV++Y+PWCGHC  + P++   A+         LIA +D T          + G+PT+V + P G   + V Y G R+ D++ +F+
Sbjct:  398 LVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTEND--VRGVVIEGYPTIVLY-PGGKKSESVVYQGSRSLDSLFDFI 480          

HSP 5 Score: 50.8322 bits (120), Expect = 3.542e-7
Identity = 28/104 (26.92%), Postives = 45/104 (43.27%), Query Frame = 1
Query:  340 DQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIG-VDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDAR 648
            D  + V+V++YAPWCGHCK   P +   A+  A       I  +D T+     +     I G+P    +  GK + +  Y   R  D    F+    +  +D +
Sbjct:  392 DPKKDVLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVV----IEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGK 491          

HSP 6 Score: 50.447 bits (119), Expect = 4.796e-7
Identity = 26/82 (31.71%), Postives = 43/82 (52.44%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNK--VFKYEGDNSKEALIKFV 240
            ++YAPWCG+CK++ P +   A T    +  + I   L  T++  +   I GYP++ L   G K     Y+G  S ++L  F+
Sbjct:  400 LYYAPWCGHCKRLAPTYQELADTYANATSDVLI-AKLDHTENDVRGVVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFI 480          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Yeast
Match: MPD1 (Member of the protein disulfide isomerase (PDI) family; interacts with and inhibits the chaperone activity of Cne1p; MPD1 overexpression in a pdi1 null mutant suppresses defects in Pdi1p functions such as carboxypeptidase Y maturation [Source:SGD;Acc:S000005814])

HSP 1 Score: 59.6918 bits (143), Expect = 3.797e-10
Identity = 29/66 (43.94%), Postives = 40/66 (60.61%), Query Frame = 1
Query:  739 ALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAV--DATTETHLAAQYKVSGFPTLVYFSP 930
            +LV FY+PWCGHC  +  +F  AA +L  ++    +AAV  D      L A+Y V+GFPTL+ F P
Sbjct:   50 SLVEFYAPWCGHCKKLSSTFRKAAKRLDGVVQ---VAAVNCDLNKNKALCAKYDVNGFPTLMVFRP 112          

HSP 2 Score: 52.373 bits (124), Expect = 9.183e-8
Identity = 23/75 (30.67%), Postives = 39/75 (52.00%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEAL 228
            FYAPWCG+CK++   F  AA  L G      +N DL+    L   +++ G+P++ + +          DN+K++ 
Sbjct:   54 FYAPWCGHCKKLSSTFRKAAKRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSF 128          

HSP 3 Score: 49.6766 bits (117), Expect = 6.515e-7
Identity = 23/62 (37.10%), Postives = 30/62 (48.39%), Query Frame = 1
Query:  358 IVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYF 543
            +V FYAPWCGHCK     F  AA ++    +VA   V+C       +C    + GFP    F
Sbjct:   51 LVEFYAPWCGHCKKLSSTFRKAAKRLDGVVQVA--AVNCDLNKNKALCAKYDVNGFPTLMVF 110          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Yeast
Match: EUG1 (Protein disulfide isomerase of the endoplasmic reticulum lumen; EUG1 has a paralog, PDI1, that arose from the whole genome duplication; function overlaps with that of Pdi1p; may interact with nascent polypeptides in the ER [Source:SGD;Acc:S000002926])

HSP 1 Score: 58.5362 bits (140), Expect = 1.695e-9
Identity = 28/102 (27.45%), Postives = 51/102 (50.00%), Query Frame = 1
Query:  310 LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFM 615
            LT+  F  +++ H  V+V F+APWC H +  +P    AA+ + E+  V  + +DC  E+ + +C  + I  +P  + F  G+      Y   +  D+   +M
Sbjct:   38 LTEKKFKSFIESHPLVLVEFFAPWCLHSQILRPHLEEAASILKEH-NVPVVQIDC--EANSMVCLQQTINTYPTLKIFKNGRIFDGQVYRGVKITDEITQYM 136          

HSP 2 Score: 54.299 bits (129), Expect = 3.730e-8
Identity = 38/121 (31.40%), Postives = 59/121 (48.76%), Query Frame = 1
Query:  643 ARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNG---DWVKYMGERTDDAITEFMIK 996
            A    R  PG + +V+ EK  F   I SH    LV F++PWC H   ++P    AA+ L+    +  +  +D    + +  Q  ++ +PTL  F  NG   D   Y G +  D IT++MI+
Sbjct:   23 AENSARATPGSDLLVLTEKK-FKSFIESHPL-VLVEFFAPWCLHSQILRPHLEEAASILKE--HNVPVVQIDCEANSMVCLQQTINTYPTLKIFK-NGRIFDGQVYRGVKITDEITQYMIQ 138          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Yeast
Match: EPS1 (ER protein with chaperone and co-chaperone activity; involved in retention of resident ER proteins; has a role in recognizing proteins targeted for ER-associated degradation (ERAD), member of the protein disulfide isomerase family [Source:SGD;Acc:S000001267])

HSP 1 Score: 46.9802 bits (110), Expect = 6.645e-6
Identity = 34/110 (30.91%), Postives = 47/110 (42.73%), Query Frame = 1
Query:  226 LIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKK---VAFIGVDCTDESFADICTSEGITGFPIFRYFN 546
            L+KF     +PP     P          L   NF E L +   +I  FY+P+C HCK   P +     +  E  K   + F  V+C +   AD+C  E I  FP  R +N
Sbjct:   19 LLKFTIAAAEPPEGFPEP----------LNPTNFKEELSKGLHIID-FYSPYCPHCKHLAPVWMETWEEFKEESKTLNITFSQVNCIES--ADLCGDENIEYFPEIRLYN 115          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Nematostella
Match: EDO41376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4E6])

HSP 1 Score: 205.297 bits (521), Expect = 1.667e-59
Identity = 119/338 (35.21%), Postives = 178/338 (52.66%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQK--DVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFI-GVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSL---EREEDDFVAFMTN--PANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            MFYAPWCGYCK+ KP+FAAAAT  K +++  G++ D      ++  +NITG+P+    + G   +KY G + K+AL++++ +P+   P K  + PWS+  +E+  L D  F +++ ++ SV+VMFYAPWCGHCKA KP++  AA  + E +    +  VD T E  A +     + G+P       G +  + E++    ER+ D  V FM +           + W  IP    +  L    F ++ V      LVMFY+PWCGHC   KP  ++AA K          AAVD T E  +  Q+ V G+PT  YF+   +  KY   R      +FM
Sbjct:  141 MFYAPWCGYCKRFKPEFAAAATEHKDEAVLAGMDVDTEDGYSVRVHYNITGFPTTIYFELGQPKYKYSGKHEKDALVQWMKDPSAVAPVKEDEKPWSDTPSEVVHLRDDMFDDFVAKNPSVLVMFYAPWCGHCKAMKPEYVDAAQTLKEQEIPGVLAAVDATKE--AALGKRFKVEGYPT------GTSYMDGEFAFDVNERKGDSIVNFMKDPKEPPRPPPPEQEWSEIPSE--VYHLSDTTF-KSFVKKKKHVLVMFYAPWCGHCKKAKPELMSAA-KHHKDKNKIAYAAVDCTKEMAVCQQFGVEGYPTFRYFNYGKNDFKYTSGREAKDFIQFM 466          

HSP 2 Score: 159.458 bits (402), Expect = 1.021e-42
Identity = 105/322 (32.61%), Postives = 168/322 (52.17%), Query Frame = 1
Query:   49 FAAAATTLKGKSIFIGIN-GDLSTTDDLKQAFNITGYP-SVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEE--TNEIDFLTDANFYEYLDQHES--VIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPA--NPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
                A  +KGK     IN GD   +  L + F ++  P ++   ++G+    Y+  ++ ++++ F++NPT      D PW EE  ++++  L  A     L   E   V++MFYAPWCG+CK  KP+F +AA +  +   +A  G+D   E    +     ITGFP   YF  G+     +YS + E+D  V +M +P+   P  +  + W   P     V+  +++   + V+     LVMFY+PWCGHC AMKP +V+AA  L+      ++AAVDAT E  L  ++KV G+PT   +  +G++   + ER  D+I  FM
Sbjct:   38 LGEVAMAIKGKGTVAFINCGD---SKKLCKKFKVSPKPLALKHYKEGDFNKDYDRLDTFKSMMTFMNNPTG-----DAPWEEEPGSSDVVHLEKAGELSKLLTREKKPVLIMFYAPWCGYCKRFKPEFAAAATEHKDEAVLA--GMDVDTEDGYSVRVHYNITGFPTTIYFELGQ--PKYKYSGKHEKDALVQWMKDPSAVAPVKEDEKPWSDTPSE---VVHLRDDMFDDFVAKNPSVLVMFYAPWCGHCKAMKPEYVDAAQTLKEQEIPGVLAAVDATKEAALGKRFKVEGYPTGTSYM-DGEFAFDVNERKGDSIVNFM 343          

HSP 3 Score: 62.003 bits (149), Expect = 2.935e-10
Identity = 30/87 (34.48%), Postives = 44/87 (50.57%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPP 261
            MFYAPWCG+CK+ KP+  +AA   K K+       D +    + Q F + GYP+      G   FKY      +  I+F+ +P + P
Sbjct:  387 MFYAPWCGHCKKAKPELMSAAKHHKDKNKIAYAAVDCTKEMAVCQQFGVEGYPTFRYFNYGKNDFKYTSGREAKDFIQFMDDPREGP 473          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Nematostella
Match: EDO41377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4E7])

HSP 1 Score: 166.392 bits (420), Expect = 3.150e-46
Identity = 106/327 (32.42%), Postives = 169/327 (51.68%), Query Frame = 1
Query:   19 CGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVP-WSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMA-ENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            C +C++MKP F  AA  L GK +   +   D + + +     +I GYP++  I++G   FKY G  + EAL+ F+ +P +P P      WS++ +++ FLTD +  E++  HE+V+VM++APWCGHC   KP +  AA  +  E+       VDCT     D+     + G+P  + +  GK     EY  +R E D V FM   +N    A            +  L+ ++F    +++T   LVMFY+PWCGHC   KP +  AA   +   P+ + A +D T    +  + +V+G+PTL Y+      V+Y G+R  + +  FM
Sbjct:   26 CPHCQKMKPVFEKAAKQL-GKDVKGALAAVDCTESKNTCNQRDIKGYPTLQYIREGEFQFKYTGRRTAEALVSFMKDPKKPAPPPPPADWSKDDSKVVFLTDESHDEFIKSHENVLVMYFAPWCGHCNEMKPNYYKAAQVLHDEDANCNLAAVDCTKHK--DVAKKVALAGYPTVKLYKNGKVA--KEYEGDRSEKDLVLFMRTASNTAKAASAE----EDSSLVKQLDGSDF-WGYLNNTEHVLVMFYAPWCGHCKNAKPKYEKAAETFKD-QPNRVFAKLDCTKFGDVCDKEEVNGYPTLRYYLYGKFVVEYDGDRVTEDLISFM 341          

HSP 2 Score: 152.525 bits (384), Expect = 2.890e-41
Identity = 78/215 (36.28%), Postives = 117/215 (54.42%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLD 642
            M++APWCG+C +MKP +  AA  L  +     +   D +   D+ +   + GYP+V L ++G    +YEGD S++ L+ F+   T     K     E+++ +  L  ++F+ YL+  E V+VMFYAPWCGHCK  KPK+  AA    +     F  +DCT   F D+C  E + G+P  RY+ YGK     EY  +R  +D ++FM  P  P  D
Sbjct:  142 MYFAPWCGHCNEMKPNYYKAAQVLHDEDANCNLAAVDCTKHKDVAKKVALAGYPTVKLYKNGKVAKEYEGDRSEKDLVLFMR--TASNTAKAASAEEDSSLVKQLDGSDFWGYLNNTEHVLVMFYAPWCGHCKNAKPKYEKAAETFKDQPNRVFAKLDCT--KFGDVCDKEEVNGYPTLRYYLYGKFV--VEYDGDRVTEDLISFMEEPPLPLSD 350          

HSP 3 Score: 69.3218 bits (168), Expect = 9.167e-13
Identity = 35/97 (36.08%), Postives = 51/97 (52.58%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEE 291
            MFYAPWCG+CK  KP++  AA T K +   +    D +   D+     + GYP++     G  V +Y+GD   E LI F+  P  P P  D+P  ++
Sbjct:  262 MFYAPWCGHCKNAKPKYEKAAETFKDQPNRVFAKLDCTKFGDVCDKEEVNGYPTLRYYLYGKFVVEYDGDRVTEDLISFMEEP--PLPLSDIPKDQQ 356          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Nematostella
Match: EDO32930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM8])

HSP 1 Score: 149.058 bits (375), Expect = 3.091e-38
Identity = 90/260 (34.62%), Postives = 137/260 (52.69%), Query Frame = 1
Query:  286 EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKK-VAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM---IKKHSDIIRHEEAEKLFQEEK 1053
            +E +++  L   NF   ++++  ++V FYAPWCGHCK+  P++  AA +M  N   V F  +D T  S  DI     ++G+P  + F  G   +  EY   REE   V +M   ++P      +W+  P   A + L K NF + +V+  S  LV F++PWCGHC  + P +  AA +LQ   P   +A VDAT E+ LA +Y+V G+PTL  F   G   +Y G+R    I  +M   +   S I+   +A + F +EK
Sbjct:   58 KEEDDVLVLNSKNFDRVIEENNIILVEFYAPWCGHCKSLAPEYAKAAKKMKLNDPPVPFAKMDATVAS--DIAQRFDVSGYPTLKIFRKG---TPYEYEGPREESGIVEYMKKQSDP------NWK--PPPVAALTLTKENFTE-VVNRESLMLVEFFAPWCGHCKQLAPEYEKAAQELQKNDPPIPLAIVDATIESELAQKYEVQGYPTLKVFR-KGKATEYKGQRDQYGIASYMRSQVGPSSRILSSLKAVQDFMKEK 302          

HSP 2 Score: 119.398 bits (298), Expect = 2.277e-28
Identity = 82/318 (25.79%), Postives = 142/318 (44.65%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGI-NGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENK-KVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKY 951
            FYAPWCG+CK + P++A AA  +K     +     D +   D+ Q F+++GYP++ + + G   ++YEG   +  +++++        Q D  W         LT  NF E +++   ++V F+APWCGHCK   P++  AA ++ +N   +    VD T ES  ++     + G+P  + F  GK T   EY  +R++    ++M +   P               +  IL     VQ+ +       +M +  + G    M  S++ A N ++   P       DA  + H   +       ++V F P     KY
Sbjct:   85 FYAPWCGHCKSLAPEYAKAAKKMKLNDPPVPFAKMDATVASDIAQRFDVSGYPTLKIFRKGTP-YEYEGPREESGIVEYMKK------QSDPNWKPPPVAALTLTKENFTEVVNRESLMLVEFFAPWCGHCKQLAPEYEKAAQELQKNDPPIPLAIVDATIES--ELAQKYEVQGYPTLKVFRKGKAT---EYKGQRDQYGIASYMRSQVGP---------------SSRILSSLKAVQDFMKEKDDVTIMGF--FDGEDDKMLESYLEANNDVRDDYP--FAHTFDAAAKKHFGIKKS-----SIVLFQPERFLSKY 366          

HSP 3 Score: 61.2326 bits (147), Expect = 7.358e-10
Identity = 32/105 (30.48%), Postives = 49/105 (46.67%), Query Frame = 1
Query:  340 DQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNS-EYSLEREEDDFVAFMTNPANPQLDARR 651
            D  + V++ FYAPWCGHCKA +P F         +K +    +D T     D+ ++  + GFP   YF   K+  N  ++   RE  D + F+   A   L   +
Sbjct:  541 DPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRNDKNIVIAKIDATAN---DVPSTYAVEGFPTI-YFATSKDKKNPIKFDGGRELKDLIKFVEEKATVSLSKEK 641          

HSP 4 Score: 60.077 bits (144), Expect = 1.840e-9
Identity = 35/122 (28.69%), Postives = 64/122 (52.46%), Query Frame = 1
Query:  676 EAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDW---VKYMGERTDDAITEFMIKKHSDIIRHEEAE 1032
            E + ++    F + +       L+ FY+PWCGHC A++P+F       +    + +IA +DAT    + + Y V GFPT +YF+ + D    +K+ G R    + +F+ +K +  +  E+A+
Sbjct:  525 EPVTVVVGKTFDEIVNDPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRN-DKNIVIAKIDATA-NDVPSTYAVEGFPT-IYFATSKDKKNPIKFDGGRELKDLIKFVEEKATVSLSKEKAK 643          

HSP 5 Score: 52.7582 bits (125), Expect = 3.529e-7
Identity = 24/82 (29.27%), Postives = 42/82 (51.22%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLI--QDGNKVFKYEGDNSKEALIKFVH 243
            FYAPWCG+CK ++P F       +     +    D +T +D+   + + G+P+++    +D     K++G    + LIKFV 
Sbjct:  550 FYAPWCGHCKALEPTFKKLGKHFRNDKNIVIAKID-ATANDVPSTYAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVE 630          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Nematostella
Match: EDO47340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMG9])

HSP 1 Score: 130.183 bits (326), Expect = 2.863e-33
Identity = 75/231 (32.47%), Postives = 119/231 (51.52%), Query Frame = 1
Query:  310 LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSP-NGDWVKYMGERTDDAITEFMIKK 999
            LT  NF E ++  +  +V FYAPWCGHCK   P +        ++  V    VD   +   D+ +   + GFP  +YF  G +T+  EY+  R+ +DF+ F+      +   R     IP   A+  L+++NF + + +  +  LV F++PWCGHC  + P +       +   P+C+IA VDA   + L  +Y VSG+PTL +FS  N D  +Y   R + +  +FM +K
Sbjct:   27 LTKDNFDEVVNGEKFALVEFYAPWCGHCKQLAPTYEQLGEAYTQSSDVIIAKVDADGDR--DLGSRFDVKGFPTIKYFPKG-STTPEEYNGGRDINDFIKFIEE----KTGVRGRVPVIP--SAVADLDESNFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVYEKVGEAFKN-EPNCVIAKVDADAHSALGQKYGVSGYPTLKFFSKTNKDGEEYSSGRDEQSFVDFMNEK 247          

HSP 2 Score: 92.8189 bits (229), Expect = 1.663e-20
Identity = 59/206 (28.64%), Postives = 92/206 (44.66%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKV-FKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHE-SVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFM 615
            FYAPWCG+CKQ+ P +          S  I    D     DL   F++ G+P++     G+    +Y G       IKF+   T    +  V  S   +    L ++NF + +   + +V+V F+APWCGHCK   P +                 VD   ++ + +    G++G+P  ++F+   N    EYS  R+E  FV FM
Sbjct:   46 FYAPWCGHCKQLAPTYEQLGEAYTQSSDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDINDFIKFIEEKTGVRGRVPVIPSAVAD----LDESNFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVYEKVGEAFKNEPNCVIAKVDA--DAHSALGQKYGVSGYPTLKFFSK-TNKDGEEYSSGRDEQSFVDFM 244          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Nematostella
Match: EDO34590 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNX3])

HSP 1 Score: 129.028 bits (323), Expect = 7.825e-33
Identity = 97/355 (27.32%), Postives = 143/355 (40.28%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTL-KGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVP---WSEETNEIDFLTDANFYEYLDQHESV---IVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDF-------VAFMTNPANPQLDARRHWRRIP-------GHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKH 1002
            MFY PWC +CK M P + A      K K        D ++  +L    NI  YP++ L  DG+ + +Y G  + E +  FV      P  K       S     +  LT   F    D+H  +    V FYAPWC HC    P +   A    +N  +    +DCT  +    C+  G+ GFP  + F  G+      YS  R  +D        +A     +    D       +P         + I   + NN   +         V FY+PWC HC  + P +   ANK    +    IA VD T E  L   + ++G+PTL+ F       +Y G R  D++  F+++ H
Sbjct:    9 MFYGPWCEHCKNMMPAWEALGEQYSKEKRDLTIAKVDCTSDVNLCVKQNIRAYPTMKLYYDGD-IKRYTGRRNAEDMKVFVDKIVLKPEGKSKDSEGLSTSEAGVHILTKNTF----DKHIELGLHFVKFYAPWCIHCIKLAPIWERLAEDFKDNADITISKIDCT--AHGSKCSQHGVNGFPTLKLFKNGREV--DRYSGMRSLEDLKNYVKLKIAEHGLLSTVTTDKSETAEEVPPTDTDMDAADLIKPYQLNNQNFDTTVSLGTTFVKFYAPWCRHCKILAPVWDQLANKCADQVAGPKIAKVDCTKEESLCQSFGINGYPTLMLFKDGVQKKEYSGNRDLDSLYRFIMQNH 354          

HSP 2 Score: 91.2781 bits (225), Expect = 5.628e-20
Identity = 57/212 (26.89%), Postives = 95/212 (44.81%), Query Frame = 1
Query:  361 VMFYAPWCGHCKATKPKFTSAANQMAENKK-VAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPA-NPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            VMFY PWC HCK   P + +   Q ++ K+ +    VDCT +   ++C  + I  +P  + +  G       Y+  R  +D   F+      P+  ++           + IL KN F ++I        V FY+PWC HCI + P +   A   +       I+ +D T      +Q+ V+GFPTL  F    +  +Y G R+ + +  ++
Sbjct:    8 VMFYGPWCEHCKNMMPAWEALGEQYSKEKRDLTIAKVDCTSD--VNLCVKQNIRAYPTMKLYYDG---DIKRYTGRRNAEDMKVFVDKIVLKPEGKSKDSEGLSTSEAGVHILTKNTFDKHI--ELGLHFVKFYAPWCIHCIKLAPIWERLAEDFKD-NADITISKIDCTAHGSKCSQHGVNGFPTLKLFKNGREVDRYSGMRSLEDLKNYV 211          

HSP 3 Score: 54.299 bits (129), Expect = 7.556e-8
Identity = 26/85 (30.59%), Postives = 42/85 (49.41%), Query Frame = 1
Query:  742 LVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIK 996
             VMFY PWC HC  M P++     +         IA VD T++ +L  +  +  +PT+  +  +GD  +Y G R  + +  F+ K
Sbjct:    7 FVMFYGPWCEHCKNMMPAWEALGEQYSKEKRDLTIAKVDCTSDVNLCVKQNIRAYPTMKLYY-DGDIKRYTGRRNAEDMKVFVDK 90          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Medaka
Match: pdia5 (protein disulfide isomerase family A member 5 [Source:NCBI gene;Acc:101175203])

HSP 1 Score: 189.119 bits (479), Expect = 2.091e-52
Identity = 123/361 (34.07%), Postives = 185/361 (51.25%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYE--GDNSKEALIKFVHNPTQPPPQ-KDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSE--GITGFPIFRYFNYGKNTSNSEYSLE--REEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATT-ETH-LAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQEEKK 1056
            MFYAPWCG CK+M+P F  AAT  KG+ +  G+N   S  D LKQ +++ GYP+    + G  ++ YE  G  +K+ +  ++ NP  P P+  +VPWSE  + +  LTD  F  +L++H + +VMFYAPWCGHCK  KP++  AA  +  NK     GV    ++       E   I+GFP  +YF  G+      Y+L   R ++  V +M NP  P       W   P   ++  L   +F +  +     ALVMFY+PWC HC    P F  AA   +      + AAVD T  + H +  Q  V G+PT  +++      +Y G+R +   T FM       +R  + EK+ + +++
Sbjct:  214 MFYAPWCGVCKRMQPIFQQAATEAKGQFVLAGMNVHPSEFDGLKQEYSVKGYPTFCYFEKGKFLYHYENYGATAKD-ITDWLKNPQPPQPKTPEVPWSEMDSAVFHLTDDTFDSFLEEHPAALVMFYAPWCGHCKKMKPEYDEAAEIL--NKDADSPGVLAAVDATVHKALGERFKISGFPTVKYFEKGEE----RYTLPHLRTKNMIVEYMHNPQAPP-PPELSWEDKPS--SVSHLGSEDF-REALKKKKHALVMFYAPWCPHCKNAVPHFTTAAELFKEDR-KIVFAAVDCTKGQNHEVCKQEGVEGYPTFNHYNYGKFVERYNGDRGEAGFTGFMRS-----LRGRDQEKVVKRKEE 557          

HSP 2 Score: 135.191 bits (339), Expect = 2.184e-33
Identity = 96/320 (30.00%), Postives = 151/320 (47.19%), Query Frame = 1
Query:   61 ATTLKGKSIFIGINGDLSTTDDLKQAFNI-----TGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHES-VIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHE---AIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPS-CLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
            A T+KG+     +N   S    L +   +      G   +   +DG    +Y    + ++++ F+ +P+ PP  ++ P +++   I+  T+  F + L + E  V++MFYAPWCG CK  +P F  AA +     +    G++     F  +     + G+P F YF  GK   + E +      D   ++ NP  PQ         +P  E   A+  L  + F   +  H + ALVMFY+PWCGHC  MKP +  AA  L     S  ++AAVDAT    L  ++K+SGFPT+ YF    +       RT + I E+M
Sbjct:  109 AQTVKGQGTIAWVNCGDSEGRKLCKKVKVDPSSKQGGIELLHYKDGTFHTEYNRPTTIKSMVAFLKDPSGPPLWEENPEAKDVVHIE--TEKEFRKLLKKEEKPVLMMFYAPWCGVCKRMQPIFQQAATEA--KGQFVLAGMNVHPSEFDGLKQEYSVKGYPTFCYFEKGKFLYHYE-NYGATAKDITDWLKNPQPPQPKT----PEVPWSEMDSAVFHLTDDTFDSFLEEHPA-ALVMFYAPWCGHCKKMKPEYDEAAEILNKDADSPGVLAAVDATVHKALGERFKISGFPTVKYFEKGEERYTLPHLRTKNMIVEYM 418          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Medaka
Match: txndc5 (thioredoxin domain containing 5 [Source:NCBI gene;Acc:101160445])

HSP 1 Score: 144.821 bits (364), Expect = 1.612e-37
Identity = 97/366 (26.50%), Postives = 168/366 (45.90%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKP---QFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWS------EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDA-------------RRHWRRIPGHEA--------IVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
            MFYAPWCG+C++++P   + A    ++    +++     +  T        + GYP++ L +   +  KY+G    ++L  ++    Q  P +           E    +  LT  NF E++ +  +  V F+APWCGHCKA  P +   A  +  ++ V    VDCT     ++C+  G+ G+P   +F  G+     +Y  +R+ D F  F+ N    QL A             ++    IP  E         +++L +++F + +        V FY+PWCGHC  + P++ + + K    L    IA VD T E  L  +Y V G+PTL+ F       ++ G R  +++  F++K+  D
Sbjct:   57 MFYAPWCGHCQRLQPTWNELAEKYNSMDEPPVYVVKVDCVQDTKFCSNVHGVRGYPTLLLFKPDQEAVKYQGPRDLQSLETWMLKTLQAEPSEPESELEPPKAPEPKQGMYELTALNFKEHISKG-AHFVKFFAPWCGHCKAMAPTWEQLATTLEHSEDVKIGKVDCTQHY--EVCSDNGVRGYPTLLFFYNGQK--KEQYKGKRDLDSFKDFVDN----QLKALQTEEHEHELKEEQQAANEIPTEEPAKEEAESNVLVLTESDFDEAVAK--GFTFVKFYAPWCGHCKNLAPTWDDLSKKEFPGLTDVKIAKVDCTVERTLCNKYSVRGYPTLIIFRAGEQGDEHHGGRDLESLHNFVMKQTRD 411          

HSP 2 Score: 84.7297 bits (208), Expect = 3.451e-17
Identity = 61/218 (27.98%), Postives = 98/218 (44.95%), Query Frame = 1
Query:  358 IVMFYAPWCGHCKATKPKFTSAA---NQMAENKKVAFIGVDCTDESFADICTS-EGITGFPIFRYFNYGKNTSNSE--YSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGA-LVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFM 990
             VMFYAPWCGHC+  +P +   A   N M E   V  + VDC  ++    C++  G+ G+P    F   +     +    L+  E   +  +    +         +     + +  L   NF ++I   + GA  V F++PWCGHC AM P++   A  L+       I  VD T    + +   V G+PTL++F       +Y G+R  D+  +F+
Sbjct:   55 FVMFYAPWCGHCQRLQPTWNELAEKYNSMDE-PPVYVVKVDCVQDT--KFCSNVHGVRGYPTLLLFKPDQEAVKYQGPRDLQSLETWMLKTLQAEPSEPESELEPPKAPEPKQGMYELTALNFKEHI---SKGAHFVKFFAPWCGHCKAMAPTWEQLATTLEH-SEDVKIGKVDCTQHYEVCSDNGVRGYPTLLFFYNGQKKEQYKGKRDLDSFKDFV 265          

HSP 3 Score: 68.9366 bits (167), Expect = 5.045e-12
Identity = 32/91 (35.16%), Postives = 52/91 (57.14%), Query Frame = 1
Query:  730 TSGALVMFYSPWCGHCIAMKPSFVNAANKLQTL-LPSCLIAAVDATTETHLAAQ-YKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIK 996
            T+   VMFY+PWCGHC  ++P++   A K  ++  P   +  VD   +T   +  + V G+PTL+ F P+ + VKY G R   ++  +M+K
Sbjct:   51 TAPHFVMFYAPWCGHCQRLQPTWNELAEKYNSMDEPPVYVVKVDCVQDTKFCSNVHGVRGYPTLLLFKPDQEAVKYQGPRDLQSLETWMLK 141          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Medaka
Match: pdia4 (protein disulfide isomerase family A member 4 [Source:NCBI gene;Acc:101168751])

HSP 1 Score: 139.428 bits (350), Expect = 1.591e-34
Identity = 87/258 (33.72%), Postives = 129/258 (50.00%), Query Frame = 1
Query:  295 NEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKK-VAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQEEKKKAD 1065
            N +  LTD NF  +++  ++V+V FYAPWCGHCK   P++   A  + +N   +    VD T  S   + +   ++G+P  +     KN    +Y   R E   V  +   A+P       W+  P  +A ++L + NF  + V++    LV FY+PWCGHC  + P +  AA +L    P   +A VDAT ET LA +Y V+GFPTL  F   G   +Y G R +  I E M ++     +  +A K  QE  K  D
Sbjct:   58 NGVLVLTDNNFDTFMEGKDTVLVEFYAPWCGHCKQFAPEYEKIAQTLKDNDPPIPVAKVDATQAS--QLASKFDVSGYPTIKIL---KNGEPVDYDGARTEKAIVERVKEVAHPD------WK--PPPDATLVLTQENF-DDTVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSKRTPPIPLAKVDATVETELAKRYGVNGFPTLKIFR-KGRAFEYNGPRENYGIVEHMGEQAGPPSKQVQAVKQVQELIKDGD 300          

HSP 2 Score: 120.553 bits (301), Expect = 2.888e-28
Identity = 86/344 (25.00%), Postives = 153/344 (44.48%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAEN-KKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP---QLDARRHWRRI--PGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHC---IAMKPSFVNAANKLQTLLPSCLI------------------AAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKY 951
            FYAPWCG+CKQ  P++   A TLK     I +   D +    L   F+++GYP++ ++++G  V  Y+G  +++A+++ V     P       W    +    LT  NF + ++  + ++V FYAPWCGHCK   P++  AA ++++    +    VD T E+  ++    G+ GFP  + F  G+     EY+  RE    V  M   A P   Q+ A +  + +   G +A+++         I S+   +    Y+  C       + + SF +   KL    P  ++                     D+T+ + +   +K    P + +  P+ D  +Y
Sbjct:   82 FYAPWCGHCKQFAPEYEKIAQTLKDNDPPIPVAKVDATQASQLASKFDVSGYPTIKILKNGEPV-DYDGARTEKAIVERVKEVAHP------DWKPPPDATLVLTQENFDDTVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSKRTPPIPLAKVDATVET--ELAKRYGVNGFPTLKIFRKGRAF---EYNGPRENYGIVEHMGEQAGPPSKQVQAVKQVQELIKDGDDAVIV--------GIFSNEQDSAYELYTEACNTLREDFSFRHSFSSDVAKLLKASPGQIVIVQPEKFRSKYEPASHTLTVKDSTSASEIQEFFKKHSIPLVGHRKPSNDAKRY 405          

HSP 3 Score: 62.3882 bits (150), Expect = 8.386e-10
Identity = 42/147 (28.57%), Postives = 73/147 (49.66%), Query Frame = 1
Query:  598 DFV-AFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDW--VKY-MGERTDDAITEFMIKKHSDIIRHEE 1026
            DFV AF      P + ++   +   G   +V+     F + ++      L+ FY+PWCGHC  ++P +++   K +    + +IA +DAT        YK  GFPT+     NG    VK+  G+RT +A++ F+ K  + + + +E
Sbjct:  496 DFVMAFKKGKLKPIIKSQPVPKSNTGPVKVVV--GKTFDEIVMDTQKDVLIEFYAPWCGHCKKLEPDYLSLGKKYKK-EKNLVIAKMDATANDIPNDNYKAEGFPTIYLAPANGKQSPVKFEGGDRTVEALSNFLEKHATKLQQKDE 639          

HSP 4 Score: 51.2174 bits (121), Expect = 2.959e-6
Identity = 28/93 (30.11%), Postives = 45/93 (48.39%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNK--VFKYE-GDNSKEALIKFVHNPTQPPPQKD 273
            FYAPWCG+CK+++P + +     K +   +    D +  D     +   G+P+++L     K    K+E GD + EAL  F+        QKD
Sbjct:  546 FYAPWCGHCKKLEPDYLSLGKKYKKEKNLVIAKMDATANDIPNDNYKAEGFPTIYLAPANGKQSPVKFEGGDRTVEALSNFLEKHATKLQQKD 638          

HSP 5 Score: 50.0618 bits (118), Expect = 5.408e-6
Identity = 32/115 (27.83%), Postives = 51/115 (44.35%), Query Frame = 1
Query:  169 LIQDGNKVFKYEGDN-SKEALIKFVHN----------PTQPPPQKDVPWSEETNEIDFLTDANFYE-YLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCT 477
            ++ +G K F  E D+   E L  FV             +QP P+ +      T  +  +    F E  +D  + V++ FYAPWCGHCK  +P + S   +  + K +    +D T
Sbjct:  474 IMAEGGKKFAMEPDDFDSEVLRDFVMAFKKGKLKPIIKSQPVPKSN------TGPVKVVVGKTFDEIVMDTQKDVLIEFYAPWCGHCKKLEPDYLSLGKKYKKEKNLVIAKMDAT 582          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Medaka
Match: txndc5 (thioredoxin domain containing 5 [Source:NCBI gene;Acc:101160445])

HSP 1 Score: 122.094 bits (305), Expect = 3.413e-30
Identity = 85/316 (26.90%), Postives = 145/316 (45.89%), Query Frame = 1
Query:  142 NITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWS------EETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDA-------------RRHWRRIPGHEA--------IVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
             + GYP++ L +   +  KY+G    ++L  ++    Q  P +           E    +  LT  NF E++ +  +  V F+APWCGHCKA  P +   A  +  ++ V    VDCT     ++C+  G+ G+P   +F  G+     +Y  +R+ D F  F+ N    QL A             ++    IP  E         +++L +++F + +    +   V FY+PWCGHC  + P++ + + K    L    IA VD T E  L  +Y V G+PTL+ F       ++ G R  +++  F++K+  D
Sbjct:   25 GVRGYPTLLLFKPDQEAVKYQGPRDLQSLETWMLKTLQAEPSEPESELEPPKAPEPKQGMYELTALNFKEHISKG-AHFVKFFAPWCGHCKAMAPTWEQLATTLEHSEDVKIGKVDCTQHY--EVCSDNGVRGYPTLLFFYNGQK--KEQYKGKRDLDSFKDFVDN----QLKALQTEEHEHELKEEQQAANEIPTEEPAKEEAESNVLVLTESDFDEAVAKGFT--FVKFYAPWCGHCKNLAPTWDDLSKKEFPGLTDVKIAKVDCTVERTLCNKYSVRGYPTLIIFRAGEQGDEHHGGRDLESLHNFVMKQTRD 329          

HSP 2 Score: 80.8777 bits (198), Expect = 3.066e-16
Identity = 59/211 (27.96%), Postives = 94/211 (44.55%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLK-GKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHN------------------------PTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTS-AANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKN 558
            F+APWCG+CK M P +   ATTL+  + + IG   D +   ++     + GYP++    +G K  +Y+G    ++   FV N                        PT+ P +++     E+N +  LT+++F E + +     V FYAPWCGHCK   P +   +  +      V    VDCT E    +C    + G+P    F  G+ 
Sbjct:  105 FFAPWCGHCKAMAPTWEQLATTLEHSEDVKIG-KVDCTQHYEVCSDNGVRGYPTLLFFYNGQKKEQYKGKRDLDSFKDFVDNQLKALQTEEHEHELKEEQQAANEIPTEEPAKEEA----ESN-VLVLTESDFDEAVAKG-FTFVKFYAPWCGHCKNLAPTWDDLSKKEFPGLTDVKIAKVDCTVER--TLCNKYSVRGYPTLIIFRAGEQ 306          
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Medaka
Match: pdia6 (protein disulfide isomerase family A member 6 [Source:NCBI gene;Acc:101171545])

HSP 1 Score: 103.99 bits (258), Expect = 2.130e-23
Identity = 72/254 (28.35%), Postives = 110/254 (43.31%), Query Frame = 1
Query:  292 TNEIDFLTDANFYEYLDQHESV-IVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDAR-------------RHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCL-IAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
            ++++  LT +NF   + Q +S+ +V FYAPWCGHC+   P +  AA  +    KV  +  D        +    G+ GFP  + F   KN    EY   R     V    N     +  R                      + +V L  +NF + ++      LV F++PWCGHC  ++P +  AA  ++      + + AVDAT    L+++Y V GFPT+  F    +   Y G RT   I E  +   SD
Sbjct:   24 SDDVVELTPSNFNREVMQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKVGAVDAD----EHKSLGGQYGVRGFPTIKIFGANKNKPE-EYQGARSSQAIVDGAMNALRSLVKDRLSGKSGSSGYSRQSDSGSSGSSKDVVELTDDNFDKTVLQSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVDATVHQVLSSRYGVRGFPTIKIFRKGEEPEDYQGGRTRGDIIERALDLFSD 272          

HSP 2 Score: 95.5153 bits (236), Expect = 1.470e-20
Identity = 66/235 (28.09%), Postives = 110/235 (46.81%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLI-QDGNKVFKYEGDNSKEALIKFVHNPTQP---------------PPQKDVPWSEETNEIDFLTDANFYEYLDQHESV-IVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSE-GITGFPIFRYFNYGKNTSNSEYSLEREEDDFVA-----FMTNPANPQL 639
            FYAPWCG+C+ + P +  AAT LKG      ++ D   +  L   + + G+P++ +   + NK  +Y+G  S +A++    N  +                  Q D   S  + ++  LTD NF + + Q + V +V F+APWCGHCK  +P++ +AA  + E  K   + +   D +   + +S  G+ GFP  + F  G+   +  Y   R   D +      F  N   P+L
Sbjct:   50 FYAPWCGHCRNLAPDWKKAATALKGIVKVGAVDADEHKS--LGGQYGVRGFPTIKIFGANKNKPEEYQGARSSQAIVDGAMNALRSLVKDRLSGKSGSSGYSRQSDSGSSGSSKDVVELTDDNFDKTVLQSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTK-GKVRLGAVDATVHQVLSSRYGVRGFPTIKIFRKGEEPED--YQGGRTRGDIIERALDLFSDNAPPPEL 279          
BLAST of Protein disulfide-isomerase A5 vs. Planmine SMEST
Match: SMESG000005268.1 (SMESG000005268.1)

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 277/359 (77.16%), Postives = 302/359 (84.12%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGING-DLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYE-GDNSKEALIKFVHNPTQPP-PQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQEEKKKADA 1068
            MFYAPWCG+CK MKP    AA  L+   I   I   D +   ++ QAF I G+P+V   +  N  F Y+  + S + L+KF+ +P +P  P+ ++PW EE +++       F   L +++  +VMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAM PSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQEEKKKADA
Sbjct:  284 MFYAPWCGHCKAMKPAMVDAAVQLRKLKIDAQIAAIDSTENKNISQAFQIKGFPTVKYFK--NAQFMYDVNERSADGLVKFLLDPKKPEEPKLELPWKEEQSQVIHPVPEEFRAVLKRYKHALVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMMPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQEEKKKADA 640          

HSP 2 Score: 370.548 bits (950), Expect = 1.913e-119
Identity = 198/336 (58.93%), Postives = 225/336 (66.96%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFI-GVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP-QLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTET--HLAAQYKVSGFPTLVYFS--PNGDWVKYMGERTDDAITEFM 990
            MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKA KP    AA Q+ + K  A I  +D T+    +I  +  I GFP  +YF   KN        ER  D  V F+ +P  P +      W+     ++ VI       + ++     ALVMFY+PWCGHC A KP F +AAN++        I  VD T E+   +     ++GFP   YF+   N    +Y  ER +D    FM
Sbjct:  163 MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKAMKPAMVDAAVQLRKLKIDAQIAAIDSTENK--NISQAFQIKGFPTVKYF---KNAQFMYDVNERSADGLVKFLLDPKKPEEPKLELPWKE---EQSQVIHPVPEEFRAVLKRYKHALVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFI-GVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFM 489          

HSP 3 Score: 137.502 bits (345), Expect = 8.483e-34
Identity = 83/275 (30.18%), Postives = 140/275 (50.91%), Query Frame = 1
Query:  199 YEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFL----------TDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMI 993
            Y+     E++++F+ +PT      ++ W E+    D +            +NF   +    S+++MFYAPWCG+CK  KP+F +AA  +    K  FIG++    +  D+  +  ITG+P       G      +Y  +  ++  + F+ NP  P       W        I  L   NF + +  H S  +VMFY+PWCGHC AMKP+ V+AA +L+ L     IAA+D+T   +++  +++ GFPT+ YF  N  ++  + ER+ D + +F++
Sbjct:  106 YDRKFRAESILRFLEDPTG-----EIAWEEDETARDIVHVKGSQDLQRLVSNFKTNI---PSMMLMFYAPWCGYCKQMKPQFAAAATTL--KGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKV--FKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNE--IDFLTDANFYEYLDQHES-VIVMFYAPWCGHCKAMKPAMVDAAVQLRKLKIDAQIAAIDSTENKNISQAFQIKGFPTVKYFK-NAQFMYDVNERSADGLVKFLL 364          
BLAST of Protein disulfide-isomerase A5 vs. Planmine SMEST
Match: SMESG000077361.1 (SMESG000077361.1)

HSP 1 Score: 170.244 bits (430), Expect = 7.689e-47
Identity = 101/344 (29.36%), Postives = 164/344 (47.67%), Query Frame = 1
Query:    1 MFYAPWCGYCKQMKPQFAAAATTL---KGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNP----------TQPPPQK-------DVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEK--------------NNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAV--DATTETHLAAQYKVSGFPTLVYF 924
            MFYAPWC +C+  KP+   AAT +     K++F  +N +     D+ Q  NI GYP++       KV  Y G  ++E+L+KF+ NP          ++ P          DVP+    N   +L   NF+E L + +  +V FYAPWC HC+ +KP    A+ ++  N    F  V+C D     +C    I GFP F+Y++ G+    +EY  E   + ++ +++ P       +   + IP  +A   ++K                F+  I + +   ++M+Y+PWC HC   KP F  AA  +    P+ ++AAV  D      L  +  V+GFPT +++
Sbjct:   57 MFYAPWCPHCQDAKPELFKAATKMAIINSKNVFALLNCEDPKNTDICQQHNIEGYPTIKAFSPDKKVHVYNGPATEESLLKFIENPAMFSKSQDSASESPDSSADDENLPDVPF----NHTKYLNGENFHETLSKMKHALVFFYAPWCPHCQESKPSVDKASEKLKSNDHEIF-AVNCEDSKSKTLCVDNKIEGFPTFKYYHKGE--LFAEYEEELTAEAYLLYLSKP------PKEKVKEIPKEKASDEIQKPEEKMEFVKYLTSEETFLHEIKTPSRHTMIMYYAPWCSHCQTAKPIFNLAAKDISKSNPNHVLAAVNCDDKATQKLCEKEDVNGFPTFIHY 387          

HSP 2 Score: 106.301 bits (264), Expect = 2.451e-24
Identity = 77/262 (29.39%), Postives = 114/262 (43.51%), Query Frame = 1
Query:  310 LTDANFYEYLDQHE-SVIVMFYAPWCGHCKATKPKFTSAANQMA-ENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNP---------ANPQLDARRHWRRIPG--HEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQEEKK 1056
            LT   F  Y  + + + +VMFYAPWC HC+  KP+   AA +MA  N K  F  ++C D    DIC    I G+P  + F+  K      Y+    E+  + F+ NP         A+   D+      +P         L   NF    +S    ALV FY+PWC HC   KPS   A+ KL++          + +    L    K+ GFPT  Y+     + +Y  E T +A   ++ K   + ++    EK   E +K
Sbjct:   38 LTSEFFENYTTKSDGTTVVMFYAPWCPHCQDAKPELFKAATKMAIINSKNVFALLNCEDPKNTDICQQHNIEGYPTIKAFSPDKKVHV--YNGPATEESLLKFIENPAMFSKSQDSASESPDSSADDENLPDVPFNHTKYLNGENF-HETLSKMKHALVFFYAPWCPHCQESKPSVDKASEKLKSNDHEIFAVNCEDSKSKTLCVDNKIEGFPTFKYYHKGELFAEYEEELTAEAYLLYLSKPPKEKVKEIPKEKASDEIQK 296          

HSP 3 Score: 97.0561 bits (240), Expect = 2.256e-21
Identity = 59/200 (29.50%), Postives = 99/200 (49.50%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFI-GINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQK--DVPWSEETNEIDFLTDA-NFYEYLDQHES-----------VIVMFYAPWCGHCKATKPKFTSAANQMAE-NKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGK 555
            FYAPWC +C++ KP    A+  LK     I  +N + S +  L     I G+P+      G    +YE + + EA + ++   ++PP +K  ++P  + ++EI    +   F +YL   E+            ++M+YAPWC HC+  KP F  AA  +++ N       V+C D++   +C  E + GFP F ++  GK
Sbjct:  195 FYAPWCPHCQESKPSVDKASEKLKSNDHEIFAVNCEDSKSKTLCVDNKIEGFPTFKYYHKGELFAEYEEELTAEAYLLYL---SKPPKEKVKEIPKEKASDEIQKPEEKMEFVKYLTSEETFLHEIKTPSRHTMIMYYAPWCSHCQTAKPIFNLAAKDISKSNPNHVLAAVNCDDKATQKLCEKEDVNGFPTFIHYFEGK 391          
BLAST of Protein disulfide-isomerase A5 vs. Planmine SMEST
Match: SMESG000010656.1 (SMESG000010656.1)

HSP 1 Score: 163.696 bits (413), Expect = 5.593e-43
Identity = 92/234 (39.32%), Postives = 126/234 (53.85%), Query Frame = 1
Query:  310 LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIG-VDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSD 1008
            L   NF E+++ +  V+V FYAPWCGHCK   P +T AA Q+ +N     +G VD T ES  ++ T  GI+G+P  ++F  G      +Y   R E   V FM    +P       W+  P    ++ L K NF Q IV  +   LV F++PWCGHC ++ P F  AA  L  L P   +A VDAT ET LA +Y VSG+P+L  F     +V Y G R+ D I ++MIK   +
Sbjct:   33 LNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVES--ELATRFGISGYPTLKFFKSG---IPYDYDDSRSESAIVNFMKKVGSPD------WQ--PPKNYVLTLTKENFTQ-IVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPSLKLFKNKNFFVDYSGPRSSDGIVDWMIKNREN 252          

HSP 2 Score: 109.768 bits (273), Expect = 6.475e-25
Identity = 67/207 (32.37%), Postives = 104/207 (50.24%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKS--IFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNEIDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAE-NKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFM 615
            FYAPWCG+CKQ+ P +  AA  LK  +  I +G   D +   +L   F I+GYP++   + G   + Y+   S+ A++ F+     P       W    N +  LT  NF + ++    ++V F+APWCGHCK+  P+F  AA  ++  N  +    VD T E+  D+     ++G+P  + F   KN    +YS  R  D  V +M
Sbjct:   52 FYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLG-KVDATVESELATRFGISGYPTLKFFKSGIP-YDYDDSRSESAIVNFMKKVGSPD------WQPPKNYVLTLTKENFTQIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVET--DLAKEYHVSGYPSLKLFK-NKNFF-VDYSGPRSSDGIVDWM 246          
BLAST of Protein disulfide-isomerase A5 vs. Planmine SMEST
Match: SMESG000017020.1 (SMESG000017020.1)

HSP 1 Score: 107.842 bits (268), Expect = 7.929e-25
Identity = 78/272 (28.68%), Postives = 126/272 (46.32%), Query Frame = 1
Query:  310 LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQLDARRHWR------RIPGHEA------------IVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSP---NGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQEEKKKA 1062
            LT +NF +  +      V FYAPWCGHC++  P++  AA  +    KV  + +D     ++ +    GI GFP  + F   K+ S  +Y  +R     V    N A  +LD     R          HE             +V L  +NF + ++      LV F++PWCGHC  +KP +  AA++L+  +    + A+DAT  T  A++Y V G+PT+ +F     +GD   Y G R+   I  +   K  + +   E +++  +E  K+
Sbjct:   29 LTPSNFDDMKNSDSLWFVEFYAPWCGHCQSLAPEWKKAATALKGVVKVGAVDMD----KYSSLGQPYGIQGFPTIKIFGKSKH-SPKDYQGDRTAGSIV----NAALKELDELVRSRLGGASGGSSSHERKSSGGSSGSGGDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASELRGKVK---LGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPAPEIKEILNQEILKS 288          

HSP 2 Score: 94.7449 bits (234), Expect = 1.542e-20
Identity = 66/233 (28.33%), Postives = 108/233 (46.35%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFK-YEGDNSKEALIKFVHNPTQPPPQKDV----------------PWSEETNEIDFLTDANFYEY-LDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSE-YSLEREEDDFVAFMTNPANPQLDA 645
            FYAPWCG+C+ + P++  AAT LKG  + +G   D+     L Q + I G+P++ +        K Y+GD +  +++           +  +                  S    ++  LTD+NF E  L   E  +V F+APWCGHCK  KP +  AA+++    KV    +D T  +     +  G+ G+P  ++F  G  + +S+ Y   R   D V + ++    QL A
Sbjct:   48 FYAPWCGHCQSLAPEWKKAATALKG-VVKVGAV-DMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGDRTAGSIVNAALKELDELVRSRLGGASGGSSSHERKSSGGSSGSGGDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAASEL--RGKVKLGALDATVHTAT--ASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRWASDKVVEQLPA 274          
BLAST of Protein disulfide-isomerase A5 vs. Planmine SMEST
Match: SMESG000023147.1 (SMESG000023147.1)

HSP 1 Score: 89.7373 bits (221), Expect = 9.656e-19
Identity = 44/112 (39.29%), Postives = 66/112 (58.93%), Query Frame = 1
Query:  664 IPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGDWVKYMGERTDDAITEFMIKK 999
            I   E +++L  +NF   ++      LV FY+PWCGHC A+ P + +AA KL+       +A VDAT E  LA+++K+ G+PTL +F  +G  + Y G RT D I  ++ KK
Sbjct:   20 ITEEEGVLVLTNSNF-NEVIEKNKYVLVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFK-DGKVMDYGGGRTADTIISWLEKK 129          

HSP 2 Score: 76.2554 bits (186), Expect = 2.047e-14
Identity = 39/109 (35.78%), Postives = 63/109 (57.80%), Query Frame = 1
Query:  310 LTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAE-NKKVAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANP 633
            LT++NF E +++++ V+V FYAPWCGHCKA  P++ SAA ++ E N  +    VD T E+  D+ +   I G+P  ++F  GK     +Y   R  D  ++++     P
Sbjct:   29 LTNSNFNEVIEKNKYVLVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVEN--DLASKFKIQGYPTLKFFKDGKVM---DYGGGRTADTIISWLEKKTGP 132          

HSP 3 Score: 74.3294 bits (181), Expect = 1.006e-13
Identity = 35/87 (40.23%), Postives = 52/87 (59.77%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGI-NGDLSTTDDLKQAFNITGYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPP 261
            FYAPWCG+CK + P++A+AA  LK K+  I +   D +  +DL   F I GYP++   +DG KV  Y G  + + +I ++   T PP
Sbjct:   48 FYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDG-KVMDYGGGRTADTIISWLEKKTGPP 133          

HSP 4 Score: 68.9366 bits (167), Expect = 4.905e-12
Identity = 51/181 (28.18%), Postives = 82/181 (45.30%), Query Frame = 1
Query:   34 QMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNI--TGYPSVFLIQDGNKVFKYEGDN---SKEALIKFVHNPTQPPPQ-----KDVPWSEETNEIDFLTDANFYEYL-DQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKKVAFIGVDCTDESFADICTSEGITGFPIFRYF 543
            ++K QF  +A    G+ +F+ IN D    D + + F +  T  PS  +IQ  + + K++ D+   S E L  FV +      +     +++P   + N +  L   NF     D+ ++V V FYAPWCGHCK   P +        +N  +    +D T    A+      I  FP  +YF
Sbjct:  268 ELKGQFETSAKKFLGQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDST----ANEVEGVRIQSFPTIKYF 444          

HSP 5 Score: 49.6766 bits (117), Expect = 5.101e-6
Identity = 25/82 (30.49%), Postives = 46/82 (56.10%), Query Frame = 1
Query:    4 FYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNITGYPSV-FLIQDGNKVFKYEGDNSKEALIKFVHN 246
            FYAPWCG+CKQ+ P +     T K  +  +    D ST +++ +   I  +P++ +  +D +++  +EGD + E   KF+ +
Sbjct:  390 FYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMD-STANEV-EGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDS 469          

HSP 6 Score: 49.2914 bits (116), Expect = 6.119e-6
Identity = 41/177 (23.16%), Postives = 69/177 (38.98%), Query Frame = 1
Query:  529 IFRYFNYGKNTSNSEYSLEREEDDFVAFMTNPANPQ-----------LDAR-----------RHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVMFYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVSGFPTLVYFSPNGD-WVKYMGERTDDAITEFM 990
            +  +F   K T    + + + EDD V F  + A              LD +             W + P    + +L   NF       +    V FY+PWCGHC  + P +       +      +IA +D+T   +     ++  FPT+ YF  + D  V + G+RT +   +F+
Sbjct:  299 VLEFFGMAK-TDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNP----VKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKD-NTDIVIAKMDST--ANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFI 467          
The following BLAST results are available for this feature:
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDIA59.497e-4532.25protein disulfide isomerase family A member 5 [Sou... [more]
TXNDC51.478e-4026.82thioredoxin domain containing 5 [Source:HGNC Symbo... [more]
TXNDC52.242e-3427.19thioredoxin domain containing 5 [Source:HGNC Symbo... [more]
PDIA41.701e-3232.63protein disulfide isomerase family A member 4 [Sou... [more]
PDIA41.739e-3232.63protein disulfide isomerase family A member 4 [Sou... [more]
back to top
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C14B9.24.239e-3233.48Probable protein disulfide-isomerase A4 [Source:U... [more]
pdi-22.484e-2529.15Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-22.484e-2529.15Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-26.164e-2526.67Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-26.164e-2526.67Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
back to top
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG93022.733e-6337.54gene:FBgn0032514 transcript:FBtr0080470[more]
prtp6.123e-2824.86gene:FBgn0030329 transcript:FBtr0303334[more]
prtp6.123e-2824.86gene:FBgn0030329 transcript:FBtr0303335[more]
prtp6.123e-2824.86gene:FBgn0030329 transcript:FBtr0073551[more]
prtp2.521e-2424.09gene:FBgn0030329 transcript:FBtr0332954[more]
back to top
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia53.728e-5736.87protein disulfide isomerase family A, member 5 [So... [more]
pdia46.929e-3532.95protein disulfide isomerase family A, member 4 [So... [more]
txndc53.480e-3325.91thioredoxin domain containing 5 [Source:ZFIN;Acc:Z... [more]
pdia63.907e-2528.20protein disulfide isomerase family A, member 6 [So... [more]
dnajc102.068e-2122.41DnaJ (Hsp40) homolog, subfamily C, member 10 [Sour... [more]
back to top
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
txndc51.557e-3625.34thioredoxin domain containing 5 [Source:NCBI gene;... [more]
chst131.871e-3331.76carbohydrate (chondroitin 4) sulfotransferase 13 [... [more]
chst132.129e-3331.76carbohydrate (chondroitin 4) sulfotransferase 13 [... [more]
chst132.287e-3331.76carbohydrate (chondroitin 4) sulfotransferase 13 [... [more]
chst132.289e-3331.76carbohydrate (chondroitin 4) sulfotransferase 13 [... [more]
back to top
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdia56.815e-5133.05protein disulfide isomerase associated 5 [Source:M... [more]
Txndc51.154e-3826.70thioredoxin domain containing 5 [Source:MGI Symbol... [more]
Txndc52.370e-3425.86thioredoxin domain containing 5 [Source:MGI Symbol... [more]
Txndc52.198e-3227.07thioredoxin domain containing 5 [Source:MGI Symbol... [more]
Pdia43.466e-3232.20protein disulfide isomerase associated 4 [Source:M... [more]
back to top
BLAST of Protein disulfide-isomerase A5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q921X9|PDIA5_MOUSE4.767e-5033.05Protein disulfide-isomerase A5 OS=Mus musculus OX=... [more]
sp|Q5I0H9|PDIA5_RAT5.712e-4632.76Protein disulfide-isomerase A5 OS=Rattus norvegicu... [more]
sp|Q14554|PDIA5_HUMAN4.561e-4432.25Protein disulfide-isomerase A5 OS=Homo sapiens OX=... [more]
sp|Q2KIL5|PDIA5_BOVIN7.952e-4331.75Protein disulfide-isomerase A5 OS=Bos taurus OX=99... [more]
sp|Q8NBS9|TXND5_HUMAN7.098e-4026.82Thioredoxin domain-containing protein 5 OS=Homo sa... [more]
back to top
BLAST of Protein disulfide-isomerase A5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UHJ28.077e-7540.99Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1X7VMG86.524e-7138.00Uncharacterized protein OS=Amphimedon queenslandic... [more]
A0A1S3HT501.972e-6938.62protein disulfide-isomerase A5-like OS=Lingula ung... [more]
A0A2T7PR442.475e-6938.99Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A423TN251.441e-6840.70Protein disulfide-isomerase A5 OS=Penaeus vannamei... [more]
back to top
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia52.189e-5536.28protein disulfide isomerase family A member 5 [Sou... [more]
pdia51.298e-5135.10protein disulfide isomerase family A member 5 [Sou... [more]
pdia42.502e-3633.33protein disulfide isomerase family A member 4 [Sou... [more]
txndc58.083e-2825.00thioredoxin domain containing 5 [Source:ZFIN;Acc:Z... [more]
dnajc103.404e-2524.86DnaJ heat shock protein family (Hsp40) member C10 ... [more]
back to top
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006474.12.434e-5033.71pep scaffold:Pmarinus_7.0:GL478000:14574:47610:1 g... [more]
pdia51.311e-4230.00protein disulfide isomerase family A, member 5 [So... [more]
txndc51.132e-3626.14thioredoxin domain containing 5 [Source:ZFIN;Acc:Z... [more]
pdia44.090e-3232.64protein disulfide isomerase family A, member 4 [So... [more]
dnajc106.479e-2724.72DnaJ (Hsp40) homolog, subfamily C, member 10 [Sour... [more]
back to top
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
PDI11.620e-1531.20Protein disulfide isomerase; multifunctional oxido... [more]
MPD13.797e-1043.94Member of the protein disulfide isomerase (PDI) fa... [more]
EUG11.695e-927.45Protein disulfide isomerase of the endoplasmic ret... [more]
EPS16.645e-630.91ER protein with chaperone and co-chaperone activit... [more]
back to top
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO413761.667e-5935.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413773.150e-4632.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329303.091e-3834.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473402.863e-3332.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345907.825e-3327.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein disulfide-isomerase A5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia52.091e-5234.07protein disulfide isomerase family A member 5 [Sou... [more]
txndc51.612e-3726.50thioredoxin domain containing 5 [Source:NCBI gene;... [more]
pdia41.591e-3433.72protein disulfide isomerase family A member 4 [Sou... [more]
txndc53.413e-3026.90thioredoxin domain containing 5 [Source:NCBI gene;... [more]
pdia62.130e-2328.35protein disulfide isomerase family A member 6 [Sou... [more]
back to top
BLAST of Protein disulfide-isomerase A5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005268.11.913e-11977.16SMESG000005268.1[more]
SMESG000077361.17.689e-4729.36SMESG000077361.1[more]
SMESG000010656.15.593e-4339.32SMESG000010656.1[more]
SMESG000017020.17.929e-2528.68SMESG000017020.1[more]
SMESG000023147.19.656e-1939.29SMESG000023147.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035571 ID=SMED30035571|Name=Protein disulfide-isomerase A5|organism=Schmidtea mediterranea sexual|type=transcript|length=1773bp
ATGTTCTATGCTCCATGGTGCGGCTATTGCAAACAGATGAAGCCTCAGTT
CGCAGCAGCGGCCACCACATTAAAGGGCAAATCGATATTTATCGGAATAA
ACGGGGATTTATCGACGACAGATGATCTGAAGCAAGCATTTAACATTACC
GGATATCCGAGCGTGTTCCTGATACAGGATGGCAACAAGGTATTCAAGTA
CGAAGGTGACAATTCCAAGGAGGCACTTATCAAATTTGTCCACAACCCAA
CGCAACCTCCTCCACAGAAAGACGTTCCCTGGTCAGAAGAAACTAATGAA
ATTGATTTCCTGACCGATGCCAATTTTTATGAGTATCTAGATCAACACGA
ATCAGTCATAGTCATGTTCTATGCTCCATGGTGCGGACATTGCAAGGCCA
CCAAGCCAAAATTCACATCGGCAGCCAATCAAATGGCTGAAAATAAGAAA
GTTGCATTTATTGGTGTAGATTGTACCGATGAATCATTTGCCGATATTTG
CACATCCGAAGGAATTACTGGATTCCCAATATTTCGCTATTTCAATTACG
GTAAAAATACATCGAATAGTGAATATTCACTGGAACGTGAAGAAGACGAC
TTTGTCGCATTTATGACGAATCCAGCCAATCCGCAATTGGATGCCCGTCG
TCACTGGCGGCGGATACCGGGACATGAAGCCATTGTGATATTGGAAAAGA
ACAATTTCGTGCAAAATATCGTTTCTCATACCAGTGGAGCTCTCGTTATG
TTCTATTCTCCGTGGTGCGGGCACTGCATAGCTATGAAGCCTTCTTTTGT
TAACGCTGCAAACAAACTCCAAACGTTATTACCTTCTTGTCTCATTGCTG
CCGTTGACGCGACAACCGAAACACATTTGGCTGCTCAATACAAGGTTTCC
GGATTTCCCACACTCGTATATTTCTCACCGAATGGAGATTGGGTAAAATA
TATGGGGGAAAGGACAGATGATGCAATAACTGAATTTATGATCAAGAAAC
ATTCTGATATCATCAGGCACGAGGAAGCTGAGAAACTTTTTCAGGAGGAG
AAGAAGAAAGCTGACGCGGAAAGAAAGTTAAAAGAGGAAAACGAAAGAAA
GAAAATTGAAGAAAGGAAATTACAAGAGGAAAAAGAGAGAAAGAAAATTG
AAGAAGAAAGGAAAGTAAAAGAGGAAAAAGAAAGAAGGAAAATTGAAGAA
GAAAGGATATTACAAGAGGAAAAAGAAAGAAAGAAAATTGAAGAAAAAAG
GAAATTACAAGTAGAAGAGGAAAGGGAAAAAATTGAAGAACGTAAAAAAG
AACAAGTTATTAAAAATGTGCCTTTAAACGAAGACGATAAATCAATCAAT
TTCGAAGAATTGCTCGATGAGAATTCATTTGAAAATGCAATTGTCTCAGA
GAGGACTTCAATCGTTTATTTGCACAAAGATAAGAAAAAGCCAAATGTAA
AGGCAAAACTGGTGAAATTATTGAATCGAGTGGAATCATCAGTTATCGCC
AGATACGAGGTGAATTGCGCACGAACTGTGAGCTTGTGTGACCAATTAAA
TGTTGTCGAGTTGCCAACGATTTTCGTGTATAGGAACAGTTTAAACAAGG
CCACTTTAACAGGCAGCTGGACAGAGGAAGATTTGTTCCAGGCGCTTGAT
CATTCCGGGCGAGATGAACTGTGATTGTCAGTTTCTTTTTGTACTAATTT
CTGGTTTAATAGCAGTACATTTTTATATGGAATTCTCCGTTCTTTTGTAT
TTGCACGCGATACTATTTACCAG
back to top

protein sequence of SMED30035571-orf-1

>SMED30035571-orf-1 ID=SMED30035571-orf-1|Name=SMED30035571-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=558bp
MFYAPWCGYCKQMKPQFAAAATTLKGKSIFIGINGDLSTTDDLKQAFNIT
GYPSVFLIQDGNKVFKYEGDNSKEALIKFVHNPTQPPPQKDVPWSEETNE
IDFLTDANFYEYLDQHESVIVMFYAPWCGHCKATKPKFTSAANQMAENKK
VAFIGVDCTDESFADICTSEGITGFPIFRYFNYGKNTSNSEYSLEREEDD
FVAFMTNPANPQLDARRHWRRIPGHEAIVILEKNNFVQNIVSHTSGALVM
FYSPWCGHCIAMKPSFVNAANKLQTLLPSCLIAAVDATTETHLAAQYKVS
GFPTLVYFSPNGDWVKYMGERTDDAITEFMIKKHSDIIRHEEAEKLFQEE
KKKADAERKLKEENERKKIEERKLQEEKERKKIEEERKVKEEKERRKIEE
ERILQEEKERKKIEEKRKLQVEEEREKIEERKKEQVIKNVPLNEDDKSIN
FEELLDENSFENAIVSERTSIVYLHKDKKKPNVKAKLVKLLNRVESSVIA
RYEVNCARTVSLCDQLNVVELPTIFVYRNSLNKATLTGSWTEEDLFQALD
HSGRDEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003756protein disulfide isomerase activity
GO:0016853isomerase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000039gamma neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR013766Thioredoxin_domain
IPR012336Thioredoxin-like_fold
IPR017937Thioredoxin_CS
Vocabulary: biological process
TermDefinition
GO:0045454cell redox homeostasis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 339..438
NoneNo IPR availablePRINTSPR00421THIOREDOXINcoord: 298..309
score: 38.89
coord: 119..127
score: 57.96
coord: 127..136
score: 58.72
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 375..401
NoneNo IPR availablePANTHERPTHR45672:SF2PROTEIN DISULFIDE-ISOMERASE A5coord: 1..211
NoneNo IPR availablePANTHERPTHR45672:SF2PROTEIN DISULFIDE-ISOMERASE A5coord: 202..350
NoneNo IPR availablePANTHERPTHR45672FAMILY NOT NAMEDcoord: 1..211
NoneNo IPR availablePANTHERPTHR45672FAMILY NOT NAMEDcoord: 202..350
NoneNo IPR availableCDDcd02961PDI_a_familycoord: 229..330
e-value: 8.6267E-27
score: 102.304
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 452..547
e-value: 8.8E-8
score: 34.0
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 220..336
e-value: 2.5E-28
score: 100.7
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 1..102
e-value: 4.9E-26
score: 93.2
coord: 103..219
e-value: 3.0E-31
score: 110.0
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 190..332
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 454..549
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 1..82
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 99..211
IPR013766Thioredoxin domainPFAMPF00085Thioredoxincoord: 228..330
e-value: 2.4E-21
score: 75.7
coord: 2..81
e-value: 9.2E-18
score: 64.1
coord: 103..206
e-value: 4.0E-21
score: 74.9
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 81..210
score: 14.646
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 1..80
score: 10.02
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 227..336
score: 10.635
IPR017937Thioredoxin, conserved sitePROSITEPS00194THIOREDOXIN_1coord: 120..138