SMED30035566

Overview
NameSMED30035566
Smed IDSMED30035566
Length (bp)1015
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30035566 (SMED30035566) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30035566 (SMED30035566) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035566

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30035566SMESG000005776.1 dd_Smed_v4_3522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
vitelline glandSMED30035566SMESG000005776.1 GCR160smed_ncbi_20200123PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30035566 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000596:1897..2911 +4985
Homology
BLAST of SMED30035566 vs. TrEMBL
Match: A0A193KUV5 (GCR160 OS=Schmidtea mediterranea OX=79327 GN=gcr160 PE=2 SV=1)

HSP 1 Score: 499.204 bits (1284), Expect = 6.482e-176
Identity = 299/303 (98.68%), Postives = 302/303 (99.67%), Query Frame = -1
Query:  107 MTIGKKIFYTXXXXXXXXXXILNLIIFICLKVKSLPSQYTTVVLRNQAFIDXXXXXXXXXXXXLPEQIITKNLFFDLFFCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKVTLSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRIVFNIRRNVNXXXXXXXXXXXXXXXXXXIVFLVTIAYDAIYYMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVVLFIIVRNIRIRCYKLLGIIFRNHFTIVESSGSY 1015
            MTIGKKIFYTFFGFIVFVGIILNLIIFICLKVKSLPSQYTTVVLRNQAFIDCFVCFLTFLFVVLPEQIITKNLFFDLFFCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKV LSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPAT+MIYLYSRIVFNIRRNVNAKRKFTFKTITKAAIIITIVFLVTIAYDAIYYMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVVLFIIVRNIRIRCYKLLGIIFRN+FTIVESSGS+
Sbjct:    1 MTIGKKIFYTFFGFIVFVGIILNLIIFICLKVKSLPSQYTTVVLRNQAFIDCFVCFLTFLFVVLPEQIITKNLFFDLFFCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKVKLSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATIMIYLYSRIVFNIRRNVNAKRKFTFKTITKAAIIITIVFLVTIAYDAIYYMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVVLFIIVRNIRIRCYKLLGIIFRNNFTIVESSGSF 303          
BLAST of SMED30035566 vs. TrEMBL
Match: A0A193KUF5 (GCR145 OS=Schmidtea mediterranea OX=79327 GN=gcr145 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 9.087e-46
Identity = 105/271 (38.75%), Postives = 157/271 (57.93%), Query Frame = -1
Query:  164 NLIIFICLKVKSLPSQYTTVVLRNQAFIDXXXXXXXXXXXXLPEQIITKNLFFDLFFCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKVTLSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRI--VFNIRRNVNXXXXXXXXXXXXXXXXXXIVFLVTIAYDAIYYMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVVLFIIVRNIR-------IRCYK 949
            N + FI L ++SL S+YT  +LRNQ+ ID  +C +T L + LP+   +  LF D   C IW GQ + +  +LAG +NL+FTA DR+WA++TP  Y  N+ +K+ LS++ IY    I   P   +  L N TC S Y+  G  +  F+K  S +W L  Y IP  ++I+LY ++    N  ++ N + K      TKA +I+ I+F++T  +D  YYMLGY   + Y F +P+QL G+ L + NS +NPVV FI +++ R        RC K
Sbjct:   29 NFMFFIVLCLRSLKSKYTNCILRNQSIIDSSLCLITLLALNLPKTSSSGILFIDQISCSIWTGQYLEYCFILAGEYNLVFTAVDRFWAVVTPSFYQKNINRKIILSFVFIYTFPVIFNWPQFIEFRLINGTCNSDYSDLGPNIVMFFKVNSTMWVLFQYIIPVAIIIFLYWKVYKAMNKLKSNNEETKKATMKFTKATMIVVIIFMLTCFFDPFYYMLGYLGAVEYVFNSPLQLTGISLITINSAVNPVVYFITMKSFRKFYFDVFCRCRK 299          
BLAST of SMED30035566 vs. TrEMBL
Match: A0A1I8HGG3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.033e-31
Identity = 82/262 (31.30%), Postives = 137/262 (52.29%), Query Frame = -1
Query:  173 NLIIFICLKVKSLPSQYTTVVLRNQAFIDXXXXXXXXXXXXLPEQIITKNLFFDLFFCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKVTLSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRIVFNIRR---NVNXXXXXXXXXXXXXXXXXXIVFLVTIAYDAIYYMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVVLFIIVRNIRIR 949
            N ++ + L  +   SQ+ T V  +Q  +D  VC  T + +V P Q  T +L F    CH+ N Q +YW+ V + V NL+  A DRY+A+  P+ Y     +   L  + ++  S  + I  +F       +   +           +K +  +WF  +Y +P   ++ LYS IV+ +     + +  R+     +TK+A+IIT++F+V  +YD IYY+LG+  ++ Y + +P QL+GV L + NSC NPVV  II+ + R R
Sbjct:  288 NALVILTLLRRRYKSQFATAVFLHQTVMDFMVCAFTLVLLVKPSQNPTSSLGFGFALCHVINSQLLYWYFVFSSVQNLVLIAVDRYFAVFRPVRYKTLSFRSAALHLVGLHCYSFAVNIIDIFSVEFDRDSNHCSSEITHQVFKKVFKVYGFLWFFLVYLLPVAAVVCLYSAIVYRLSNQGLHNSRFRQRAATELTKSAVIITVIFIVCFSYDCIYYLLGHLDLVEYIYSSPTQLIGVALVTINSCANPVVYCIIMPSFRER 549          
BLAST of SMED30035566 vs. TrEMBL
Match: R7VIJ2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_185678 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.212e-30
Identity = 80/244 (32.79%), Postives = 131/244 (53.69%), Query Frame = -1
Query:  206 SQYTTVVLRNQAFIDXXXXXXXXXXXXLPEQIITKNLFFDLFFCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSY---GNNLKKKVTLSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRIVFNIRR-------NVNXXXXXXXXXXXXXXXXXXIVFLVTIAYDAIYYMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVV 907
            S+   ++L++Q+ +D  VC      ++ P   +  N F D F C+IW+GQA YW +V    +NL+  A +RY AI  P ++    +  +KK+      +Y+    +T     QT L +  C+S YAF+G     ++  F I  +++ Y IPA  M  LYS +   +R+         +         +TK A+ +TI+F++++ YD  +Y+LGY  VI Y FG+P Q +GVFL++ NS  NP+V
Sbjct:   68 SRLIKILLQHQSLVDACVCACATALILQPSMWLPGNAFGDHFVCYIWHGQAAYWGLVTLSTYNLVLIALERYLAICRPFAHTRCSDYSRKKLATYGAWLYVFCLFLTHGTYIQTRLTDGQCKSEYAFDGKWTKLYFTSFVIFTYITTYLIPALTMALLYSLVAHQLRKRKENTELGKSKTIDRATDQLTKTAVTVTIIFILSVGYDLHFYLLGYNHVIEYTFGSPEQKVGVFLSNLNSVANPLV 311          
BLAST of SMED30035566 vs. TrEMBL
Match: R7VBF8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_208570 PE=3 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 1.490e-30
Identity = 80/244 (32.79%), Postives = 131/244 (53.69%), Query Frame = -1
Query:  206 SQYTTVVLRNQAFIDXXXXXXXXXXXXLPEQIITKNLFFDLFFCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSY---GNNLKKKVTLSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRIVFNIRR-------NVNXXXXXXXXXXXXXXXXXXIVFLVTIAYDAIYYMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVV 907
            S+   ++L++Q+ +D  VC      ++ P   +  N F D F C+IW+GQA YW +V    +NL+  A +RY AI  P ++    +  +KK+      +Y+    +T     QT L +  C+S YAF+G     ++  F I  +++ Y IPA  M  LYS +   +R+         +         +TK A+ +TI+F++++ YD  +Y+LGY  VI Y FG+P Q +GVFL++ NS  NP+V
Sbjct:   68 SRLIKILLQHQSLVDACVCACATALILQPSMWLPGNAFGDHFVCYIWHGQAAYWGLVTLSTYNLVLIALERYLAICRPFAHTRCSDYSRKKLATYGAWLYVFCLFLTHGTYIQTRLTDGQCKSEYAFDGKWTKLYFTSFVIFTYITTYLIPALTMALLYSLVAHQLRKRKENTELGKSKTIDRATDQLTKTAVTVTIIFILSVGYDLHFYLLGYNHVIEYTFGSPEQKVGVFLSNLNSVANPLV 311          
BLAST of SMED30035566 vs. Ensembl Nematostella
Match: EDO35030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMQ7])

HSP 1 Score: 54.299 bits (129), Expect = 2.859e-8
Identity = 67/276 (24.28%), Postives = 114/276 (41.30%), Query Frame = -1
Query:  179 IFICLKVKSLPSQYT--TVVLRNQAFIDXXXXXXXXXXXXLPEQIITKNLFFD-------LFFCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLS-YGNNLKKKVTLSYLIIYLVSGIITIPAMF--QTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRIVFNIRRNVNXXXXXXXXXXXXXXXXXXIVFLVTIAYDAIYYMLGYFKVI----------SYEFGTPIQLLGVFLTSFNSCINPVVLFIIVRNIR 940
            I +CL V   P   T   ++L N A  D  V           + IITK  FF         + C       + W   LA VF L+  A++RY AI+ P++ +    K    +  +I ++ S +I IP  F  Q S +   C   +     A     + +S+ W   +  IP+T++++ YSRIV ++    +  ++   +             L+ I   ++ YM+G+   +           Y+ G  I  +   L  FNS +NP V  +  ++ R
Sbjct:   30 ILVCLVVHKNPRMRTPMNIILFNLAICDITVAMGMTS-----KYIITK--FFQHPTGDCGRYLCTFITSGNLTWVGGLASVFCLVSLAYERYSAIVNPINIHKRTSKTSAKILCIIAWITSIMICIPEFFGHQYSKEREVCYQRW----PADEWLPQAYSMFWLFIVGFIPSTLLVFYYSRIVRSLWFAEHPSQEAHAQMAALRYRKSVTKMLIGI---SVIYMIGWMPTLFVFVLVYWHTGYQVGQVIGAVTAILVVFNSAVNPYVYALQSKSFR 291          
BLAST of SMED30035566 vs. Ensembl Nematostella
Match: EDO35029 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMQ6])

HSP 1 Score: 48.521 bits (114), Expect = 1.246e-6
Identity = 55/203 (27.09%), Postives = 93/203 (45.81%), Query Frame = -1
Query:  170 AGVFNLIFTAFDRYWAIITPLSYGNNLKKKVTLSYLIIYLVSG------IITIP--AMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRIVFNIR-RNVNXXXXXXXXXXXXXXXXXXIVFLVTIAYDAIY------YMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVVLFIIVRNIRIRC 733
            A VF+L+  A +RY+A++ PL    N ++++T S  +  LVSG      ++T P       S   H C   +     A     K +S+  FL +  IP T+M  LYSRI   +  +            +++   +  +V +V+  Y A +      Y+L Y+   ++ +G    L+ + L S NS +NP V  +  +  R RC
Sbjct:   91 ASVFSLVAIATERYFAVVWPL----NNERRIT-SRKLKCLVSGSWMFAVLMTFPLYTSVTYSETEHQCAEAWGHVSHA-----KAYSMCCFLFLGVIPLTIMAGLYSRITHELWFKGARVTSLTQRIVLSRRKRVTRMVIIVSSIYAATWMPNLTSYILNYYHP-NFAYGDTFYLVSICLVSVNSTVNPFVYTLQSQRFR-RC 281          
BLAST of SMED30035566 vs. Ensembl Nematostella
Match: EDO32417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV37])

HSP 1 Score: 46.595 bits (109), Expect = 5.125e-6
Identity = 40/138 (28.99%), Postives = 64/138 (46.38%), Query Frame = -1
Query:  410 EQIITKNLFFDLFFCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKVTLSYLI-IYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRIVFNIRRN 820
            EQI    LF  L    ++  Q I   ++   V  L+  + +RY AI+TPL     L+ K+  + LI  +++S  +  P M      N  C      E   V A  K F+ V F+ +Y +P  ++ Y Y R++  I R+
Sbjct:   60 EQISKHFLFGKLMCSLLYPLQTI---LMGTSVLTLLAVSIERYKAIVTPLQ--PKLRGKLAKAMLIGSWVLSVAVVAPYMVVLKYVNRQC-----IESWPVPAHAKTFTFVLFVVLYAVPMVIITYCYVRVLRRIHRD 187          
BLAST of SMED30035566 vs. Ensembl Nematostella
Match: EDO25557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DW52])

HSP 1 Score: 46.2098 bits (108), Expect = 5.519e-6
Identity = 40/139 (28.78%), Postives = 66/139 (47.48%), Query Frame = -1
Query:  410 EQIITKNLFFDLFFCHI-WNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKVTLSYLI-IYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRIVFNIRRN 820
            EQI +K+  F    C + +  Q I   ++   V  L+  + +RY AI+TPL     L+ K+  + LI  +++S  +  P M      N  C      E   V A  K F+ V F+ +Y +P  ++ Y Y R++  I R+
Sbjct:   56 EQI-SKHFLFGKVMCSLLYPLQTI---LMGTSVLTLLAVSIERYKAIVTPLQ--PKLRGKLAKAMLIGSWVLSVAVVAPYMVVLKYVNRQC-----IESWPVPAHAKTFTFVLFVVLYAVPMVIITYCYVRVLRRIHRD 183          
BLAST of SMED30035566 vs. Ensembl Medaka
Match: DRD5 (dopamine receptor D5 [Source:HGNC Symbol;Acc:HGNC:3026])

HSP 1 Score: 48.1358 bits (113), Expect = 7.295e-6
Identity = 35/126 (27.78%), Postives = 58/126 (46.03%), Query Frame = -1
Query:  431 FCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKV---------TLSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRI 781
            FC++W    I      A + NL   + DRYWAI +P  Y   + ++V         TLS LI ++   +    A  +    N T   ++ FE +  ++  + ++I   L  + IP  +MI  Y+RI
Sbjct:   89 FCNVWVAFDIM--CSTASILNLCIISVDRYWAISSPFRYERKMTQRVAFVMISITWTLSVLISFIPVQLNWHKASAEDRAHNST---SWQFEENCDSSLSREYAISSSLISFYIPVAIMIVTYTRI 209          
BLAST of SMED30035566 vs. Planmine SMEST
Match: SMESG000005776.1 (SMESG000005776.1)

HSP 1 Score: 370.163 bits (949), Expect = 5.779e-130
Identity = 208/212 (98.11%), Postives = 211/212 (99.53%), Query Frame = -1
Query:  107 MVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKVTLSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRIVFNIRRNVNXXXXXXXXXXXXXXXXXXIVFLVTIAYDAIYYMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVVLFIIVRNIRIRCYKLLGIIFRNHFTIVESSGSY 742
            MVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKV LSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPAT+MIYLYSRIVFNIRRNVNAKRKFTFKTITKAAIIITIVFLVTIAYDAIYYMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVVLFIIVRNIRIRCYKLLGIIFRN+FTIVESSGS+
Sbjct:    1 MVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKVKLSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATIMIYLYSRIVFNIRRNVNAKRKFTFKTITKAAIIITIVFLVTIAYDAIYYMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVVLFIIVRNIRIRCYKLLGIIFRNNFTIVESSGSF 212          
BLAST of SMED30035566 vs. Planmine SMEST
Match: SMESG000037926.1 (SMESG000037926.1)

HSP 1 Score: 203.371 bits (516), Expect = 4.513e-63
Identity = 101/251 (40.24%), Postives = 170/251 (67.73%), Query Frame = -1
Query:  179 KSLPSQYTTVVLRNQAFIDXXXXXXXXXXXXLPEQIITKNLFFDLFFCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKVTLSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRIVF----NIRRNVNXXXXXXXXXXXXXXXXXXIVFLVTIAYDAIYYMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVVLFIIVRNIR 919
            + L S++TT ++R+QA ID  +CF+T + V+ P  + + NL  D+  C IW  QA +WW+VL+ V+NL+FTA DRYWA++ P +Y +++ +K+ L+Y II  + G IT+P+  Q+   N +C S   + G  V+  +K +S++WFLSIYGIP  ++IY+Y++++     +++ +  +  K   ++ TK  ++ T++F++TI+YDAIYYMLGY  +  Y F +P Q++GVFLT+ NS +NP++ F +V+  R
Sbjct:   41 RGLDSKFTTFIVRSQAVIDMMICFMTMMLVIFPNPLNSGNLVLDIIICRIWTSQATFWWLVLSSVYNLLFTAIDRYWAVLKPQTYKHHMNRKIVLAYSIIIGMCGFITLPSYLQSKYYNGSCTSELQYSGIIVSNLFKAYSVIWFLSIYGIPTPILIYIYTKVILQLTSSLQGDSGSNLKTAMRSFTKGTMVTTLIFILTISYDAIYYMLGYLGIAVYIFNSPPQVVGVFLTAVNSSVNPIIFFALVKTFR 291          
BLAST of SMED30035566 vs. Planmine SMEST
Match: SMESG000037908.1 (SMESG000037908.1)

HSP 1 Score: 199.134 bits (505), Expect = 2.055e-61
Identity = 116/263 (44.11%), Postives = 176/263 (66.92%), Query Frame = -1
Query:  173 NLIIFICLKVKSLPSQYTTVVLRNQAFIDXXXXXXXXXXXXLPEQIITKNLFFDLFFCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKVTLSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRIVFNI----RRNVNXXXXXXXXXXXXXXXXXXIVFLVTIAYDAIYYMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVVLFIIVRNIRIR 949
            N+I    +  ++L S++T  +LR+Q+ ID  VC +T + V+ P+ + + N+  D  FCHIW  QAI+WW VLA ++NLIF A DRY A+I P SY N +KKK+  +Y II+  +G+  IPA FQ + +N TC +   F G++    +K FSI WF+++YG PA ++I+LYS+I++ +    +R+     + + K+ TK+ +I TI+FL+TIAYDA+YYMLGY  V+ Y   +P Q +GVFLTS NS  NP+V FI+V++ R +
Sbjct:   29 NIIFVSTIFCRALESKFTNYLLRSQSLIDSVVCIVTIIIVIFPDPMTSGNVNVDSVFCHIWTSQAIFWWTVLASIYNLIFLAVDRYSAVIIPQSYKNKIKKKIFFAYSIIFGCTGLSVIPAYFQYTFQNGTCLTQMDFVGESAKFAFKSFSIYWFIAVYGFPAPLLIFLYSKIIWKLYESFKRDKRISMQASMKSFTKSTLINTIIFLITIAYDAMYYMLGYLGVVEYVLYSPTQRVGVFLTSVNSSTNPLVFFILVKSFRRK 291          
BLAST of SMED30035566 vs. Planmine SMEST
Match: SMESG000003474.1 (SMESG000003474.1)

HSP 1 Score: 167.548 bits (423), Expect = 2.527e-49
Identity = 105/271 (38.75%), Postives = 157/271 (57.93%), Query Frame = -1
Query:  164 NLIIFICLKVKSLPSQYTTVVLRNQAFIDXXXXXXXXXXXXLPEQIITKNLFFDLFFCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKVTLSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRI--VFNIRRNVNXXXXXXXXXXXXXXXXXXIVFLVTIAYDAIYYMLGYFKVISYEFGTPIQLLGVFLTSFNSCINPVVLFIIVRNIR-------IRCYK 949
            N + FI L ++SL S+YT  +LRNQ+ ID  +C +T L + LP+   +  LF D   C IW GQ + +  +LAG +NL+FTA DR+WA++TP  Y  N+ +K+ LS++ IY    I   P   +  L N TC S Y+  G  +  F+K  S +W L  Y IP  ++I+LY ++    N  ++ N + K      TKA +I+ I+F++T  +D  YYMLGY   + Y F +P+QL G+ L + NS +NPVV FI +++ R        RC K
Sbjct:   29 NFMFFIVLCLRSLKSKYTNCILRNQSIIDSSLCLITLLALNLPKTSSSGILFIDQISCSIWTGQYLEYCFILAGEYNLVFTAVDRFWAVVTPSFYQKNINRKIILSFVFIYTFPVIFNWPQFIEFRLINGTCNSDYSDLGPNIVMFFKVNSTMWVLFQYIIPVAIIIFLYWKVYKAMNKLKSNNEETKKATMKFTKATMIVVIIFMLTCFFDPFYYMLGYLGAVEYVFNSPLQLTGISLITINSAVNPVVYFITMKSFRKFYFDVFCRCRK 299          
BLAST of SMED30035566 vs. Planmine SMEST
Match: SMESG000008854.1 (SMESG000008854.1)

HSP 1 Score: 167.162 bits (422), Expect = 2.867e-49
Identity = 116/277 (41.88%), Postives = 170/277 (61.37%), Query Frame = -1
Query:  140 LNLIIFICLKVKSLPSQYTTVVLRNQAFIDXXXXXXXXXXXXLPEQIITKNLFFDLFFCHIWNGQAIYWWMVLAGVFNLIFTAFDRYWAIITPLSYGNNLKKKVTLSYLIIYLVSGIITIPAMFQTSLKNHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRIVFNIRRNVNXXXXXXXXXXXXXXXXXXIVFLVTIAYDAIYYMLGYFKVISYEF---GTPIQ---LLGVFLTSFNSCINPVVLFIIVRNIRIRCYKLLGIIFRN 952
            +N+++ I L  KSLPS  TT +L NQA ID  +C L  ++V +PEQ+    ++ +   C   N   I+W ++ AG+ NL+FTA DRYWA+I PL+Y  ++K+     ++I Y  S  I IP  F+ S  N + ES      D    F+K  SI+W LSIY IP+ +MIY+Y  I+F  ++ +  K+  + KT+TKA ++ITI+FL TI ++ +  +L  +KV+ Y F   G  ++   L G+FL SFNSC+NPVVLF+IV+  R R  KLL   FRN
Sbjct:   21 MNILLLIVLTTKSLPSLRTTALLFNQALIDSCICLLLLIYVTIPEQL-EIFIYVNAEKCISINVLKIFWMVIQAGILNLVFTAVDRYWAVILPLNYFRDIKRNTIFLFVITYAYSATIVIPKYFEKSFVNCS-ESNLKIIFD---YFFKTHSIIWLLSIYAIPSIVMIYIYLTIIFKFQKKIQLKKNSSIKTLTKALVVITIIFLSTIPFNVVCEILDKWKVMDYRFHKDGRKLETFYLWGMFLHSFNSCVNPVVLFLIVKKFRSRFRKLLKATFRN 292          
The following BLAST results are available for this feature:
BLAST of SMED30035566 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035566 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035566 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035566 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035566 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035566 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035566 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035566 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUV56.482e-17698.68GCR160 OS=Schmidtea mediterranea OX=79327 GN=gcr16... [more]
A0A193KUF59.087e-4638.75GCR145 OS=Schmidtea mediterranea OX=79327 GN=gcr14... [more]
A0A1I8HGG34.033e-3131.30Uncharacterized protein OS=Macrostomum lignano OX=... [more]
R7VIJ21.212e-3032.79G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
R7VBF81.490e-3032.79G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of SMED30035566 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035566 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035566 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035566 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO350302.859e-824.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350291.246e-627.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324175.125e-628.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO255575.519e-628.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of SMED30035566 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DRD57.295e-627.78dopamine receptor D5 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of SMED30035566 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005776.15.779e-13098.11SMESG000005776.1[more]
SMESG000037926.14.513e-6340.24SMESG000037926.1[more]
SMESG000037908.12.055e-6144.11SMESG000037908.1[more]
SMESG000003474.12.527e-4938.75SMESG000003474.1[more]
SMESG000008854.12.867e-4941.88SMESG000008854.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035566 ID=SMED30035566|Name=SMED30035566|organism=Schmidtea mediterranea sexual|type=transcript|length=1015bp
TAAAAACTTGGTTTTACTATTTACAATTAAATTAAAAAAAGGAATTTAAG
TAGTTTCCAAATTATTTCCTCAAATCAACAATATAAAACAAAAAAAATAT
TCATCAATATGAGCCACTTGATTCGACAATAGTGAAATGATTGCGGAAGA
TTATTCCCAACAATTTGTAACATCGAATCCGAATGTTACGGACAATTATA
AACAAAACAACCGGATTAATGCAACTGTTGAAAGATGTTAGAAAAACCCC
GAGAAGCTGAATGGGGGTTCCGAATTCGTAGGAAATGACTTTGAAATATC
CCAGCATATAGTAAATAGCATCATATGCTATTGTCACTAGAAATACAATA
GTTATTATTATAGCAGCCTTTGTGATAGTTTTAAATGTAAATTTTCTCTT
TGCGTTGACATTTCTCCTGATATTGAAAACAATTCTTGAGTACAAATAAA
TCATCATTGTTGCTGGAATCCCATAAATGGATAAGAACCAAACTATTGAA
AACCCCTTATAAAATGCTGTAACAGCATCCCCCTCAAAAGCATATGTTGA
TTCACATGTATGATTTTTCAGTGATGTTTGAAACATCGCTGGAATAGTAA
TAATTCCACTTACCAAATAAATGATCAAATATGACAATGTCACTTTCTTT
TTCAAATTGTTCCCATAACTTAAAGGTGTGATTATGGCCCAATAACGATC
GAATGCTGTGAAAATAAGATTAAAAACTCCCGCTAACACCATCCACCAAT
ATATGGCCTGACCATTCCAAATATGACAGAAAAATAAATCAAAAAATAAA
TTTTTTGTTATTATCTGTTCGGGTAGAACGACAAACAAAAATGTAAGGAA
ACAAACGAAACAATCAATGAAAGCTTGATTTCGTAGAACAACTGTTGTAT
ATTGAGATGGCAAGGATTTTACCTTCAGACAAATAAATATTATTAAATTT
AAAATAATTCCAACAAAAACTATAAATCCAAAAAAAGTATAAAATATTTT
TTTCCCAATTGTCAT
back to top

protein sequence of SMED30035566-orf-1

>SMED30035566-orf-1 ID=SMED30035566-orf-1|Name=SMED30035566-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=304bp
MTIGKKIFYTFFGFIVFVGIILNLIIFICLKVKSLPSQYTTVVLRNQAFI
DCFVCFLTFLFVVLPEQIITKNLFFDLFFCHIWNGQAIYWWMVLAGVFNL
IFTAFDRYWAIITPLSYGNNLKKKVTLSYLIIYLVSGIITIPAMFQTSLK
NHTCESTYAFEGDAVTAFYKGFSIVWFLSIYGIPATMMIYLYSRIVFNIR
RNVNAKRKFTFKTITKAAIIITIVFLVTIAYDAIYYMLGYFKVISYEFGT
PIQLLGVFLTSFNSCINPVVLFIIVRNIRIRCYKLLGIIFRNHFTIVESS
GSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000231vitelline gland
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 7..31
score: 14.81
coord: 173..196
score: 22.84
coord: 89..111
score: 28.45
coord: 40..61
score: 21.4
coord: 253..279
score: 23.66
coord: 124..145
score: 16.28
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 23..270
e-value: 7.1E-21
score: 74.7
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 95..111
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 2..294
e-value: 2.0E-34
score: 121.0
NoneNo IPR availablePANTHERPTHR45698FAMILY NOT NAMEDcoord: 8..280
NoneNo IPR availableCDDcd006377tm_classA_rhodopsin-likecoord: 10..270
e-value: 1.89291E-16
score: 75.777
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 6..293
NoneNo IPR availableTMHMMTMhelixcoord: 174..196
NoneNo IPR availableTMHMMTMhelixcoord: 127..149
NoneNo IPR availableTMHMMTMhelixcoord: 252..274
NoneNo IPR availableTMHMMTMhelixcoord: 79..101
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 217..239
NoneNo IPR availableTMHMMTMhelixcoord: 42..64
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 22..271
score: 20.973