Tripartite motif-containing protein 2

Overview
NameTripartite motif-containing protein 2
Smed IDSMED30035563
Length (bp)1357
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tripartite motif-containing protein 2 (SMED30035563) t-SNE clustered cells

Violin plots show distribution of expression levels for Tripartite motif-containing protein 2 (SMED30035563) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tripartite motif-containing protein 2 (SMED30035563) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tripartite motif-containing protein 2 (SMED30035563) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035563

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30035563SMESG000037506.1 dd_Smed_v4_13659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035563SMESG000037506.1 Contig51032newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30035563SMESG000037506.1 dd_Smed_v6_13659_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035563SMESG000037506.1 dd_Smed_v4_13659_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tripartite motif-containing protein 2 vs. TrEMBL
Match: K1PCJ1 (Tripartite motif-containing protein 2 OS=Crassostrea gigas OX=29159 GN=CGI_10009108 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 7.956e-19
Identity = 98/370 (26.49%), Postives = 165/370 (44.59%), Query Frame = 2
Query:  164 MADGHTKRKLWHEGYQG---ELPICDRNSAYLNLKKYYLKSQPNIKHSCTNNRREK----TDENDWLIFLLSFGLKQTI----------SDPNQITSLANGVSLLGLAKLDDXXXXXXXXXXXXTMKDGQIIVCDTXXXXXXXXXXXXI--QTFSSEKYIKNQLASPLSVCVLSGMCIAVANYYNSSVNILNNDGIHEFMFFCKSRPIALDSDNFFTLYVLTETQTVECYSEMGCLLKIFTIPIQTNEFFSLFVCHKEKDELYLGEVNSNKIFVLNKAGRALKTMRLDIPNSGLNVFMSNFCY-RNGRIFVTDSVNRSVFLFQSNSGEFITILVNGKNDLGSVQAVAISSNNQLVTTEYAINQAHAVKMF 1213
            M D  ++ +L+  GY     + P+      Y N        +P + H C   RRE      D  +W  +LLS GL++TI           + N   +      L  +      +  F+FP+SV+T +DG ++V DT N+RV  FN+ G+    F  +   K Q   P  V  +    +AVA+  N  V I+   G    +F     P ++ SD    + V T  +T+E Y + G L+  F IP  + + F   +C   + E+ + +  ++ I      GR +          GL +  S     R G I V DS+N ++ ++  N G+F+   +   +  G +QA A+     L+TTE++++  H +K+F
Sbjct:    1 MVDFQSRYRLYGHGYTSPELKYPVPTYRELYHNTAPTIFSRRPRM-HDC---RRESMKDYVDAREWETWLLSQGLRETIRSATCLNLKVKETNSDGTKKPEKLLFNIGMRGSGNGDFNFPRSVITTRDGDVVVADTMNHRVQIFNSFGVFLTKFGKKGTGKLQFNEPSDVAEIPNGDLAVADKRNKRVQIITQGGQFRSVFETVDEPYSIASDLSGNVIVSTTRRTIEVYKKGGKLIHRFVIPGVSCDTFGCKICVNNRQEIIVCDAVNSTIKFFTYNGRYVSKFSPRSSGEGLTMIPSGITINRMGEILVADSLNHTINVYNDN-GDFLRQAICPTDQAGCIQACAVGPEGHLITTEFSLSGPHTLKIF 365          
BLAST of Tripartite motif-containing protein 2 vs. TrEMBL
Match: A0A210QQC4 (Tripartite motif-containing protein 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07471 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.214e-18
Identity = 85/367 (23.16%), Postives = 158/367 (43.05%), Query Frame = 2
Query:  164 MADGHTKRKLWHEGY---QGELPICDRNSAYLNLKKYYLKSQPNIKHSCT-NNRREKTDENDWLIFLLSFGLKQTISDPNQITSLANGVSLLGLAKLDD----------XXXXXXXXXXXXTMKDGQIIVCDTXXXXXXX--XXXXXIQTFSSEKYIKNQLASPLSVCVLSGMCIAVANYYNSSVNILNNDGIHEFMFFCKSRPIALDSDNFFTLYVLTETQTVECYSEMGCLLKIFTIPIQTNEFFSLFVCHKEKDELYLGEVNSNKIFVLNKAGRALKTMRLDIPNSGLNVFMSNFCYR-NGRIFVTDSVNRSVFLFQSNSGEFITILVNGKNDLGSVQAVAISSNNQLVTTEYAINQAHAVKMF 1213
            M D  ++ +L+  GY   +   PI      Y +   +    +P   H C   + ++ T++ DW  ++ S GL Q     N + +    ++  G    D               F +P+ +    DG++++ DT N+RV         I+   S+   + Q   P  V  L    +AVA+  N  V + +     +FMF     P ++ SD  + + V T  +++E Y   G L+  F++     +     VC   K+E+ + +  +N +      G+ L          GL++  S  C    G + V D++N +V L+ S  G  +  L+   ++ G+VQ  AI     L+ TE++++  H++K+F
Sbjct:    1 MVDYLSRYRLYGHGYTSPEQRYPITTYREIYRDNAPHIFGRRPR-SHDCRMESVKDLTEKKDWEAWMFSHGLGQVYRSVNYLHNQEKELTPQGTTAPDKLLFNIGVKGRGDGDFYYPRGLSVTLDGEVLIADTLNHRVQIFNQFGIFIKKIGSKGTGEGQFNEPSGVTELPNGDLAVADKRNKRVQVFSQRRQFKFMFPTGDEPFSIASDKDYNIIVSTIRRSIEVYRRGGKLVHAFSVGGSARDKIGCHVCVNNKEEVIVSDAVNNSVKYFTYGGKLLYKFNPMSTGDGLSMLPSGICVNMAGEVIVGDALNHTVNLY-SERGVLLKQLIGPSDEAGAVQTCAIGPEGHLMVTEFSVSGPHSLKIF 365          
BLAST of Tripartite motif-containing protein 2 vs. TrEMBL
Match: A0A1S3KGD7 (tripartite motif-containing protein 2-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106181771 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.198e-14
Identity = 89/339 (26.25%), Postives = 147/339 (43.36%), Query Frame = 2
Query:  245 YLNLKKYYLKSQPNIKHSCTNNR-REKTDENDWLIFLLSFGLKQTISDPNQITSLANGV-------SLLGLAKLDDXXXXXXXXXXXXTMKDGQ-IIVCDTXXXXXXXXXXXXI--QTFSSEKYIKNQLASPLSVCVLSGMCIAVANYYNSSVNILNNDGIHEFMFFCKSRPIALDSDNFFTLYVLTETQTVECYSEMGCLLKIFTI---PIQTNEFFS-LFVCHKEKDELYLGEVNSNKIFVLNKAGRALKTMRLDIPNSGLNVFMSNFCYRN-GRIFVTDSVNRSVFLFQSNSGEFITILVNGKNDLGSVQAVAISSNNQLVTTEYAINQAHAVKMF 1213
            Y N   +  K++  + H C     +  TD   W  +LL+ GL  T     ++ +             LL    +             +T+ D + I++ DT N+R+  FNN G+   +F S    + Q   P  V V     IAVA+  N  + +L  +G  ++ F     P ++  D ++   V T ++TVE Y   G LL  F +   P +T+   S + V    K+E+ L +  + ++   + AG  L   R +    GL    +  C    G+I + D +N +V ++ S  G+ +  +V   +  GSVQ  AI     LV TEY+ N  H  K+F
Sbjct:   31 YRNSAPHVFKAERALVHDCREPVVKAYTDSKLWEAYLLTRGLSDTARSQRELNAKEKEEEGMKKPQKLLFNVGVRGRGKGEFSYPRGLTITDERDIVIADTMNHRIQIFNNFGVFKSSFGSLGSGEGQFNEPTGVSVFPNQTIAVADKKNKRIQVLTLEGRFKYSFPTVDEPYSVACDIYYNTVVGTASRTVEVYRRGGKLLSRFEVGGKPPKTSMSGSPIHVAVNNKNEVVLCDSVNCRVRTYSYAGDLLYQFRTEANGDGLAAVPAGVCLNPLGQILIADRLNHTVNVY-SERGQLLLQIVGPPDLTGSVQTCAIGPEGHLVVTEYSTNGDHCFKIF 368          
BLAST of Tripartite motif-containing protein 2 vs. TrEMBL
Match: A0A1S3KGW8 (tripartite motif-containing protein 2-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106181771 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.560e-13
Identity = 63/222 (28.38%), Postives = 102/222 (45.95%), Query Frame = 2
Query:  563 TFSSEKYIKNQLASPLSVCVLSGMCIAVANYYNSSVNILNNDGIHEFMFFCKSRPIALDSDNFFTLYVLTETQTVECYSEMGCLLKIFTI---PIQTNEFFS-LFVCHKEKDELYLGEVNSNKIFVLNKAGRALKTMRLDIPNSGLNVFMSNFCYRN-GRIFVTDSVNRSVFLFQSNSGEFITILVNGKNDLGSVQAVAISSNNQLVTTEYAINQAHAVKMF 1213
            +F S    + Q   P  V V     IAVA+  N  + +L  +G  ++ F     P ++  D ++   V T ++TVE Y   G LL  F +   P +T+   S + V    K+E+ L +  + ++   + AG  L   R +    GL    +  C    G+I + D +N +V ++ S  G+ +  +V   +  GSVQ  AI     LV TEY+ N  H  K+F
Sbjct:  156 SFGSLGSGEGQFNEPTGVSVFPNQTIAVADKKNKRIQVLTLEGRFKYSFPTVDEPYSVACDIYYNTVVGTASRTVEVYRRGGKLLSRFEVGGKPPKTSMSGSPIHVAVNNKNEVVLCDSVNCRVRTYSYAGDLLYQFRTEANGDGLAAVPAGVCLNPLGQILIADRLNHTVNVY-SERGQLLLQIVGPPDLTGSVQTCAIGPEGHLVVTEYSTNGDHCFKIF 376          
BLAST of Tripartite motif-containing protein 2 vs. TrEMBL
Match: A0A1S3KBG1 (tripartite motif-containing protein 2 OS=Lingula unguis OX=7574 GN=LOC106180357 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.574e-13
Identity = 93/352 (26.42%), Postives = 152/352 (43.18%), Query Frame = 2
Query:  245 YLNLKKYYLKSQPNIKHSCTNNR-REKTDENDWLIFLLSFGLKQTISDPNQITS---------------------LANGVSLLGLAKLDDXXXXXXXXXXXXTMKDGQIIVCDTXXXXXXXXXXXXI--QTFSSEKYIKNQLASPLSVCVLSGMCIAVANYYNSSVNILNNDGIHEFMFFCKSRPIALDSDNFFTLYVLTETQTVECYSEMGCLLKIFTI---PIQTNEFFS-LFVCHKEKDELYLGEVNSNKIFVLNKAGRALKTMRLDIPNSGLNVFMSNFCYRN-GRIFVTDSVNRSVFLFQSNSGEFITILVNGKNDLGSVQAVAISSNNQLVTTEYAINQAHAVKMF 1213
            Y N   +  K++  + H C     +  TD   W  +LL+ GL  T     ++ +                     L   V + G  K +     FS+P+ +    D  I++ DT N+R+  FNN G+   +F S    + Q   P  V V     IAVA+  N  + +L  +G  ++ F     P ++  D ++   V T ++TVE Y   G LL  F +   P +T+   S + V    K+E+ L +  + ++   + AG  L   R +    GL    +  C    G+I + D +N +V ++ S  G+ +  +V   +  GSVQ  AI     LV TEY+ N  H  K+F
Sbjct:   31 YRNSAPHVFKAERALVHDCREPVVKAYTDSKLWEAYLLTRGLSDTARSQRELNAKEKEEEGMKKFFRPYSWRPQKLLFNVGVRGRGKGE-----FSYPRGLTITDDRDIVIADTMNHRIQIFNNFGVFKSSFRSLGSGEGQFNEPTGVSVFPNQTIAVADKKNKRIQVLTLEGRFKYSFPTVDEPYSVACDIYYNTVVGTASRTVEVYRRGGKLLSRFEVGGKPPKTSMSGSPIHVAVNNKNEVVLCDSVNCRVRTYSYAGDLLYQFRTEANGDGLAAVPAGVCLNPLGQILIADRLNHTVNVY-SERGQLLLQIVGPPDLTGSVQTCAIGPEGHLVVTEYSTNGDHCFKIF 376          
BLAST of Tripartite motif-containing protein 2 vs. Planmine SMEST
Match: SMESG000037506.1 (SMESG000037506.1)

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 350/352 (99.43%), Postives = 352/352 (100.00%), Query Frame = 2
Query:  164 MADGHTKRKLWHEGYQGELPICDRNSAYLNLKKYYLKSQPNIKHSCTNNRREKTDENDWLIFLLSFGLKQTISDPNQITSLANGVSLLGLAKLDDXXXXXXXXXXXXTMKDGQIIVCDTXXXXXXXXXXXXIQTFSSEKYIKNQLASPLSVCVLSGMCIAVANYYNSSVNILNNDGIHEFMFFCKSRPIALDSDNFFTLYVLTETQTVECYSEMGCLLKIFTIPIQTNEFFSLFVCHKEKDELYLGEVNSNKIFVLNKAGRALKTMRLDIPNSGLNVFMSNFCYRNGRIFVTDSVNRSVFLFQSNSGEFITILVNGKNDLGSVQAVAISSNNQLVTTEYAINQAHAVKMFSC 1219
            MADGHTKRKLWHEGYQGELPICDRNSAYLNLKKYYLKSQPNIKHSCTNNRREKTDENDWLIFLLSFGLKQTISDPNQITSLANGVSLLGLAKLDDSSVPFSFPKSVVTMKDGQIIVCDTGNNRVVGFNNGGIQTFSSEKYIK+QLASPLSVCVLSGMCIAVANYYNSSVNILNNDGIHEFMFFCKSRPIALDSDNFFTLYVLTETQTVECYSEMGCLLKIFTIPIQTNEFFSLFVCHKEKDELYLGEVNSNKIFVLNK+GRALKTMRLDIPNSGLNVFMSNFCYRNGRIFVTDSVNRSVFLFQSNSGEFITILVNGKNDLGSVQAVAISSNNQLVTTEYAINQAHAVKMFSC
Sbjct:    1 MADGHTKRKLWHEGYQGELPICDRNSAYLNLKKYYLKSQPNIKHSCTNNRREKTDENDWLIFLLSFGLKQTISDPNQITSLANGVSLLGLAKLDDSSVPFSFPKSVVTMKDGQIIVCDTGNNRVVGFNNGGIQTFSSEKYIKHQLASPLSVCVLSGMCIAVANYYNSSVNILNNDGIHEFMFFCKSRPIALDSDNFFTLYVLTETQTVECYSEMGCLLKIFTIPIQTNEFFSLFVCHKEKDELYLGEVNSNKIFVLNKSGRALKTMRLDIPNSGLNVFMSNFCYRNGRIFVTDSVNRSVFLFQSNSGEFITILVNGKNDLGSVQAVAISSNNQLVTTEYAINQAHAVKMFSC 352          
The following BLAST results are available for this feature:
BLAST of Tripartite motif-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripartite motif-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripartite motif-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripartite motif-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripartite motif-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripartite motif-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripartite motif-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripartite motif-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1PCJ17.956e-1926.49Tripartite motif-containing protein 2 OS=Crassostr... [more]
A0A210QQC45.214e-1823.16Tripartite motif-containing protein 2 OS=Mizuhopec... [more]
A0A1S3KGD72.198e-1426.25tripartite motif-containing protein 2-like isoform... [more]
A0A1S3KGW81.560e-1328.38tripartite motif-containing protein 2-like isoform... [more]
A0A1S3KBG11.574e-1326.42tripartite motif-containing protein 2 OS=Lingula u... [more]
back to top
BLAST of Tripartite motif-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripartite motif-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripartite motif-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripartite motif-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripartite motif-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripartite motif-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000037506.10.000e+099.43SMESG000037506.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035563 ID=SMED30035563|Name=Tripartite motif-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1357bp
ATTTTACTTTAACAAAAAATTATAGATTCTTTGTGTCTATTGACAAAGGG
ACCCTTCATCCACAATCACAGCAGTGCTAGCCCGCATATGTCAACAATAG
CATTTAGAAGCTTCAAATCAATATTAATGTGTTATCAAATTGTCATTGTC
TATTGACATTAAAATGGCTGATGGTCATACTAAAAGAAAATTGTGGCATG
AAGGCTACCAAGGCGAATTGCCAATTTGTGACAGAAATTCAGCTTATTTA
AATTTGAAAAAATATTACTTGAAAAGTCAACCAAATATAAAACATTCATG
TACAAATAATAGAAGAGAGAAAACAGATGAAAATGATTGGCTGATATTTC
TTTTATCCTTCGGATTAAAACAAACAATTTCTGATCCGAATCAAATTACT
TCACTTGCCAATGGAGTTAGTTTACTCGGATTAGCAAAACTGGATGACAG
CTCTGTTCCGTTTTCGTTTCCGAAATCCGTTGTGACAATGAAAGACGGAC
AGATAATTGTTTGTGATACGGGCAATAATAGAGTCGTTGGTTTCAATAAC
GGAGGGATACAAACATTTAGTTCCGAGAAGTACATTAAAAATCAATTGGC
AAGTCCTCTTTCTGTTTGCGTTTTATCCGGAATGTGCATTGCGGTTGCTA
ATTACTATAATTCATCTGTGAATATTTTAAATAACGATGGAATCCACGAA
TTTATGTTCTTTTGCAAATCCAGACCCATTGCGTTGGATTCCGATAATTT
CTTTACACTTTACGTATTGACCGAAACTCAAACTGTCGAATGCTATTCTG
AAATGGGATGTTTGTTGAAGATATTTACAATTCCAATTCAAACCAATGAA
TTTTTCTCGCTTTTTGTGTGTCATAAAGAAAAAGATGAATTGTACCTAGG
AGAAGTTAATTCTAATAAAATCTTTGTCTTGAACAAAGCCGGGCGTGCTT
TGAAAACCATGAGATTGGACATTCCCAATTCTGGGTTGAATGTTTTCATG
AGCAATTTCTGTTACAGAAATGGGAGGATTTTCGTGACTGATTCAGTAAA
TCGTAGTGTTTTCCTATTCCAAAGTAATAGCGGCGAGTTCATAACAATAC
TTGTTAATGGGAAAAATGATTTGGGTAGCGTCCAAGCTGTCGCGATATCT
AGTAACAATCAACTGGTAACAACAGAATATGCCATCAATCAAGCTCACGC
AGTGAAAATGTTCTCGTGTAATTTGGATTTTTTGACAAATGAATTATTCT
AATTATTGTTATTTTTAAATGCTATTTTTGCAGAGCTATAAAATGTTGAT
AAAAGGCATTGAAATTAAATAAAGGTTCTACCATTAATTATTCCCAAAAA
TACGTCC
back to top

protein sequence of SMED30035563-orf-1

>SMED30035563-orf-1 ID=SMED30035563-orf-1|Name=SMED30035563-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=363bp
MADGHTKRKLWHEGYQGELPICDRNSAYLNLKKYYLKSQPNIKHSCTNNR
REKTDENDWLIFLLSFGLKQTISDPNQITSLANGVSLLGLAKLDDSSVPF
SFPKSVVTMKDGQIIVCDTGNNRVVGFNNGGIQTFSSEKYIKNQLASPLS
VCVLSGMCIAVANYYNSSVNILNNDGIHEFMFFCKSRPIALDSDNFFTLY
VLTETQTVECYSEMGCLLKIFTIPIQTNEFFSLFVCHKEKDELYLGEVNS
NKIFVLNKAGRALKTMRLDIPNSGLNVFMSNFCYRNGRIFVTDSVNRSVF
LFQSNSGEFITILVNGKNDLGSVQAVAISSNNQLVTTEYAINQAHAVKMF
SCNLDFLTNELF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001258NHL_repeat
IPR0110426-blade_b-propeller_TolB-like
IPR013017NHL_repeat_subgr
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001258NHL repeatPFAMPF01436NHLcoord: 100..127
e-value: 2.7E-6
score: 27.1
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 283..360
e-value: 1.1E-5
score: 26.7
coord: 95..282
e-value: 8.1E-18
score: 66.6
NoneNo IPR availablePANTHERPTHR24104FAMILY NOT NAMEDcoord: 101..183
NoneNo IPR availablePANTHERPTHR24104:SF25E3 UBIQUITIN-PROTEIN LIGASE TRIM71coord: 101..183
NoneNo IPR availableSUPERFAMILYSSF101898NHL repeatcoord: 99..338
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 142..175
score: 6.25
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 285..305
score: 7.093
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 99..130
score: 9.272
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 316..353
score: 4.091