Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase

Overview
NameAlpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase
Smed IDSMED30035558
Length (bp)2489
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase (SMED30035558) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase (SMED30035558) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase (SMED30035558) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase (SMED30035558) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035558

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30035558h1SMcG0000559 dd_Smed_v4_7841_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30035558h1SMcG0000559 dd_Smed_v4_7841_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30035558h1SMcG0000559 dd_Smed_v4_7841_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035558h1SMcG0000559 Contig50850newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035558h1SMcG0000559 Contig50850uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Human
Match: MGAT5 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase [Source:HGNC Symbol;Acc:HGNC:7049])

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 295/726 (40.63%), Postives = 425/726 (58.54%), Query Frame = 2
Query:  212 LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILD-LDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRL-DIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMK--------KIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            L+++IL+LSKRY+  LA + +N VDGPY+G +T YDLKKT AVLL NI +R+  LE+KV NL      + + ++   + +           L +   ++  DII GAQEKC+L  +D    +P C+ KI+WM+  WRS  CY + GVDGS CS  IYLSEVE +CP L +R  N    +  NS+ E+  + + L   +      + F +M++RI+R+    ++A     ++ + ++   K +L++ G L+KES  KI++T FSGGPLGE+VQWSDLI SL++LGHDI +   L ++   + ++      C T +G+R+ ++ Y DI+G  Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QFY M+PHT DN+FLGF+V   +         +IK++  +LVYGK  S WKN + YL+II  Y E+HATV     S   +P YV NHGIL   +   LL E  +FVGLGFPYEGPAPLEAIA+G  F NPKFN  +    + FF  KPT R+L SQHPY E  IG P  + ++ NN+  + +  K I+ +     ++P+EFT  G LQR++   EKQ FC            WP + +    L     SC++ C +  LICE SF + +  ++  L+ + V C++ +       PS+DP  K C FQ D  L+SC  +   H R C CRDFI GQ ALCK+CL
Sbjct:   46 LREQILDLSKRYIKALAEENRNVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNLVVNGTGTNSTNSTTAVPS-----------LVALEKINVADIINGAQEKCVLPPMDG---YPHCEGKIKWMKDMWRSDPCYADYGVDGSTCSFFIYLSEVENWCPHLPWRAKNPYEEADHNSLAEIRTDFNILYSMMK---KHEEFRWMRLRIRRMADAWIQAIKSLAEKQNLEKRKRKKVLVHLGLLTKESGFKIAETAFSGGPLGELVQWSDLITSLYLLGHDIRISASLAELKEIMKKVVGNRSGCPT-VGDRIVELIYIDIVGLAQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHANYAQSKGHK-TPWGKWNLNPQQFYTMFPHTPDNSFLGFVVEQHLNSSDIHHINEIKRQNQSLVYGKVDSFWKNKKIYLDIIHTYMEVHATVY--GSSTKNIPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFNPPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVDLNNQEEVEDAVKAILNQK-IEPYMPYEFTCEGMLQRINAFIEKQDFCHGQV-------MWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYK-VTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKDCL 741          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Human
Match: MGAT5 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase [Source:HGNC Symbol;Acc:HGNC:7049])

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 295/726 (40.63%), Postives = 425/726 (58.54%), Query Frame = 2
Query:  212 LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILD-LDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRL-DIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMK--------KIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            L+++IL+LSKRY+  LA + +N VDGPY+G +T YDLKKT AVLL NI +R+  LE+KV NL      + + ++   + +           L +   ++  DII GAQEKC+L  +D    +P C+ KI+WM+  WRS  CY + GVDGS CS  IYLSEVE +CP L +R  N    +  NS+ E+  + + L   +      + F +M++RI+R+    ++A     ++ + ++   K +L++ G L+KES  KI++T FSGGPLGE+VQWSDLI SL++LGHDI +   L ++   + ++      C T +G+R+ ++ Y DI+G  Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QFY M+PHT DN+FLGF+V   +         +IK++  +LVYGK  S WKN + YL+II  Y E+HATV     S   +P YV NHGIL   +   LL E  +FVGLGFPYEGPAPLEAIA+G  F NPKFN  +    + FF  KPT R+L SQHPY E  IG P  + ++ NN+  + +  K I+ +     ++P+EFT  G LQR++   EKQ FC            WP + +    L     SC++ C +  LICE SF + +  ++  L+ + V C++ +       PS+DP  K C FQ D  L+SC  +   H R C CRDFI GQ ALCK+CL
Sbjct:   46 LREQILDLSKRYIKALAEENRNVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNLVVNGTGTNSTNSTTAVPS-----------LVALEKINVADIINGAQEKCVLPPMDG---YPHCEGKIKWMKDMWRSDPCYADYGVDGSTCSFFIYLSEVENWCPHLPWRAKNPYEEADHNSLAEIRTDFNILYSMMK---KHEEFRWMRLRIRRMADAWIQAIKSLAEKQNLEKRKRKKVLVHLGLLTKESGFKIAETAFSGGPLGELVQWSDLITSLYLLGHDIRISASLAELKEIMKKVVGNRSGCPT-VGDRIVELIYIDIVGLAQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHANYAQSKGHK-TPWGKWNLNPQQFYTMFPHTPDNSFLGFVVEQHLNSSDIHHINEIKRQNQSLVYGKVDSFWKNKKIYLDIIHTYMEVHATVY--GSSTKNIPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFNPPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVDLNNQEEVEDAVKAILNQK-IEPYMPYEFTCEGMLQRINAFIEKQDFCHGQV-------MWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYK-VTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKDCL 741          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Human
Match: MGAT5B (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B [Source:HGNC Symbol;Acc:HGNC:24140])

HSP 1 Score: 409.453 bits (1051), Expect = 4.120e-130
Identity = 237/685 (34.60%), Postives = 355/685 (51.82%), Query Frame = 2
Query:  422 NNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSN-----VSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYN----KFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKKIKKRKI--------ALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEV--------------------------DQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
             N +D+ +  D    QILR+ L     L  + + +G +++C    D K  FP+C  K+EWMR  W S  CY   GVDG+ CS +IYLSEVE +CP L +R    +      + +  ++     NLS LLD + G G +++ IFMK R +RL  +   AA +  ++    +   K IL++ GFL++ES    S     GGPLGE+VQW+D++ +L++LGH + V   L ++ + L  +P     C   +    D+ YTD  G  Q+       F K++C +R++DTFGT+P +N+  Y      + N W    L  KQF  M+PHT DN+F+GF V   + + +KR I        A+VYGK  S+WK  E +L I+  Y E+H TV   +    ++P +V NHG+L    +  LL +A +F+G GFPYEGPAPLEAIA+G IF   +F+        +FF+ KPT R+++SQHPY E  IG+P  + ++ NN     E   K I +     ++P+E+T  G L+R+    + Q FC      L E                             WP   +   +L V   +C +TC    LICE SF    +N++    +  V C++ +   +   P++    + CY Q +  L+SC  S   + R C CRDF  GQ ALC+ CL
Sbjct:  137 QNVSDIAVKVD----QILRHSL-----LLHSKVSEGRRDQCEAPSDPK--FPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAV--FRSNLSHLLD-LMGSG-KESLIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQSNL-GVPPGRGSCPLTMPLPFDLIYTDYHGLQQMKRHMGLSFKKYRCRIRVIDTFGTEPAYNHEEYATLHGYRTN-WGYWNLNPKQFMTMFPHTPDNSFMGF-VSEELNETEKRLIKGGKASNMAVVYGKEASIWKGKEKFLGILNKYMEIHGTVYYESQRPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGPAPLEAIANGCIFLQSRFSPPHSSLNHEFFRGKPTSREVFSQHPYAENFIGKPHVWTVDYNNSEEF-EAAIKAIMRTQVDPYLPYEYTCEGMLERIHAYIQHQDFCRAPDPALPEAHAPQSPFVLAPNATHLEWARNTSLAPGAWPPAHALRAWLAVPGRACTDTCLDHGLICEPSFFP-FLNSQDAFLKLQVPCDSTESEMNHLYPAFAQPGQECYLQKEPLLFSCAGSNTKYRRLCPCRDFRKGQVALCQGCL 801          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Human
Match: MGAT5B (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B [Source:HGNC Symbol;Acc:HGNC:24140])

HSP 1 Score: 409.068 bits (1050), Expect = 4.192e-130
Identity = 237/685 (34.60%), Postives = 355/685 (51.82%), Query Frame = 2
Query:  422 NNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSN-----VSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYN----KFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKKIKKRKI--------ALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEV--------------------------DQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
             N +D+ +  D    QILR+ L     L  + + +G +++C    D K  FP+C  K+EWMR  W S  CY   GVDG+ CS +IYLSEVE +CP L +R    +      + +  ++     NLS LLD + G G +++ IFMK R +RL  +   AA +  ++    +   K IL++ GFL++ES    S     GGPLGE+VQW+D++ +L++LGH + V   L ++ + L  +P     C   +    D+ YTD  G  Q+       F K++C +R++DTFGT+P +N+  Y      + N W    L  KQF  M+PHT DN+F+GF V   + + +KR I        A+VYGK  S+WK  E +L I+  Y E+H TV   +    ++P +V NHG+L    +  LL +A +F+G GFPYEGPAPLEAIA+G IF   +F+        +FF+ KPT R+++SQHPY E  IG+P  + ++ NN     E   K I +     ++P+E+T  G L+R+    + Q FC      L E                             WP   +   +L V   +C +TC    LICE SF    +N++    +  V C++ +   +   P++    + CY Q +  L+SC  S   + R C CRDF  GQ ALC+ CL
Sbjct:  126 QNVSDIAVKVD----QILRHSL-----LLHSKVSEGRRDQCEAPSDPK--FPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAV--FRSNLSHLLD-LMGSG-KESLIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQSNL-GVPPGRGSCPLTMPLPFDLIYTDYHGLQQMKRHMGLSFKKYRCRIRVIDTFGTEPAYNHEEYATLHGYRTN-WGYWNLNPKQFMTMFPHTPDNSFMGF-VSEELNETEKRLIKGGKASNMAVVYGKEASIWKGKEKFLGILNKYMEIHGTVYYESQRPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGPAPLEAIANGCIFLQSRFSPPHSSLNHEFFRGKPTSREVFSQHPYAENFIGKPHVWTVDYNNSEEF-EAAIKAIMRTQVDPYLPYEYTCEGMLERIHAYIQHQDFCRAPDPALPEAHAPQSPFVLAPNATHLEWARNTSLAPGAWPPAHALRAWLAVPGRACTDTCLDHGLICEPSFFP-FLNSQDAFLKLQVPCDSTESEMNHLYPAFAQPGQECYLQKEPLLFSCAGSNTKYRRLCPCRDFRKGQVALCQGCL 790          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Human
Match: MGAT5B (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B [Source:HGNC Symbol;Acc:HGNC:24140])

HSP 1 Score: 404.06 bits (1037), Expect = 4.809e-128
Identity = 237/687 (34.50%), Postives = 355/687 (51.67%), Query Frame = 2
Query:  422 NNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSN-----VSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYN----KFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKKIKKRKI--------ALVYGKHISMWK--NSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEV--------------------------DQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
             N +D+ +  D    QILR+ L     L  + + +G +++C    D K  FP+C  K+EWMR  W S  CY   GVDG+ CS +IYLSEVE +CP L +R    +      + +  ++     NLS LLD + G G +++ IFMK R +RL  +   AA +  ++    +   K IL++ GFL++ES    S     GGPLGE+VQW+D++ +L++LGH + V   L ++ + L  +P     C   +    D+ YTD  G  Q+       F K++C +R++DTFGT+P +N+  Y      + N W    L  KQF  M+PHT DN+F+GF V   + + +KR I        A+VYGK  S+WK    E +L I+  Y E+H TV   +    ++P +V NHG+L    +  LL +A +F+G GFPYEGPAPLEAIA+G IF   +F+        +FF+ KPT R+++SQHPY E  IG+P  + ++ NN     E   K I +     ++P+E+T  G L+R+    + Q FC      L E                             WP   +   +L V   +C +TC    LICE SF    +N++    +  V C++ +   +   P++    + CY Q +  L+SC  S   + R C CRDF  GQ ALC+ CL
Sbjct:  126 QNVSDIAVKVD----QILRHSL-----LLHSKVSEGRRDQCEAPSDPK--FPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAV--FRSNLSHLLD-LMGSG-KESLIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQSNL-GVPPGRGSCPLTMPLPFDLIYTDYHGLQQMKRHMGLSFKKYRCRIRVIDTFGTEPAYNHEEYATLHGYRTN-WGYWNLNPKQFMTMFPHTPDNSFMGF-VSEELNETEKRLIKGGKASNMAVVYGKEASIWKLQGKEKFLGILNKYMEIHGTVYYESQRPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGPAPLEAIANGCIFLQSRFSPPHSSLNHEFFRGKPTSREVFSQHPYAENFIGKPHVWTVDYNNSEEF-EAAIKAIMRTQVDPYLPYEYTCEGMLERIHAYIQHQDFCRAPDPALPEAHAPQSPFVLAPNATHLEWARNTSLAPGAWPPAHALRAWLAVPGRACTDTCLDHGLICEPSFFP-FLNSQDAFLKLQVPCDSTESEMNHLYPAFAQPGQECYLQKEPLLFSCAGSNTKYRRLCPCRDFRKGQVALCQGCL 792          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Celegans
Match: gly-2 (Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q9NDH7])

HSP 1 Score: 379.407 bits (973), Expect = 1.526e-120
Identity = 233/640 (36.41%), Postives = 348/640 (54.37%), Query Frame = 2
Query:  512 TDIIKGAQEKCI-LDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVK----NILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQ--TKLGNRLDIFYTDIIGFNQIYNKFVKF----KCLLRILDTFGTQPIFNNPFYL---KKINIKP----NGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKKIKKRKI---ALVYGKHISMWKNSESYLNIIKDYFELHATVNENN--DSKLK-LPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGV-VNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHM---RFCGCRDFINGQKALCKNCL 2347
             D  K +Q +C     + ++ +PEC +K++W++  W++H CY EN +DGS CS   YLS+VE YCP +   EH+     +   + +++ ++  LL   +   +     +MK RI RLW K  E A +  ++  + + +++    N+L++ GFL+ E KL ++  +  GGPLGE++QWSDL+ +L ++GH + V      + N + +  +   PCQ       +LDI +TDI+GFN +     +F    +C +R+LD+FGT   F    Y    KK    P    N W G  L+L+Q +  YPH+DDNTFLGF+V +     K  ++   ALVYGK   MW+++E  ++++K    +H+TV + +  DS +  + K V NHG L     + LLD   +F GLGFP EGPAPLEA+AHGA+F N KF + +     +F  +KPT RK  SQ+PY+E  IGEP    ++  NE  + E  K+ I     + FVPFEFT AG L RV++L EKQ  C + +Y      +WP I     F  +  +DSCE  CH + L+CE S+   +  N   L +R   C +   +  P  P        C  Q   FL+SC  S        R C CRD+I  Q A+CK CL
Sbjct:   59 VDFDKYSQSECSRFPSNVEIEYPECLNKMKWIKNGWKTHHCYIENHIDGSECSFRYYLSQVENYCPPM---EHH----GKRKGLAKISPSIRRLLPIFESIPH-----YMKTRINRLWKKWKEGAHEVMQK--YPKSMIERRKLNVLVFIGFLANEQKLNMAKKSDHGGPLGELLQWSDLLATLSVIGHHLEVSTNKNTLRNIVWKYMS-RGPCQYVNNFRQQLDIIFTDIMGFNILRQHHRQFLLSNRCRIRLLDSFGTHAEFTTKTYFVQNKKSLSGPFSQRNPWGGHGLDLRQHWTFYPHSDDNTFLGFVVDTEGIDKKNNQMIPSALVYGKEQYMWRDAEKPIDVLKRIVTVHSTVADLDLKDSNISSIFKKVQNHGFLNSEEISQLLDNITIFFGLGFPLEGPAPLEAMAHGAVFINAKFKEPKSRLNYKFLAEKPTLRKWTSQNPYME-KIGEPHVITVDIFNELELEEAIKRAISLKP-KHFVPFEFTPAGMLHRVALLLEKQELCDKIAYS----KRWPPIDQMKIFRTLNADDSCETICHSKQLLCEPSYFPII--NSSPLLRRENLCSSTTSDSSPFAPF------NCTIQQSAFLFSCASSPPISFEINRLCPCRDYIPEQHAICKKCL 669          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Zebrafish
Match: mgat5 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase [Source:ZFIN;Acc:ZDB-GENE-060616-238])

HSP 1 Score: 528.865 bits (1361), Expect = 4.152e-177
Identity = 288/731 (39.40%), Postives = 414/731 (56.63%), Query Frame = 2
Query:  191 TKTDDEQLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKK--------IKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            T     QL+ +IL+LSKRY+  LA + ++ +DGPY G +T YDLKKT AVLL NI +RL+ LE+KV N+  +N  S N +        N       NP++ +  ++  D++ GAQEKC  +L S   FP C+ KI+WM+  WRS  CYG  GVDGS CS  IYLSEVE +CP+L +R  N+ +     +  E+  +   L   +     ++ F +M +RI+R+    V A      + +      K IL++ G L+KES  KI++  FSGGPLGE+VQWSDLI +L++LGHDI +   L ++   + ++ +    C TK    +++ Y DI+G  Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QF  M+PHT DN+FLGF+V   +          IK++  +LVYGK  + WK+ + YL+II  Y E+H TV+    S + LP YV NHGIL   +   LL E  +FVGL FPYEGPAPLEAIA+G  F NP+F+  +    + FFK KPT R+L SQHPY E  IG P  + +N  +   +    K I+ +     ++P+EFT  G LQRV+   E Q FC            WP + S    L     SC++ C ++ LICE SF +  +N   +L + GV C+ V        P++    + C FQ+D  L+SC  + +   R C CRD++ GQ ALCK+CL
Sbjct:   39 THESSAQLRMQILDLSKRYIKALAEENQSVMDGPYVGTMTAYDLKKTLAVLLDNIMQRLSKLESKVDNIM-YNGTSANLT--------NGTGTPGPNPVNPEK-VNVADLLNGAQEKC--ELPSLDGFPHCEGKIKWMKDMWRSDPCYGNYGVDGSTCSFFIYLSEVENWCPRLPWRIKNIGDDLDRKTQLEVRTSFDELYRVMS---RREEFRWMMLRIKRMEEPWVSAVRSLANKQNLHHRKRKKILVHLGLLTKESGFKIAENAFSGGPLGELVQWSDLITTLYLLGHDIRISASLAELKEIMKKVMDNKSSCPTKGDKVVELIYIDIVGLAQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHAHYAQSKGHK-TPWGKWNLNPQQFNTMFPHTPDNSFLGFVVEQHLNASDVKHIDDIKRQNQSLVYGKVDNFWKDKKKYLDIIHSYMEVHGTVH--GTSTVHLPGYVKNHGILSGRDLQFLLRETKLFVGLSFPYEGPAPLEAIANGCAFLNPRFDPAKSSKNTDFFKGKPTLRELTSQHPYAEVYIGRPHVWTVNIEDPAEVENAIKAILSQK-IEPYLPYEFTCEGMLQRVNAFIENQDFCHGQV-------MWPPLSSMQVRLAPAGKSCKQVCQEEQLICEPSFFQH-LNKDKDLARYGVECKTVDSANDIVVPAFSESSRHCVFQSDLLLFSCAGAHQTLTRICPCRDYMKGQVALCKDCL 742          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Zebrafish
Match: MGAT5B (mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, isozyme B [Source:NCBI gene;Acc:101884072])

HSP 1 Score: 268.855 bits (686), Expect = 1.083e-80
Identity = 149/438 (34.02%), Postives = 221/438 (50.46%), Query Frame = 2
Query: 1160 LDIFYTDIIGFNQIYN----KFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPS-------SMKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQ-------------------------NSYELVEVDQ------WPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
             D+ YTD  G  Q+       F + +C +R++DTFGT+P +NN  Y      + N W    L  KQ+  M+PHT DN+F+GF+          ++K+ K   +A+VYGK  SMWK  E  L+I+  Y ++H TV        ++P +V NHG+L       LL +A +F+G GFPYEGPAPLEAIA+G IF  PKF+  +     +FF+ KPT R++ SQHPY E  IG+P    ++ NN     +  ++++K       +P+E+T  G L+RV+   + Q FC +                         NS  L+          WP + +    L   + SC +TC    LICE +F    +NN          CE+++   +   P+    ++ C+ Q +  L+SC      H R C CRDFI GQ ALC++CL
Sbjct:   47 FDLIYTDYHGLQQMKQHMGLSFRQHRCHIRVIDTFGTEPAYNNEEYATLHGYRTN-WGYWNLNCKQYMTMFPHTPDNSFMGFVTEELNQTERFNIKRNKVNNMAVVYGKEASMWKGKEKLLSILHRYMDIHGTVYYEAQRPPEVPAFVRNHGLLPQDELQQLLRKAKLFMGFGFPYEGPAPLEAIANGCIFLQPKFSPPRSSLNHEFFRGKPTSREVSSQHPYTEQYIGKPHVITVDFNNSQEFEKAVQELLKYKV-EPLIPYEYTCEGMLERVNAYIQHQDFCQRSSPFPAANESRSWPGNPPSPFLQLPNSTALIWAPNISAPACWPPLSALRLLLSPEDSSCVKTCQDAGLICEPAFFP-FINNIEAFNGLNAQCESLEAEKNHVFPAVHADRRECFQQKEPLLFSCAGVSAKHQRICPCRDFIQGQVALCRDCL 481          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Zebrafish
Match: ccdc126 (coiled-coil domain containing 126 [Source:ZFIN;Acc:ZDB-GENE-060503-11])

HSP 1 Score: 60.077 bits (144), Expect = 5.705e-10
Identity = 33/82 (40.24%), Postives = 48/82 (58.54%), Query Frame = 2
Query:  194 KTDDEQLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGY-DLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSAD 436
            +    +L+ +ILELS RYV VL+ + +N   GP+   + GY DLK+T AVLL +I  RL  LE KV      +  +I++ A 
Sbjct:   39 RQSSAELRQQILELSHRYVKVLSEENQNP-SGPHGTSMAGYADLKRTIAVLLDDILNRLVKLEGKVEAAVNASTHNISHPAG 119          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Zebrafish
Match: ccdc126 (coiled-coil domain containing 126 [Source:ZFIN;Acc:ZDB-GENE-060503-11])

HSP 1 Score: 60.077 bits (144), Expect = 5.705e-10
Identity = 33/82 (40.24%), Postives = 48/82 (58.54%), Query Frame = 2
Query:  194 KTDDEQLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGY-DLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSAD 436
            +    +L+ +ILELS RYV VL+ + +N   GP+   + GY DLK+T AVLL +I  RL  LE KV      +  +I++ A 
Sbjct:   39 RQSSAELRQQILELSHRYVKVLSEENQNP-SGPHGTSMAGYADLKRTIAVLLDDILNRLVKLEGKVEAAVNASTHNISHPAG 119          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Xenopus
Match: socs4 (suppressor of cytokine signaling 4 [Source:Xenbase;Acc:XB-GENE-481718])

HSP 1 Score: 538.88 bits (1387), Expect = 0.000e+0
Identity = 291/728 (39.97%), Postives = 418/728 (57.42%), Query Frame = 2
Query:  212 LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDF----TDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSS--------MKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            L+++IL+LSKRY+  LA + +N VDGPY G +T YDLKKT AVLL NI +R+  LE+KV NL       IN +         N++ I    + S    D      DII GAQE+C  +L     +P C+ KI+WM+  WRS  CY   GVDGS CS  IYLSEVE +CP+L +R  N ++ +   ++ E+  +   L   +      + F +M +RI+R+    +EA      + + ++   K IL++ G L+KES  KI++  FSGGPLGE+VQWSDLI SL++LGHD+ +   + ++   + ++      C T+    +++ Y DI+G +Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QFY M+PHT DN+FLGF+V           M  IK++  +LVYGK  + WK+  SYL+II  Y E+H TV+E     L +P YV NHGIL   +   LL E  +FVGLGFPYEGPAPLEAIA+G  F NPKFN  +    + FFK KPT R+L SQHPY E  +G+P  + ++ NN   + +  K+I+ +     ++P+EFT  G LQRV+   EKQ FC            WP + +    +     SC++ C ++ LICE S+ +  +N   +L + GV C++ +       PS D  +  C  Q D  L+SC  S  NH R C CRD++ GQ ALCK+CL
Sbjct:   46 LREQILDLSKRYIKALAEENRNVVDGPYVGTMTAYDLKKTLAVLLDNILQRIGKLESKVDNLV------INGTG-------TNSTNISTTAIPSTGAGDICNLVMDIINGAQEQC--ELPPMDGYPHCEGKIKWMKDMWRSDVCYSNYGVDGSTCSFFIYLSEVENWCPRLPWRAVNPNDEADRKNLAEIRTDFDDLYKVM---AKHEEFRWMTLRIRRMDDTWIEAIKSLADKQNLEKRKRKKILIHLGLLTKESGFKIAENAFSGGPLGELVQWSDLITSLYLLGHDVRISASIAELKEIMKKVVGNRSGCPTQGDKVVELIYIDIVGLSQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHAHYAQSKGHK-TPWGKWNLNPQQFYTMFPHTPDNSFLGFVVEQHLNASDIRHMNDIKRQNQSLVYGKVDNFWKDKHSYLDIIHTYMEVHGTVHEK--GTLYMPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFNPPKSSRNTDFFKGKPTLRELTSQHPYAEVYVGKPHVWTVDINNREEVEKAVKEILNQKN-EPYLPYEFTCEGMLQRVNAFIEKQDFCHGQV-------MWPPLSALQVKIAEPGKSCKQVCQEEQLICEPSYFQH-LNKDTDLAKFGVRCQSSETANDIVVPSLDEKRNHCVLQGDLLLFSCAGSHSNHKRVCPCRDYMKGQVALCKDCL 743          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Xenopus
Match: socs4 (suppressor of cytokine signaling 4 [Source:Xenbase;Acc:XB-GENE-481718])

HSP 1 Score: 537.724 bits (1384), Expect = 1.867e-180
Identity = 291/728 (39.97%), Postives = 417/728 (57.28%), Query Frame = 2
Query:  212 LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNL----TAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSS--------MKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            L+++IL+LSKRY+  LA + +N VDGPY G +T YDLKKT AVLL NI +R+  LE+KV NL    T  N  +I+ +A    VN                     DII GAQE+C  +L     +P C+ KI+WM+  WRS  CY   GVDGS CS  IYLSEVE +CP+L +R  N ++ +   ++ E+  +   L   +      + F +M +RI+R+    +EA      + + ++   K IL++ G L+KES  KI++  FSGGPLGE+VQWSDLI SL++LGHD+ +   + ++   + ++      C T+    +++ Y DI+G +Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QFY M+PHT DN+FLGF+V           M  IK++  +LVYGK  + WK+  SYL+II  Y E+H TV+E     L +P YV NHGIL   +   LL E  +FVGLGFPYEGPAPLEAIA+G  F NPKFN  +    + FFK KPT R+L SQHPY E  +G+P  + ++ NN   + +  K+I+ +     ++P+EFT  G LQRV+   EKQ FC            WP + +    +     SC++ C ++ LICE S+ +  +N   +L + GV C++ +       PS D  +  C  Q D  L+SC  S  NH R C CRD++ GQ ALCK+CL
Sbjct:   46 LREQILDLSKRYIKALAEENRNVVDGPYVGTMTAYDLKKTLAVLLDNILQRIGKLESKVDNLVINGTGTNSTNISTTAIPMPVN--------------------RDIINGAQEQC--ELPPMDGYPHCEGKIKWMKDMWRSDVCYSNYGVDGSTCSFFIYLSEVENWCPRLPWRAVNPNDEADRKNLAEIRTDFDDLYKVM---AKHEEFRWMTLRIRRMDDTWIEAIKSLADKQNLEKRKRKKILIHLGLLTKESGFKIAENAFSGGPLGELVQWSDLITSLYLLGHDVRISASIAELKEIMKKVVGNRSGCPTQGDKVVELIYIDIVGLSQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHAHYAQSKGHK-TPWGKWNLNPQQFYTMFPHTPDNSFLGFVVEQHLNASDIRHMNDIKRQNQSLVYGKVDNFWKDKHSYLDIIHTYMEVHGTVHEK--GTLYMPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFNPPKSSRNTDFFKGKPTLRELTSQHPYAEVYVGKPHVWTVDINNREEVEKAVKEILNQKN-EPYLPYEFTCEGMLQRVNAFIEKQDFCHGQV-------MWPPLSALQVKIAEPGKSCKQVCQEEQLICEPSYFQH-LNKDTDLAKFGVRCQSSETANDIVVPSLDEKRNHCVLQGDLLLFSCAGSHSNHKRVCPCRDYMKGQVALCKDCL 736          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000011615.1 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B [Source:NCBI gene;Acc:100487001])

HSP 1 Score: 405.601 bits (1041), Expect = 9.507e-129
Identity = 234/681 (34.36%), Postives = 358/681 (52.57%), Query Frame = 2
Query:  422 NNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPN-FNVPCQTKLGNRLDIFYTDIIGFNQIYN----KFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPS-------SMKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQ--------------NSYELVEVDQ--------------WPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNC 2344
             N +D+ +  D    QILRN L        + +++G ++ C  D+    RFP+C  K+EWMR  W S  CY   GVDG+ CS ++YLSEVE +CP L +R   ++  S           LS+LLD + G G +++ IFMK R++RL  + + AA +   +        K IL++ GFL++ES    S     GGPLGE+VQW+D++ +L+ILGH + +   + ++ +YL   P   N P    L    D+ YTD  G  Q+       F K++C LR++DTFGT+P +N+  Y      + N W    L  KQF  M+PHT DN+F+GF+           + + K R +A+VYGK  +MWK  E +L+++  + E+H TV        ++P +V NHG+L   +   LL +A +F+G GFPYEGPAPLEA+A+G +F  P+FN        +FF+ KPT R++ SQHPY+E  +G+P    ++ NN T   E   K I ++    ++P+E+T  G LQR+    + Q FC+               ++  L+ V+               WP + S   +L    +SC   C ++NL+CE SF   +  N+  L + G  C++ +       P+     + CY Q +  L+SC        R C CRD+  GQ ALC++C
Sbjct:  125 QNVSDIAVKVD----QILRNSLLR------SKVMEGQRDLC--DIPRDPRFPDCSGKVEWMRSRWTSDPCYAYYGVDGTECSFLVYLSEVEWFCPVLPWRNQTVAPTSFLFPQAAFRTELSSLLD-LMGTG-KESLIFMKKRLRRLEAQWLLAARRLENKVLDTPKEQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILAALYILGHSLKITVSVKELQSYLGVPPGRGNCPLTDPLP--FDLIYTDYHGMQQMKQHMGLSFRKYRCRLRVVDTFGTEPAYNHEEYATLHGYRTN-WGYWNLHPKQFMTMFPHTPDNSFMGFVTDELNDTERRQVAQNKVRNMAVVYGKEAAMWKGKEKFLSVLHKHMEIHGTVYFETQRPPEVPAFVKNHGLLPQQDLQQLLKKAKLFIGFGFPYEGPAPLEAVANGCVFLQPRFNPPHSSLNHEFFRGKPTSREVSSQHPYMEMAVGKPHVLTVDYNN-TQEFEAAIKAILRSKVEPYLPYEYTSEGMLQRLHAYIQHQEFCSPSMSSPYSINGSQGLHTPPLLLVNHTHLVWPPNVPLPHIWPPVTSMQVWLSEEGESCTNACWERNLVCEPSFF--IFINQQRLLELGALCDSTESVMSHLYPAVSLAVRECYLQREPLLFSCSGHSNKFRRLCPCRDYQPGQVALCRDC 785          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000011608.1 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B [Source:NCBI gene;Acc:100487001])

HSP 1 Score: 403.675 bits (1036), Expect = 3.129e-128
Identity = 242/720 (33.61%), Postives = 371/720 (51.53%), Query Frame = 2
Query:  341 LLQNIFER---LTNLENK-------VVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVS--QTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPN-FNVPCQTKLGNRLDIFYTDIIGFNQIYN----KFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPS-------SMKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQ--------------NSYELVEVDQ--------------WPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNC 2344
            +L+ +  R   L  LEN         V L    +    N +D+ +  D    QILRN L        + +++G ++ C  D+    RFP+C  K+EWMR  W S  CY   GVDG+ CS ++YLSEVE +CP L +R   + + S  +          LS+LLD + G G +++ IFMK R++RL  + + AA +   +        K IL++ GFL++ES    S     GGPLGE+VQW+D++ +L+ILGH + +   + ++ +YL   P   N P    L    D+ YTD  G  Q+       F K++C LR++DTFGT+P +N+  Y      + N W    L  KQF  M+PHT DN+F+GF+           + + K R +A+VYGK  +MWK  E +L+++  + E+H TV        ++P +V NHG+L   +   LL +A +F+G GFPYEGPAPLEA+A+G +F  P+FN        +FF+ KPT R++ SQHPY+E  +G+P    ++ NN T   E   K I ++    ++P+E+T  G LQR+    + Q FC+               ++  L+ V+               WP + S   +L    +SC   C ++NL+CE SF   +  N+  L + G  C++ +       P+     + CY Q +  L+SC        R C CRD+  GQ ALC++C
Sbjct:   77 ILETLVRRMDMLARLENASEYRPHTTVGLMEKIQAIAQNVSDIAVKVD----QILRNSLLR------SKVMEGQRDLC--DIPRDPRFPDCSGKVEWMRSRWTSDPCYAYYGVDGTECSFLVYLSEVEWFCPVLPWRNQTVGSYSKYRPKKQAAFRTELSSLLD-LMGTG-KESLIFMKKRLRRLEAQWLLAARRLENKVLDTPKEQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILAALYILGHSLKITVSVKELQSYLGVPPGRGNCPLTDPLP--FDLIYTDYHGMQQMKQHMGLSFRKYRCRLRVVDTFGTEPAYNHEEYATLHGYRTN-WGYWNLHPKQFMTMFPHTPDNSFMGFVTDELNDTERRQVAQNKVRNMAVVYGKEAAMWKGKEKFLSVLHKHMEIHGTVYFETQRPPEVPAFVKNHGLLPQQDLQQLLKKAKLFIGFGFPYEGPAPLEAVANGCVFLQPRFNPPHSSLNHEFFRGKPTSREVSSQHPYMEMAVGKPHVLTVDYNN-TQEFEAAIKAILRSKVEPYLPYEYTSEGMLQRLHAYIQHQEFCSPSMSSPYSINGSQGLHTPPLLLVNHTHLVWPPNVPLPHIWPPVTSMQVWLSEEGESCTNACWERNLVCEPSFF--IFINQQRLLELGALCDSTESVMSHLYPAVSLAVRECYLQREPLLFSCSGHSNKFRRLCPCRDYQPGQVALCRDC 776          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Xenopus
Match: ccdc126 (coiled-coil domain containing 126 [Source:NCBI gene;Acc:549166])

HSP 1 Score: 64.3142 bits (155), Expect = 1.456e-11
Identity = 32/61 (52.46%), Postives = 45/61 (73.77%), Query Frame = 2
Query:  209 QLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGY-DLKKTFAVLLQNIFERLTNLENKV 388
            +L+D+IL+LS+RYV  LA + K+ +DG   G + GY DLK+T AVLL +I +RL  LENK+
Sbjct:   44 ELRDQILDLSRRYVKALAEENKDLMDGGNGGSMAGYADLKRTIAVLLDDILQRLGKLENKI 104          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Mouse
Match: Mgat5 (mannoside acetylglucosaminyltransferase 5 [Source:MGI Symbol;Acc:MGI:894701])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 297/726 (40.91%), Postives = 423/726 (58.26%), Query Frame = 2
Query:  212 LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILD-LDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRL-DIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMK--------KIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            L+++IL+LSKRY+  LA + ++ VDGPY+G +T YDLKKT AVLL NI +R+  LE+KV NL       +N +       ++ NS      L S   ++  DII G QEKC+L  +D    +P C+ KI+WM+  WRS  CY + GVDG+ CS  IYLSEVE +CP+L +R  N    +  NS+ E+  + + L   +      + F +M++RI+R+    ++A     ++ + ++   K IL++ G L+KES  KI++T FSGGPLGE+VQWSDLI SL++LGHDI +   L ++   + ++      C T +G+R+ ++ Y DI+G  Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QFY M+PHT DN+FLGF+V   +         +IK++  +LVYGK  S WKN + YL+II  Y E+HATV     S   +P YV NHGIL   +   LL E  +FVGLGFPYEGPAPLEAIA+G  F NPKFN  +    + FF  KPT R+L SQHPY E  IG P  + ++ NN   + +  K I+ +     ++P+EFT  G LQR++   EKQ FC            WP + +    L     SC++ C +  LICE SF +  +N   +L +  V C++ +       PS+ P  K C FQ D  L+SC  +   H R C CRDFI GQ ALCK+CL
Sbjct:   46 LREQILDLSKRYIKALAEENRDVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNL-------VNGTG-----ANSTNSTTAVPSLVSLEKINVADIINGVQEKCVLPPMDG---YPHCEGKIKWMKDMWRSDPCYADYGVDGTSCSFFIYLSEVENWCPRLPWRAKNPYEEADHNSLAEIRTDFNILYGMMK---KHEEFRWMRLRIRRMADAWIQAIKSLAEKQNLEKRKRKKILVHLGLLTKESGFKIAETAFSGGPLGELVQWSDLITSLYLLGHDIRISASLAELKEIMKKVVGNRSGCPT-VGDRIVELIYIDIVGLAQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHASYAQSKGHK-TPWGKWNLNPQQFYTMFPHTPDNSFLGFVVEQHLNSSDIHHINEIKRQNQSLVYGKVDSFWKNKKIYLDIIHTYMEVHATVY--GSSTKNIPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFNPPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVDLNNREEVEDAVKAILNQK-IEPYMPYEFTCEGMLQRINAFIEKQDFCHGQV-------MWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQH-LNKEKDLLKYKVTCQSSELYKDILVPSFYPKSKHCVFQGDLLLFSCAGAHPTHQRICPCRDFIKGQVALCKDCL 740          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Mouse
Match: Mgat5 (mannoside acetylglucosaminyltransferase 5 [Source:MGI Symbol;Acc:MGI:894701])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 297/726 (40.91%), Postives = 423/726 (58.26%), Query Frame = 2
Query:  212 LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILD-LDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRL-DIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMK--------KIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            L+++IL+LSKRY+  LA + ++ VDGPY+G +T YDLKKT AVLL NI +R+  LE+KV NL       +N +       ++ NS      L S   ++  DII G QEKC+L  +D    +P C+ KI+WM+  WRS  CY + GVDG+ CS  IYLSEVE +CP+L +R  N    +  NS+ E+  + + L   +      + F +M++RI+R+    ++A     ++ + ++   K IL++ G L+KES  KI++T FSGGPLGE+VQWSDLI SL++LGHDI +   L ++   + ++      C T +G+R+ ++ Y DI+G  Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QFY M+PHT DN+FLGF+V   +         +IK++  +LVYGK  S WKN + YL+II  Y E+HATV     S   +P YV NHGIL   +   LL E  +FVGLGFPYEGPAPLEAIA+G  F NPKFN  +    + FF  KPT R+L SQHPY E  IG P  + ++ NN   + +  K I+ +     ++P+EFT  G LQR++   EKQ FC            WP + +    L     SC++ C +  LICE SF +  +N   +L +  V C++ +       PS+ P  K C FQ D  L+SC  +   H R C CRDFI GQ ALCK+CL
Sbjct:   46 LREQILDLSKRYIKALAEENRDVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNL-------VNGTG-----ANSTNSTTAVPSLVSLEKINVADIINGVQEKCVLPPMDG---YPHCEGKIKWMKDMWRSDPCYADYGVDGTSCSFFIYLSEVENWCPRLPWRAKNPYEEADHNSLAEIRTDFNILYGMMK---KHEEFRWMRLRIRRMADAWIQAIKSLAEKQNLEKRKRKKILVHLGLLTKESGFKIAETAFSGGPLGELVQWSDLITSLYLLGHDIRISASLAELKEIMKKVVGNRSGCPT-VGDRIVELIYIDIVGLAQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHASYAQSKGHK-TPWGKWNLNPQQFYTMFPHTPDNSFLGFVVEQHLNSSDIHHINEIKRQNQSLVYGKVDSFWKNKKIYLDIIHTYMEVHATVY--GSSTKNIPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFNPPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVDLNNREEVEDAVKAILNQK-IEPYMPYEFTCEGMLQRINAFIEKQDFCHGQV-------MWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQH-LNKEKDLLKYKVTCQSSELYKDILVPSFYPKSKHCVFQGDLLLFSCAGAHPTHQRICPCRDFIKGQVALCKDCL 740          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Mouse
Match: Mgat5b (mannoside acetylglucosaminyltransferase 5, isoenzyme B [Source:MGI Symbol;Acc:MGI:3606200])

HSP 1 Score: 402.905 bits (1034), Expect = 8.556e-128
Identity = 239/708 (33.76%), Postives = 365/708 (51.55%), Query Frame = 2
Query:  359 ERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNL----NLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYN----KFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSS-------MKKIKKRKIALVYGKHISMWK--NSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFC------------TQNSYELVE--------------VDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERM--MNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            +RLT   + +  + A  +    N +D+ +  D    QILR+ L     +  + + +G +++C    D K  FP+C  K+EWMR  W S  CY   GVDG+ CS +IYLSEVE +CP L +R    +  +   S+  +      NLS LL+ + G G +++ IFMK R +R   +  +AA    ++    R   K IL++ GFL++ES    S     GGPLGE+VQW+D++ +L++LGH + +   L ++ + L  +P     C   +    D+ YTD  G  Q+       F K++C +R++DTFGT+P +N+  Y      + N W    L  KQF  M+PHT DN+F+GF+           +K  K   +A+VYGK  S+WK    E +L ++  Y E+H TV   +    ++P +V NHG+L    +  LL +A +F+G GFPYEGPAPLEAIA+G IF   +F+        +FF+ KPT R+++SQHPY E  IG+P  + ++ NN     E   K I       ++P+E+T AG L+R++   + Q FC             Q+ + L                   WP   S   +L     +C + C    LICE SF   +   N+ L+LQ   V C++ ++  H   P++    + CY Q +  L+SC  +   + R C CRDF  GQ ALC+ CL
Sbjct:  109 DRLTPGASLIERIQAIAQ----NVSDIAVKVD----QILRHSL-----ILHSKVSEGRRDQCEAPSDPK--FPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAARTA-PKSLPRVQAVFRSNLSHLLE-LMGSG-KESLIFMKKRTRRFTAQWTKAAKYLAQKLGDIRRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILAALYVLGHSLRITVSLKELQSNL-GVPPGRGNCPLTVPLPFDLIYTDYHGLQQMKQHMGLSFKKYRCRIRVIDTFGTEPAYNHEEYATLHGYRTN-WGYWNLNPKQFMTMFPHTPDNSFMGFVSEELNETEKQLIKDGKASNMAVVYGKEASIWKLQGKEKFLAVLNKYMEIHGTVYYESQRPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGPAPLEAIANGCIFLQSRFSPPHSSLNHEFFRGKPTSREVFSQHPYAENFIGKPHVWTVDYNNSDEF-ETAIKAIMNTQVDPYLPYEYTCAGMLERINAYIQHQDFCVGPSPLPPGASTAQSPFVLAPNATHLEWAQNISSVPGAWPPTHSLRAWLAAPGRACTDACLDHGLICEPSFFPFLNSQNSFLKLQ---VPCDSTEWEMHHLYPAFAQPGQECYLQKEPLLFSCAGASTKYQRLCPCRDFRKGQVALCQGCL 792          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Mouse
Match: Mgat5b (mannoside acetylglucosaminyltransferase 5, isoenzyme B [Source:MGI Symbol;Acc:MGI:3606200])

HSP 1 Score: 174.866 bits (442), Expect = 1.702e-49
Identity = 85/204 (41.67%), Postives = 123/204 (60.29%), Query Frame = 2
Query: 1211 FVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSS-------MKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIE 1801
            F K++C +R++DTFGT+P +N+  Y      + N W    L  KQF  M+PHT DN+F+GF+           +K  K   +A+VYGK  S+WK  E +L ++  Y E+H TV   +    ++P +V NHG+L    +  LL +A +F+G GFPYEGPAPLEAIA+G IF   +F+        +FF+ KPT R+++SQHPY E
Sbjct:   11 FKKYRCRIRVIDTFGTEPAYNHEEYATLHGYRTN-WGYWNLNPKQFMTMFPHTPDNSFMGFVSEELNETEKQLIKDGKASNMAVVYGKEASIWKGKEKFLAVLNKYMEIHGTVYYESQRPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGPAPLEAIANGCIFLQSRFSPPHSSLNHEFFRGKPTSREVFSQHPYAE 213          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Mouse
Match: Ccdc126 (coiled-coil domain containing 126 [Source:MGI Symbol;Acc:MGI:1889376])

HSP 1 Score: 57.3806 bits (137), Expect = 2.651e-9
Identity = 29/61 (47.54%), Postives = 42/61 (68.85%), Query Frame = 2
Query:  209 QLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGY-DLKKTFAVLLQNIFERLTNLENKV 388
            +L+++IL+LSKRYV  LA + ++  D      + GY DLK+T AVLL +I +RL  LE+KV
Sbjct:   44 KLREQILDLSKRYVKALAEESRSTADVDSGASMAGYADLKRTIAVLLDDILQRLVKLESKV 104          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q08834|MGT5A_RAT (Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A OS=Rattus norvegicus OX=10116 GN=Mgat5 PE=1 SV=1)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 298/726 (41.05%), Postives = 423/726 (58.26%), Query Frame = 2
Query:  212 LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILD-LDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRL-DIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMK--------KIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            L+++IL+LSKRY+  LA + +N VDGPY+G +T YDLKKT AVLL NI +R+  LE+KV NL       +N +       ++ NS      L S   ++  DII G QEKC+L  +D    +P C+ KI+WM+  WRS  CY + GVDG+ CS  IYLSEVE +CP+L +R  N    +  NS+ E+  + + L   +      + F +M++RI+R+    ++A     ++ + ++   K IL++ G L+KES  KI++T FSGGPLGE+VQWSDLI SL++LGHDI +   L ++   + ++      C T +G+R+ ++ Y DI+G  Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QFY M+PHT DN+FLGF+V   +         +IK++  +LVYGK  S WKN + YL+II  Y E+HATV     S   +P YV NHGIL   +   LL E  +FVGLGFPYEGPAPLEAIA+G  F NPKFN  +    + FF  KPT R+L SQHPY E  IG P  + ++ NN   + +  K I+ +     ++P+EFT  G LQR++   EKQ FC            WP + +    L     SC++ C +  LICE SF +  +N   +L +  V C++ +       PS+ P  K C FQ D  L+SC  +   H R C CRDFI GQ ALCK+CL
Sbjct:   46 LREQILDLSKRYIKALAEENRNVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNL-------VNGTG-----ANSTNSTTAVPSLVSLEKINVADIINGVQEKCVLPPMDG---YPHCEGKIKWMKDMWRSDPCYADYGVDGTSCSFFIYLSEVENWCPRLPWRAKNPYEEADHNSLAEIRTDFNILYGMMK---KHEEFRWMRLRIRRMADAWIQAIKSLAEKQNLEKRKRKKILVHLGLLTKESGFKIAETAFSGGPLGELVQWSDLITSLYLLGHDIRISASLAELKEIMKKVVGNRSGCPT-VGDRIVELIYIDIVGLAQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHASYAQSKGHK-TPWGKWNLNPQQFYTMFPHTPDNSFLGFVVEQHLNSSDIHHINEIKRQNQSLVYGKVDSFWKNKKIYLDIIHTYMEVHATVY--GSSTKNIPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFNPPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVDLNNREEVEDAVKAILNQK-IEPYMPYEFTCEGMLQRINAFIEKQDFCHGQV-------MWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQH-LNKEKDLLKYKVICQSSELYKDILVPSFYPKSKHCVFQGDLLLFSCAGAHPTHQRICPCRDFIKGQVALCKDCL 740          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q09328|MGT5A_HUMAN (Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A OS=Homo sapiens OX=9606 GN=MGAT5 PE=1 SV=1)

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 295/726 (40.63%), Postives = 425/726 (58.54%), Query Frame = 2
Query:  212 LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILD-LDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRL-DIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMK--------KIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            L+++IL+LSKRY+  LA + +N VDGPY+G +T YDLKKT AVLL NI +R+  LE+KV NL      + + ++   + +           L +   ++  DII GAQEKC+L  +D    +P C+ KI+WM+  WRS  CY + GVDGS CS  IYLSEVE +CP L +R  N    +  NS+ E+  + + L   +      + F +M++RI+R+    ++A     ++ + ++   K +L++ G L+KES  KI++T FSGGPLGE+VQWSDLI SL++LGHDI +   L ++   + ++      C T +G+R+ ++ Y DI+G  Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QFY M+PHT DN+FLGF+V   +         +IK++  +LVYGK  S WKN + YL+II  Y E+HATV     S   +P YV NHGIL   +   LL E  +FVGLGFPYEGPAPLEAIA+G  F NPKFN  +    + FF  KPT R+L SQHPY E  IG P  + ++ NN+  + +  K I+ +     ++P+EFT  G LQR++   EKQ FC            WP + +    L     SC++ C +  LICE SF + +  ++  L+ + V C++ +       PS+DP  K C FQ D  L+SC  +   H R C CRDFI GQ ALCK+CL
Sbjct:   46 LREQILDLSKRYIKALAEENRNVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNLVVNGTGTNSTNSTTAVPS-----------LVALEKINVADIINGAQEKCVLPPMDG---YPHCEGKIKWMKDMWRSDPCYADYGVDGSTCSFFIYLSEVENWCPHLPWRAKNPYEEADHNSLAEIRTDFNILYSMMK---KHEEFRWMRLRIRRMADAWIQAIKSLAEKQNLEKRKRKKVLVHLGLLTKESGFKIAETAFSGGPLGELVQWSDLITSLYLLGHDIRISASLAELKEIMKKVVGNRSGCPT-VGDRIVELIYIDIVGLAQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHANYAQSKGHK-TPWGKWNLNPQQFYTMFPHTPDNSFLGFVVEQHLNSSDIHHINEIKRQNQSLVYGKVDSFWKNKKIYLDIIHTYMEVHATVY--GSSTKNIPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFNPPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVDLNNQEEVEDAVKAILNQK-IEPYMPYEFTCEGMLQRINAFIEKQDFCHGQV-------MWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYK-VTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKDCL 741          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q8R4G6|MGT5A_MOUSE (Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A OS=Mus musculus OX=10090 GN=Mgat5 PE=1 SV=1)

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 297/726 (40.91%), Postives = 423/726 (58.26%), Query Frame = 2
Query:  212 LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILD-LDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRL-DIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMK--------KIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            L+++IL+LSKRY+  LA + ++ VDGPY+G +T YDLKKT AVLL NI +R+  LE+KV NL       +N +       ++ NS      L S   ++  DII G QEKC+L  +D    +P C+ KI+WM+  WRS  CY + GVDG+ CS  IYLSEVE +CP+L +R  N    +  NS+ E+  + + L   +      + F +M++RI+R+    ++A     ++ + ++   K IL++ G L+KES  KI++T FSGGPLGE+VQWSDLI SL++LGHDI +   L ++   + ++      C T +G+R+ ++ Y DI+G  Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QFY M+PHT DN+FLGF+V   +         +IK++  +LVYGK  S WKN + YL+II  Y E+HATV     S   +P YV NHGIL   +   LL E  +FVGLGFPYEGPAPLEAIA+G  F NPKFN  +    + FF  KPT R+L SQHPY E  IG P  + ++ NN   + +  K I+ +     ++P+EFT  G LQR++   EKQ FC            WP + +    L     SC++ C +  LICE SF +  +N   +L +  V C++ +       PS+ P  K C FQ D  L+SC  +   H R C CRDFI GQ ALCK+CL
Sbjct:   46 LREQILDLSKRYIKALAEENRDVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNL-------VNGTG-----ANSTNSTTAVPSLVSLEKINVADIINGVQEKCVLPPMDG---YPHCEGKIKWMKDMWRSDPCYADYGVDGTSCSFFIYLSEVENWCPRLPWRAKNPYEEADHNSLAEIRTDFNILYGMMK---KHEEFRWMRLRIRRMADAWIQAIKSLAEKQNLEKRKRKKILVHLGLLTKESGFKIAETAFSGGPLGELVQWSDLITSLYLLGHDIRISASLAELKEIMKKVVGNRSGCPT-VGDRIVELIYIDIVGLAQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHASYAQSKGHK-TPWGKWNLNPQQFYTMFPHTPDNSFLGFVVEQHLNSSDIHHINEIKRQNQSLVYGKVDSFWKNKKIYLDIIHTYMEVHATVY--GSSTKNIPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFNPPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVDLNNREEVEDAVKAILNQK-IEPYMPYEFTCEGMLQRINAFIEKQDFCHGQV-------MWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQH-LNKEKDLLKYKVTCQSSELYKDILVPSFYPKSKHCVFQGDLLLFSCAGAHPTHQRICPCRDFIKGQVALCKDCL 740          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. UniProt/SwissProt
Match: sp|P97259|MGT5A_CRIGR (Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A OS=Cricetulus griseus OX=10029 GN=MGAT5 PE=1 SV=1)

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 296/726 (40.77%), Postives = 421/726 (57.99%), Query Frame = 2
Query:  212 LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILD-LDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRL-DIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMK--------KIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            L+++IL+LSKRY+  LA + +N VDGPY+G +T YDLKKT AVLL NI +R+  LE+KV NL       +N +       ++ NS      L S   +   DII G QEKC+L  +D    +P C+ KI+WM+  WRS  CY + GVDG+ CS  IYLSEVE +CP+L +R  N    +  NS+ E+  + + L   +      + F +M++RI+R+    ++A     ++ + ++   K IL++ G L+KES  KI++T FSGGPLGE+VQWSDLI SL++LGHDI +   L ++   + ++      C T +G+R+ ++ Y DI+G  Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QFY M+PHT DN+FLGF+V   +         +IK++  +LVYGK  S WKN + YL+II  Y E+HATV     S   +P YV NHGIL   +   LL E  +FVGLGFPYEGPAPLEAIA+G  F NPKF+  +    + FF  KPT R+L SQHPY E  IG P  + ++ NN   + +  K I+ +     ++P+EFT  G LQR++   EKQ FC            WP + +    L     SC++ C +  LICE SF +  +N   +L +  V C++ +       PS+ P  K C  Q D  L+SC  +   H R C CRDFI GQ ALCK+CL
Sbjct:   46 LREQILDLSKRYIKALAEENRNVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNL-------VNGTG-----ANSTNSTTAVPSLVSLEKISVADIINGVQEKCVLPPMDG---YPHCEGKIKWMKDMWRSDPCYADYGVDGTSCSFFIYLSEVENWCPRLPWRAKNPYEEADHNSLAEIRTDFNILYSMMK---KHEEFRWMRLRIRRMADAWIQAIKSLAEKQNLEKRKRKKILVHLGLLTKESGFKIAETAFSGGPLGELVQWSDLITSLYLLGHDIRISASLAELKEIMKKVVGNRSGCPT-VGDRIVELIYIDIVGLAQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHASYAQSKGHK-TPWGKWNLNPQQFYTMFPHTPDNSFLGFVVEQHLNSSDIHHINEIKRQNQSLVYGKVDSFWKNKKIYLDIIHTYMEVHATVY--GSSTKNIPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFSPPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVDLNNREEVEDAVKAILNQK-IEPYMPYEFTCEGMLQRINAFIEKQDFCHGQV-------MWPPLSALQVKLAEPGQSCKQVCQENQLICEPSFFQH-LNKEKDLLKYRVTCQSSELYKDILVPSFYPKSKHCVLQGDLLLFSCAGAHPTHQRICPCRDFIKGQVALCKDCL 740          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q3V5L5|MGT5B_HUMAN (Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B OS=Homo sapiens OX=9606 GN=MGAT5B PE=1 SV=2)

HSP 1 Score: 404.06 bits (1037), Expect = 2.310e-127
Identity = 237/687 (34.50%), Postives = 355/687 (51.67%), Query Frame = 2
Query:  422 NNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSN-----VSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYN----KFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKKIKKRKI--------ALVYGKHISMWK--NSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEV--------------------------DQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
             N +D+ +  D    QILR+ L     L  + + +G +++C    D K  FP+C  K+EWMR  W S  CY   GVDG+ CS +IYLSEVE +CP L +R    +      + +  ++     NLS LLD + G G +++ IFMK R +RL  +   AA +  ++    +   K IL++ GFL++ES    S     GGPLGE+VQW+D++ +L++LGH + V   L ++ + L  +P     C   +    D+ YTD  G  Q+       F K++C +R++DTFGT+P +N+  Y      + N W    L  KQF  M+PHT DN+F+GF V   + + +KR I        A+VYGK  S+WK    E +L I+  Y E+H TV   +    ++P +V NHG+L    +  LL +A +F+G GFPYEGPAPLEAIA+G IF   +F+        +FF+ KPT R+++SQHPY E  IG+P  + ++ NN     E   K I +     ++P+E+T  G L+R+    + Q FC      L E                             WP   +   +L V   +C +TC    LICE SF    +N++    +  V C++ +   +   P++    + CY Q +  L+SC  S   + R C CRDF  GQ ALC+ CL
Sbjct:  126 QNVSDIAVKVD----QILRHSL-----LLHSKVSEGRRDQCEAPSDPK--FPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAV--FRSNLSHLLD-LMGSG-KESLIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQSNL-GVPPGRGSCPLTMPLPFDLIYTDYHGLQQMKRHMGLSFKKYRCRIRVIDTFGTEPAYNHEEYATLHGYRTN-WGYWNLNPKQFMTMFPHTPDNSFMGF-VSEELNETEKRLIKGGKASNMAVVYGKEASIWKLQGKEKFLGILNKYMEIHGTVYYESQRPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGPAPLEAIANGCIFLQSRFSPPHSSLNHEFFRGKPTSREVFSQHPYAENFIGKPHVWTVDYNNSEEF-EAAIKAIMRTQVDPYLPYEYTCEGMLERIHAYIQHQDFCRAPDPALPEAHAPQSPFVLAPNATHLEWARNTSLAPGAWPPAHALRAWLAVPGRACTDTCLDHGLICEPSFFP-FLNSQDAFLKLQVPCDSTESEMNHLYPAFAQPGQECYLQKEPLLFSCAGSNTKYRRLCPCRDFRKGQVALCQGCL 792          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. TrEMBL
Match: A0A1S3KF81 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A isoform X2 OS=Lingula unguis OX=7574 GN=LOC106181457 PE=4 SV=1)

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 297/732 (40.57%), Postives = 450/732 (61.48%), Query Frame = 2
Query:  206 EQLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNL-----NLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVP-----SSMKKI-KKRKIALVYGKHISMWKNSESYLNIIKDYFELHATV---NENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            + +++EI++LS +YV  LA++Q++ VDGPYSGRLT YDLKKT AVLL++I  RL  +ENK  +L   N  S N  + V +   +   ++  NP+ +K      ++++G  EKC L  D K  +P C  K++WM+ HW+S KCY   GVDGS+CS IIYLSEVE +CPK  +R     NVS++  +   N      N + L++ +    ++  + +++ RIQ++W K  ++AI    + S +    KNIL++ G L+K+S  K ++T   GGPLGE++QWSD+I SL++LGH +T+  E+ ++   L + P+  + CQ +    +D+ +TDI+G  Q    + + + KF CLLR++D+FGT+P FN+  Y K   +    W  + L  +QF+NM+PHT DN+F+GF+V      SS+ ++ +K   ALVYGKH+SMWK  + YL+II ++FE+H+T       ++ K ++P YVINHGIL       LL E+ +FVGLGFPYEGPAPLEAIA G +F NPKF+       ++FFK KPT R++ SQHPY E  I EP+ Y ++ NN   +R   +KI +++    ++P+E++E G LQRV++  EKQ FC       V V+ +   ++    +     SC++ CH + LICE S   + +NN+ +L+Q  V C   +++     PS      TC FQTD  L+SC+ S E   R C CR++I GQ A+C+ CL
Sbjct:   37 QAIQEEIVQLSAQYVKALAAEQRDIVDGPYSGRLTSYDLKKTLAVLLEHIMGRLDKMENKFDSL--LNGTSYNLDSSVKL---STLEKVEENPMGAK------ELLQGEAEKCSLPDDHKYTYPHCLGKVDWMKGHWKSDKCYSNLGVDGSVCSFIIYLSEVENWCPKFPWR----LNVSESQHLQNRNEAIIPENAAGLMNLLTDSNSRKPYAWIRHRIQQIWPKWKQSAIDLNSKSSLKGRKQKNILIHIGALTKQSGFKFAETADKGGPLGELLQWSDIITSLYLLGHKLTITSEVEELRKILSKFPDAKIQCQVRSSLPVDVIFTDIVGLKQFKQYVGHGYGKFSCLLRVIDSFGTEPSFNHDQYAKAHKMM-TTWGRQNLIPQQFFNMFPHTPDNSFIGFVVETPDNISSLNRVVRKEDQALVYGKHLSMWKGKKQYLDIIHEFFEIHSTFYAGGVKSEDKQEVPSYVINHGILSPGEIQKLLRESKIFVGLGFPYEGPAPLEAIAAGCVFLNPKFSPPHTSQNTKFFKGKPTLREVTSQHPYAEVYIHEPYVYTVDINNLEELRTALRKIKQQSQVEPYLPYEYSEEGMLQRVNIFLEKQDFCR------VPVESFVPDQAVQTIIADTGKSCKDVCHNRGLICEPSHFTK-VNNKDKLKQMNVECTKSQHSGDIFYPSLHEDSGTCTFQTDPMLFSCVGSQEGQRRICPCRNYIKGQIAVCEQCL 745          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. TrEMBL
Match: A0A1S3KFQ4 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A isoform X1 OS=Lingula unguis OX=7574 GN=LOC106181457 PE=4 SV=1)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 297/744 (39.92%), Postives = 451/744 (60.62%), Query Frame = 2
Query:  206 EQLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLD------------FTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNL-----NLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVP-----SSMKKI-KKRKIALVYGKHISMWKNSESYLNIIKDYFELHATV---NENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            + +++EI++LS +YV  LA++Q++ VDGPYSGRLT YDLKKT AVLL++I  RL  +ENK  +L   N  S N  + V +   +   ++  NP+ +K  ++               +++G  EKC L  D K  +P C  K++WM+ HW+S KCY   GVDGS+CS IIYLSEVE +CPK  +R     NVS++  +   N      N + L++ +    ++  + +++ RIQ++W K  ++AI    + S +    KNIL++ G L+K+S  K ++T   GGPLGE++QWSD+I SL++LGH +T+  E+ ++   L + P+  + CQ +    +D+ +TDI+G  Q    + + + KF CLLR++D+FGT+P FN+  Y K   +    W  + L  +QF+NM+PHT DN+F+GF+V      SS+ ++ +K   ALVYGKH+SMWK  + YL+II ++FE+H+T       ++ K ++P YVINHGIL       LL E+ +FVGLGFPYEGPAPLEAIA G +F NPKF+       ++FFK KPT R++ SQHPY E  I EP+ Y ++ NN   +R   +KI +++    ++P+E++E G LQRV++  EKQ FC       V V+ +   ++    +     SC++ CH + LICE S   + +NN+ +L+Q  V C   +++     PS      TC FQTD  L+SC+ S E   R C CR++I GQ A+C+ CL
Sbjct:   37 QAIQEEIVQLSAQYVKALAAEQRDIVDGPYSGRLTSYDLKKTLAVLLEHIMGRLDKMENKFDSL--LNGTSYNLDSSVKL---STLEKVEENPMGAKGSVNALTEHKRSKKVTVQQLLQGEAEKCSLPDDHKYTYPHCLGKVDWMKGHWKSDKCYSNLGVDGSVCSFIIYLSEVENWCPKFPWR----LNVSESQHLQNRNEAIIPENAAGLMNLLTDSNSRKPYAWIRHRIQQIWPKWKQSAIDLNSKSSLKGRKQKNILIHIGALTKQSGFKFAETADKGGPLGELLQWSDIITSLYLLGHKLTITSEVEELRKILSKFPDAKIQCQVRSSLPVDVIFTDIVGLKQFKQYVGHGYGKFSCLLRVIDSFGTEPSFNHDQYAKAHKMM-TTWGRQNLIPQQFFNMFPHTPDNSFIGFVVETPDNISSLNRVVRKEDQALVYGKHLSMWKGKKQYLDIIHEFFEIHSTFYAGGVKSEDKQEVPSYVINHGILSPGEIQKLLRESKIFVGLGFPYEGPAPLEAIAAGCVFLNPKFSPPHTSQNTKFFKGKPTLREVTSQHPYAEVYIHEPYVYTVDINNLEELRTALRKIKQQSQVEPYLPYEYSEEGMLQRVNIFLEKQDFCR------VPVESFVPDQAVQTIIADTGKSCKDVCHNRGLICEPSHFTK-VNNKDKLKQMNVECTKSQHSGDIFYPSLHEDSGTCTFQTDPMLFSCVGSQEGQRRICPCRNYIKGQIAVCEQCL 763          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. TrEMBL
Match: A0A210Q687 (Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24123 PE=4 SV=1)

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 299/741 (40.35%), Postives = 429/741 (57.89%), Query Frame = 2
Query:  191 TKTDDEQLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFR------EHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVP-----SSMKKIKKRKIALVYGKHISMWKNSESYLNIIKDY-FELHATV------NENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            T+ + E LK+EI++LS+ YV  LA +  + VDGPY+GR T YDLKKT AVLL+++ ERL  LE K+ N  A N  +  NS       +  N Q +R    S   L   D+I+G  E+C L    K  +P C+ KIEWM+  W+S  CY   GVDGSICS ++YLSE+E +CP   +R      + +MS V   N  T+L   +  L+D       + ++ +++MRI+RLW K      + TK+ + +    K IL++ G LSK+S    ++  F GGPLGE+VQWSDL+ +LFILGHD+ V  E   +   L ++P  N PCQ++    + I YTDI+G  Q    +   + KF CLLRI+D+FGT+P +N+  Y K   +    W G+ L+ +QF+ M+PH+ DN+F+GF+V      S ++ IK+R  A+VYGK   MW+  + YL +IK+   ++H TV      N     K K P YV NHG L   +   LL ++ +FVGLGFPYEGPAPLEAIA+G +F NP+F        + FFK KPT+R++ SQHPY E  IGEP+ Y I+ NN   +++   KI++   F+ ++P+EFTE G LQR++   E Q FC           +WP   S  F LG  + SC++ C  ++L+CE S   R +N+   L + GV C++ K       P+YD     C  Q +  L+SC+    +  R C CR FI GQ ALC+ C+
Sbjct:   43 TEKESEILKNEIIQLSENYVRALARENSDIVDGPYAGRFTAYDLKKTMAVLLESMLERLNKLEIKINN--AINGTNGTNS-------NVTNGQSMR----SNYQLRAEDLIQGKVEQCDLTTQEKQLYPHCNTKIEWMKAMWKSDPCYQSYGVDGSICSFVMYLSEIEGWCPTKAWRGNIKPPKEDMSKVKFANVTTDLQALMKILVDP----NERQSYAWIRMRIRRLWDKWTGGITRLTKKQNLEGRRRKKILVHLGLLSKQSGWGFAENQFKGGPLGELVQWSDLLSTLFILGHDLIVTSETDQLAGILSKLPAANSPCQSRADLPVHIIYTDIVGLTQFRKHVKGGYAKFSCLLRIVDSFGTEPAYNHRVYAKAHKLV-TFWGGQNLQPQQFFTMFPHSPDNSFMGFLVEQHLNDSRVQDIKRRDQAVVYGKREYMWEGRQRYLEVIKNAQLDIHGTVYFDQPNNNTQGKKSKFPSYVTNHGFLNGEDLHYLLRQSKIFVGLGFPYEGPAPLEAIANGCVFINPRFKPPHSSKNTPFFKGKPTQRQVTSQHPYAEQFIGEPYVYTIDINNLNEVKDTVAKILENKKFQPYLPYEFTEEGMLQRMNAYIEHQNFCEFQK----RPAKWPPSSSIKFLLGEPDKSCQDVCWSKSLMCEPSHF-RELNSMDPLTKYGVSCKSGKSMSDIYYPAYDINTAECIIQKEEILFSCVGQSASLQRLCPCRTFIKGQSALCEECV 760          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. TrEMBL
Match: A0A2T7PXH7 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00719 PE=4 SV=1)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 292/725 (40.28%), Postives = 415/725 (57.24%), Query Frame = 2
Query:  212 LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYNK----FVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKKI-----KKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFI-----ERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNC 2344
            L+ EIL+LS+ YV  LA +  + VDGPY+GR T +DLKKT AVLL++I  RL  LEN  +N+T+ N   + N   V IV+          P + +  L   D++ G  EKC L  D K  +P C +KIEWMR  W+S  CY  +GVDGS CS I+YLSEVE +CP+  +   N +   +      +   L  LLD +     +  + +++MRI RLW K V        +    R     IL++ G LSK+S  K ++  F GGPLGE+VQWSDL+  L+ILGH++T+  E   +   L ++P    PCQT+    + I YTDI+G  Q   +    F KF CL RILD+FGT+P +N+  + K+  I  + W G  L L+QF+ M+PH+ DN+F+GF+V   +        +++ IALVYGK+  MW+  ++YL++I +Y E+H TV +   +  KLP YV+NHGIL  S+   LL +  VFVGLGFPYEGPAPLEAIA+GA+F NP+FN       ++FFK KPT+R++ SQHPY E  IG+P  Y I+ NN T + E  + I+++N F ++ P+E+TE G LQR+S   + Q FC        +V +WP   +  F L     SC + C  ++LICE +       E  + N   +        N+ Y      P+++     C  Q D  L+SC+   +N  R C CR +I GQ ALC  C
Sbjct:   21 LQKEILKLSQEYVRALAQENADIVDGPYAGRFTAFDLKKTIAVLLESILVRLERLEN-YLNITS-NGTFLQN---VPIVS----------PEERQIILSAQDLLSGKNEKCELTDDDKKIYPHCPNKIEWMRTMWKSDPCYEAHGVDGSECSFIMYLSEVEGWCPRKGWNRSNQTLSFEPKRYANITTELKGLLDLLVDPNERQGYAWIRMRITRLWDKWVNGMQNLASKQDLSRRTKHKILVHLGLLSKQSGWKFAEMQFKGGPLGELVQWSDLLSVLYILGHELTITSEAEQLVQMLSEVPEAKTPCQTRKELPVTIIYTDIVGLIQFKKRVKAGFAKFSCLFRILDSFGTEPAYNHHVFAKQNKIL-SSWGGLDLNLRQFFTMFPHSPDNSFMGFVVEHHLNDTVSEDQERKNIALVYGKNEYMWEGKKAYLDVIHEYLEIHGTVYQEQGAPSKLPPYVVNHGILAGSDLHTLLRKVKVFVGLGFPYEGPAPLEAIANGAVFLNPRFNPPHSSRNTKFFKGKPTQREVTSQHPYAEVFIGKPHIYTIDINNLTEVHEAVQAILRQNKFSAYTPYEYTEEGMLQRMSAYIQHQQFCDFQH----QVARWPPSSAVTFLLAQPGLSCSQACWAKDLICEPTHFLESNSEAALRNHSIICSSSSQSANIYY------PAFNAETGACIVQEDEALFSCVGGKDNIQRICPCRTYIPGQYALCVGC 719          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. TrEMBL
Match: A0A384AXD6 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A OS=Balaenoptera acutorostrata scammoni OX=310752 GN=MGAT5 PE=4 SV=1)

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 300/726 (41.32%), Postives = 427/726 (58.82%), Query Frame = 2
Query:  212 LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILD-LDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRL-DIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMK--------KIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            L+++IL+LSKRY+  LA + +N VDGPY+G +T YDLKKT AVLL NI +R+  LE+KV NL       IN +       +  NS      L +   ++  DII GAQEKC+L  +D    +P C+ KI+WMR  WRS  CY E GVDGS CS  IYLSEVE +CP L +R  N    +  NS+ E+ ++ + L   +      + F +M++RI+R+    ++A     ++ + ++   K + ++ G L+KES  KI++T FSGGPLGE+VQWSDLI SL++LGHDI +   L ++   + ++      C T +G+R+ ++ Y DI+G  Q    +   +V ++C+LR+LD+FGT+P FN+  Y  ++      W    L  +QFY M+PHT DN+FLGF+V   +         +IK++  +LVYGK  S WKN + YL+II  Y E+HATV     S   +P YV NHGIL   +   LL E  +FVGLGFPYEGPAPLEAIA+G  F NPKFN  +    + FF  KPT R+L SQHPY E  IG+P  + ++ +N+  + +  K I+ +     ++P+EFT  G LQR++   EKQ FC            WPS+ +    L     SC++ C ++ LICE SF +  +N   +L +  V C++ +       PS+DP  K C FQ D  L+SC  +   H R C CRDFI GQ ALCK+CL
Sbjct:   46 LREQILDLSKRYIKALAEENRNVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNLV------INGTG-----TNLTNSTTAVPSLVALEKINVADIINGAQEKCVLPPMDG---YPHCEGKIKWMRDMWRSDPCYAEYGVDGSACSFFIYLSEVENWCPHLPWRAKNPYEEADRNSLAEIRMDFNILYSMMK---KHEEFRWMRLRIRRMADAWIQAIKSLAEKQNLEKRKRKKVFVHLGLLTKESGFKIAETAFSGGPLGELVQWSDLITSLYLLGHDIRISASLAELKEIMKKVVGNRSGCPT-VGDRIVELIYIDIVGLAQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHANY-AQLKGHKTPWGKWNLNPQQFYTMFPHTPDNSFLGFVVEQHLNSSDIHHINEIKRQNQSLVYGKVDSFWKNKKLYLDIIHTYTEVHATVY--GSSTKNIPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFNPPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGQPHVWTVDLDNQEEVEDAVKAILSQK-IEPYMPYEFTCEGMLQRINAFIEKQDFCHGQV-------MWPSLSALQVKLAEPGQSCKQVCQEKQLICEPSFFQH-LNKDKDLLKYEVTCQSSEVAKDIVVPSFDPKSKHCVFQGDLLLFSCAGAHPRHRRICPCRDFIKGQAALCKDCL 741          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Cavefish
Match: mgat5 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase [Source:ZFIN;Acc:ZDB-GENE-060616-238])

HSP 1 Score: 513.842 bits (1322), Expect = 1.718e-171
Identity = 284/734 (38.69%), Postives = 411/734 (55.99%), Query Frame = 2
Query:  191 TKTDDEQLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCIL-DLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKK--------IKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALC--KNCL 2347
            T     QL+ +IL+LSKRY+  LA + +  +DGPY G +T YDLKKT AVLL NI  RL+ LE+KV ++  +N  + N +         N +        +   ++  D++ GAQEKC L  LD    FP C+ K++WM+  WRS  CYG  GVDGS CS  IYLSEVE +CP+L +R    +N     S+ EL   +S           ++ F +M +RI+R+    V A      +   QR   K IL++ G L+KES  KI++  FSGGPLGE+VQWSDLI +L++LGHDI +   + ++   + ++      C T+    +++ Y DI+G +Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QF  M+PHT DN+FLGF+V   +          IK++  +LVYGK  + WK+ + YL+II  Y E+H TV+    S + LP YV NHGIL   +   LL E  +FVGL FPYEGPAPLEAIA+G  F NPKF+  +    + FFK KPT R+L SQHPY E  IG+P  + ++ ++   +    + I+ +     ++P+EFT  G LQRV+   E Q FC            WP + +    L  V  SC++ C ++ LICE SF +  +N   +L + GV C+ V+       P++    + C  Q+D  L+SC  +  +  R C CRD++ GQ ALC  K CL
Sbjct:   38 THESSAQLRMQILDLSKRYIKALAEENQGVMDGPYVGTMTAYDLKKTLAVLLDNIMLRLSKLESKV-DIIIYNGSATNLT---------NGTATPAPSTTNAEKVNVADLLNGAQEKCELPQLDG---FPHCEGKLKWMKDMWRSDACYGNYGVDGSTCSFFIYLSEVENWCPRLPWR---TTNSEYRTSLEELYRMMS----------RREEFRWMMLRIKRMEEPWVSAIRSLATKQDLQRRKRKKILVHLGLLTKESGFKIAENAFSGGPLGELVQWSDLITTLYLLGHDIRISASIAELKEIMRKVMGNKSSCPTQGDKVVELIYIDIVGLSQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHAHYAQSKGHK-TPWGKWNLNPQQFNTMFPHTPDNSFLGFVVEQHLNASDIRHIDDIKRQNQSLVYGKVDNFWKDKKKYLDIIHSYTEVHGTVH--GTSTVHLPPYVKNHGILSGRDLQFLLRETKLFVGLSFPYEGPAPLEAIANGCAFLNPKFHPPKSSKNTDFFKGKPTLRELTSQHPYAEVYIGQPHVWTVDIDDPAEVERAIRAILSQK-IEPYLPYEFTCEGMLQRVNAFIENQDFCHGQV-------MWPPLSALQVKLAPVGKSCKQVCQEEQLICEPSFFQH-LNKDKDLARFGVECKTVESVGDIVVPAFSASARHCVLQSDLLLFSCAGAHHSLQRICPCRDYMKGQVALCKGKGCL 733          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Cavefish
Match: mgat5 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase [Source:ZFIN;Acc:ZDB-GENE-060616-238])

HSP 1 Score: 476.478 bits (1225), Expect = 1.021e-157
Identity = 258/662 (38.97%), Postives = 377/662 (56.95%), Query Frame = 2
Query:  191 TKTDDEQLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCIL-DLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKK--------IKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNR 2137
            T     QL+ +IL+LSKRY+  LA + +  +DGPY G +T YDLKKT AVLL NI  RL+ LE+KV ++  +N  + N +         N +        +   ++  D++ GAQEKC L  LD    FP C+ K++WM+  WRS  CYG  GVDGS CS  IYLSEVE +CP+L +R  N+++ S     +E   +L  L   +     ++ F +M +RI+R+    V A      +   QR   K IL++ G L+KES  KI++  FSGGPLGE+VQWSDLI +L++LGHDI +   + ++   + ++      C T+    +++ Y DI+G +Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QF  M+PHT DN+FLGF+V   +          IK++  +LVYGK  + WK+ + YL+II  Y E+H TV+    S + LP YV NHGIL   +   LL E  +FVGL FPYEGPAPLEAIA+G  F NPKF+  +    + FFK KPT R+L SQHPY E  IG+P  + ++ ++   +    + I+ +     ++P+EFT  G LQRV+   E Q FC            WP + +    L  V  SC++ C ++ LICE SF + +  ++
Sbjct:   38 THESSAQLRMQILDLSKRYIKALAEENQGVMDGPYVGTMTAYDLKKTLAVLLDNIMLRLSKLESKV-DIIIYNGSATNLT---------NGTATPAPSTTNAEKVNVADLLNGAQEKCELPQLDG---FPHCEGKLKWMKDMWRSDACYGNYGVDGSTCSFFIYLSEVENWCPRLPWRTTNVNDDSDKKGQSEYRTSLEELYRMMS---RREEFRWMMLRIKRMEEPWVSAIRSLATKQDLQRRKRKKILVHLGLLTKESGFKIAENAFSGGPLGELVQWSDLITTLYLLGHDIRISASIAELKEIMRKVMGNKSSCPTQGDKVVELIYIDIVGLSQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHAHYAQSKGHK-TPWGKWNLNPQQFNTMFPHTPDNSFLGFVVEQHLNASDIRHIDDIKRQNQSLVYGKVDNFWKDKKKYLDIIHSYTEVHGTVH--GTSTVHLPPYVKNHGILSGRDLQFLLRETKLFVGLSFPYEGPAPLEAIANGCAFLNPKFHPPKSSKNTDFFKGKPTLRELTSQHPYAEVYIGQPHVWTVDIDDPAEVERAIRAILSQK-IEPYLPYEFTCEGMLQRVNAFIENQDFCHGQV-------MWPPLSALQVKLAPVGKSCKQVCQEEQLICEPSFFQHLNKDK 672          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Cavefish
Match: mgat5 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase [Source:ZFIN;Acc:ZDB-GENE-060616-238])

HSP 1 Score: 428.328 bits (1100), Expect = 4.892e-139
Identity = 236/586 (40.27%), Postives = 341/586 (58.19%), Query Frame = 2
Query:  191 TKTDDEQLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCIL-DLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKK--------IKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNN----ETMIREICKKIIKKNAF 1897
            T     QL+ +IL+LSKRY+  LA + +  +DGPY G +T YDLKKT AVLL NI  RL+ LE+KV ++  +N  + N +         N +        +   ++  D++ GAQEKC L  LD    FP C+ K++WM+  WRS  CYG  GVDGS CS  IYLSEVE +CP+L +R  N+++ S     +E   +L  L   +     ++ F +M +RI+R+    V A      +   QR   K IL++ G L+KES  KI++  FSGGPLGE+VQWSDLI +L++LGHDI +   + ++   + ++      C T+    +++ Y DI+G +Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QF  M+PHT DN+FLGF+V   +          IK++  +LVYGK  + WK+ + YL+II  Y E+H TV+    S + LP YV NHGIL   +   LL E  +FVGL FPYEGPAPLEAIA+G  F NPKF+  +    + FFK KPT R+L SQHPY E  IG+P  + ++ ++    E  IR I  + + K+ +
Sbjct:   38 THESSAQLRMQILDLSKRYIKALAEENQGVMDGPYVGTMTAYDLKKTLAVLLDNIMLRLSKLESKV-DIIIYNGSATNLT---------NGTATPAPSTTNAEKVNVADLLNGAQEKCELPQLDG---FPHCEGKLKWMKDMWRSDACYGNYGVDGSTCSFFIYLSEVENWCPRLPWRTTNVNDDSDKKGQSEYRTSLEELYRMMS---RREEFRWMMLRIKRMEEPWVSAIRSLATKQDLQRRKRKKILVHLGLLTKESGFKIAENAFSGGPLGELVQWSDLITTLYLLGHDIRISASIAELKEIMRKVMGNKSSCPTQGDKVVELIYIDIVGLSQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHAHYAQSKGHK-TPWGKWNLNPQQFNTMFPHTPDNSFLGFVVEQHLNASDIRHIDDIKRQNQSLVYGKVDNFWKDKKKYLDIIHSYTEVHGTVH--GTSTVHLPPYVKNHGILSGRDLQFLLRETKLFVGLSFPYEGPAPLEAIANGCAFLNPKFHPPKSSKNTDFFKGKPTLRELTSQHPYAEVYIGQPHVWTVDIDDPAEVERAIRAILSQKVHKHIY 604          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Cavefish
Match: mgat5 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase [Source:ZFIN;Acc:ZDB-GENE-060616-238])

HSP 1 Score: 428.328 bits (1100), Expect = 4.892e-139
Identity = 236/586 (40.27%), Postives = 341/586 (58.19%), Query Frame = 2
Query:  191 TKTDDEQLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCIL-DLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKK--------IKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNN----ETMIREICKKIIKKNAF 1897
            T     QL+ +IL+LSKRY+  LA + +  +DGPY G +T YDLKKT AVLL NI  RL+ LE+KV ++  +N  + N +         N +        +   ++  D++ GAQEKC L  LD    FP C+ K++WM+  WRS  CYG  GVDGS CS  IYLSEVE +CP+L +R  N+++ S     +E   +L  L   +     ++ F +M +RI+R+    V A      +   QR   K IL++ G L+KES  KI++  FSGGPLGE+VQWSDLI +L++LGHDI +   + ++   + ++      C T+    +++ Y DI+G +Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QF  M+PHT DN+FLGF+V   +          IK++  +LVYGK  + WK+ + YL+II  Y E+H TV+    S + LP YV NHGIL   +   LL E  +FVGL FPYEGPAPLEAIA+G  F NPKF+  +    + FFK KPT R+L SQHPY E  IG+P  + ++ ++    E  IR I  + + K+ +
Sbjct:   38 THESSAQLRMQILDLSKRYIKALAEENQGVMDGPYVGTMTAYDLKKTLAVLLDNIMLRLSKLESKV-DIIIYNGSATNLT---------NGTATPAPSTTNAEKVNVADLLNGAQEKCELPQLDG---FPHCEGKLKWMKDMWRSDACYGNYGVDGSTCSFFIYLSEVENWCPRLPWRTTNVNDDSDKKGQSEYRTSLEELYRMMS---RREEFRWMMLRIKRMEEPWVSAIRSLATKQDLQRRKRKKILVHLGLLTKESGFKIAENAFSGGPLGELVQWSDLITTLYLLGHDIRISASIAELKEIMRKVMGNKSSCPTQGDKVVELIYIDIVGLSQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHAHYAQSKGHK-TPWGKWNLNPQQFNTMFPHTPDNSFLGFVVEQHLNASDIRHIDDIKRQNQSLVYGKVDNFWKDKKKYLDIIHSYTEVHGTVH--GTSTVHLPPYVKNHGILSGRDLQFLLRETKLFVGLSFPYEGPAPLEAIANGCAFLNPKFHPPKSSKNTDFFKGKPTLRELTSQHPYAEVYIGQPHVWTVDIDDPAEVERAIRAILSQKVHKHIY 604          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000016342.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002115.1:162667:399523:-1 gene:ENSAMXG00000015857.2 transcript:ENSAMXT00000016342.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 403.29 bits (1035), Expect = 1.811e-128
Identity = 236/709 (33.29%), Postives = 353/709 (49.79%), Query Frame = 2
Query:  350 NIFERLTNLENKVVNLTAFNKQSINNS-ADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNV---SQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYN----KFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPS-------SMKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCT----------------------QNSYEL------VEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
             + ER+  +   V N+    +Q + NS A   +V D  + Q                           D+    RFP+C  K++WMR  W S  CY   GVDGS CS +IYLSEVE +CP L +R H+   V   S          +LS LLD++ G G +++  FMK RI+RL ++   AA +   +   +    K IL++ GFL++ES    S     GGPLGE+VQW+D++ +L++LGH++ +   + ++  +L  +P     C        D+ YTD  G  Q+         K KC +R++DTFGT+P +N+  Y      + N W    L  +Q+  M+PHT DN+F+GF+          S+++ K R +A+VYGK  SMWK  E +L I+  Y E+H TV        ++P +V NHG+L       LL +A +F+G GFPYEGPAPLEAIA+G I+  PKF+        +FF+ KPT R++ SQHPY E  IG P    ++ NN        ++I++      ++P+E+T  G L+RV    + Q FC+                       NS  L        +  WP + +    +     SC E C   +L+CE +F  R +NN+  L +  + CE V+   +   P+Y   +  C  Q +  L+SC      + R C CRDF  GQ ALC++CL
Sbjct:   77 GLVERIQAIAQNVSNMAVRVEQILKNSMAASRVVRDGTSGQC--------------------------DVPRDPRFPDCPGKVDWMRARWTSDPCYAFYGVDGSDCSFLIYLSEVEWFCPPLTWRNHSSPPVLPKSPPKRQAAFRTDLSTLLDQV-GTG-KESLSFMKRRIRRLASQWATAAYRLDIKLHRRWREQKKILVHVGFLTEESGDVFSPKVLKGGPLGEMVQWADILTALYVLGHNLKISMSVKELQGFL-GVPPGRGSCPLTGPLPFDLIYTDYHGLQQMKQHMGLSLKKHKCHIRVIDTFGTEPAYNHEEYATLHGYRTN-WGYWNLNSRQYMTMFPHTPDNSFMGFVSEELNKTEKRSIQQNKVRNMAVVYGKEASMWKGKEKFLQILHRYMEVHGTVYYETQRPPEVPAFVKNHGLLPQQELQQLLRKAKLFIGFGFPYEGPAPLEAIANGCIYLQPKFHPPHSSLNHEFFRGKPTSREVSSQHPYAEQYIGRPHVMTVDYNNSDEFEAAVQEIMRLKV-EPYLPYEYTCEGMLERVHAYIQHQEFCSPEAPFPPVNASRVWPGGPFTRLPNSTLLGWAGNSTALPCWPPLSALRLMVSAEGQSCVEACQSSDLVCEPAFF-RFINNKEALSKLEIQCEVVELEMNHIFPAYSVTRGECGLQKETLLFSCAGFSAKYRRICPCRDFRKGQVALCRDCL 753          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Sea Lamprey
Match: MGAT5B (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B [Source:HGNC Symbol;Acc:HGNC:24140])

HSP 1 Score: 373.244 bits (957), Expect = 1.248e-119
Identity = 219/608 (36.02%), Postives = 316/608 (51.97%), Query Frame = 2
Query:  572 FPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQT-NSITELNL--NLSALLDKIDGKGNQDAFIFMKMRIQ---RLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYNK----FVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFI--VPSSMKKI---KKRKIALVYGKHISMWK--NSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNC 2344
            FP C DK+++++  W    CY   GV+GS CSII YL +VE +CP  +    N + +  T  S TE  +  ++S+LL   +     DA  FM+ R+Q   R W+ A       T   S  R     IL++ G L+ +S    +  T  GGPLGE+VQW+D + +L  LGH +++   LPD++  LL +P  N  C  +     D+ +TD +G  Q+       F ++ C  R++DTFGT+P FN+  Y  K   K + W    L+ +Q+  M+PHT DN+FLGF+  V S  KK+   K   +A+VYGK   MWK    E YL +I  +  +H TV     S   LPK+V NHG+L   +   LL  A +FVGLGFPYEGPAPLEAIA G +F  P+F+      ++ FFK KPT R + SQHPY E  IG P  ++++  N + +      I    A    +P+EFT  G L+RV      Q FC+          +WP   +          SC++ C  + L+CE SF   ++N +    + G+ C  V+       P++      C  Q +  L+SC  + E   R C CRDF  GQ ALC++C
Sbjct:    9 FPLCSDKVKYLQNTWTRDPCYSYYGVNGSTCSIISYLGQVEHFCPPRRQPGPNTTGILPTPASGTEAAMRRSVSSLLALTERYRAMDAVRFMERRLQQAERTWSTAAHELAARTNGTSRAR---MKILVHLGLLTGDSGRWFNSGTGQGGPLGELVQWADALAALHALGHSLSITATLPDLHR-LLGVPPGNGACPIEKALPFDLIFTDYLGIEQMSKSMGLSFREYACRYRVVDTFGTEPAFNHEAYATKNGFK-SEWGHWNLQPQQYMTMFPHTPDNSFLGFVSEVVSEKKKVTIPKDDHMAMVYGKKDEMWKAQGKEQYLKVISRHMAVHGTVG---GSLTSLPKFVHNHGLLSQRDIQLLLRRAKMFVGLGFPYEGPAPLEAIASGCVFLMPRFDPPHSSHSTAFFKGKPTSRLVTSQHPYAERFIGRPHVWMVDVGNLSEVEAAVIAIKSLPAVEPLLPYEFTAQGMLERVYAYLTHQDFCSPGP------QRWPPSSAMQAVASEGGVSCQDACWARGLVCEPSFFP-LVNTQDAFARLGLRCGAVERRASHLVPAFTHNGSHCLLQEETLLFSCAGAGET--RVCPCRDFRRGQVALCRDC 599          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003543.1 (pep scaffold:Pmarinus_7.0:GL476475:308158:335573:1 gene:ENSPMAG00000003237.1 transcript:ENSPMAT00000003543.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 364.77 bits (935), Expect = 5.187e-117
Identity = 202/570 (35.44%), Postives = 315/570 (55.26%), Query Frame = 2
Query:  686 EVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITV---LYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYNKFVKF-----KCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIV--------PSSMKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            +VE +CP+L +R+           + E+  +   L  ++    +++ F +MKMRI R+    + A    +++ + Q    K IL++ G L+KES  KI+++ FSGGPLGE+VQW D+I +L++LGH I +   + EL D+ N  L     + PC     +RL +  T+    N + N++        +C+LR+LD+FGT+P FN+  Y +    K   W    L  +QFY M+PHT DN+FLGF+V         + M+ +K++  +LVYGK  + WK    YL+II  Y E+H TV+    + + +P YV NHGIL       LL E  +FVGLGFPYEGPAPLEAIA+G +F NP+F   +    + FFK KPT R+L SQHPY E  IG+P  + I+ ++   +    ++I+ + A R F+  E+ ++ F+ R+ V ++   F T           WP + +    +     SC+  C +  LICE ++    +N   +L + GV C++ +       P+ +  +K C  Q D+ L+SC  S + H R C CRD++ GQ ALC++CL
Sbjct:    1 QVETWCPQLPWRK---KVFKPEGPLAEVKTDFKQLFHRM---ASREEFRWMKMRILRMEESWLAAVRSLSEKHNLQGRTRKKILVHLGLLTKESGFKIAESAFSGGPLGELVQWGDVISALYLLGHHIKLSVSVSELRDLGN--LSSCRVSTPCAYH--HRLHLVCTNGKSVN-LLNRWAMLLSRERRCMLRVLDSFGTEPEFNHAQYAQSRGHK-TPWGKWSLVPRQFYTMFPHTPDNSFLGFVVEQHLNSSDAAHMEDVKRQNQSLVYGKVDNFWKGKMQYLDIISKYTEIHGTVH---GATVNVPPYVKNHGILSGRELQFLLRETKLFVGLGFPYEGPAPLEAIANGCVFLNPRFRPPKSSKNTDFFKGKPTLRELTSQHPYAEVYIGKPHVWTIDIDDPQEVEAAVRQIVAQKA-RRFMSLEYPKSEFVFRIEVFSKSHNFGTMKLL-------WPPLSALQVKVAQPGQSCKHLCQESQLICEPTYFAH-LNKEQDLSRHGVECDSAEVQNEVFVPALESGRKKCLLQGDYLLFSCAGSHDTHRRICPCRDYMKGQVALCRDCL 546          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Sea Lamprey
Match: MGAT5B (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B [Source:HGNC Symbol;Acc:HGNC:24140])

HSP 1 Score: 362.844 bits (930), Expect = 2.359e-115
Identity = 219/627 (34.93%), Postives = 319/627 (50.88%), Query Frame = 2
Query:  572 FPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNS-----ITELNLNLSALLDKIDGKGNQDAFIFMKMRIQ---RLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYNK----FVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFI--VPSSMKKI---KKRKIALVYGKHISMWK--NSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRV-SVLTEKQGFCT--------QNSYELVEV--------DQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNC 2344
            FP C DK+++++  W    CY   GV+GS CSII YL +VE +CP  +    N + +  T          +  ++S+LL   +     DA  FM+ R+Q   R W+ A       T   S  R     IL++ G L+ +S    +  T  GGPLGE+VQW+D + +L  LGH +++   LPD++  LL +P  N  C  +     D+ +TD +G  Q+       F ++ C  R++DTFGT+P FN+  Y  K   K + W    L+ +Q+  M+PHT DN+FLGF+  V S  KK+   K   +A+VYGK   MWK    E YL +I  +  +H TV     S   LPK+V NHG+L   +   LL  A +FVGLGFPYEGPAPLEAIA G +F  P+F+      ++ FFK KPT R + SQHPY E  IG P  ++++  N + +      I    A    +P+EFT  G L+RV + LT + G            +SY  + V         +WP   +          SC++ C  + L+CE SF   ++N +    + G+ C  V+       P++      C  Q +  L+SC  + E   R C CRDF  GQ ALC++C
Sbjct:    9 FPLCSDKVKYLQNTWTRDPCYSYYGVNGSTCSIISYLGQVEHFCPPRRQPGPNTTGILPTPPSIGMVAAAMRRSVSSLLALTERYRAMDAVRFMERRLQQAERTWSTAAHELAARTNGTSRAR---MKILVHLGLLTGDSGRWFNSGTGQGGPLGELVQWADALAALHALGHSLSITATLPDLHR-LLGVPPGNGACPIEKALPFDLIFTDYLGIEQMSKSMGLSFREYACRYRVVDTFGTEPAFNHEAYATKNGFK-SEWGHWNLQPQQYMTMFPHTPDNSFLGFVSEVVSEKKKVTIPKDDHMAMVYGKKDEMWKAQGKEQYLKVISRHMAVHGTVG---GSLTSLPKFVHNHGLLSQRDIQLLLRRAKMFVGLGFPYEGPAPLEAIASGCVFLMPRFDPPHSSHSTAFFKGKPTSRLVTSQHPYAERFIGRPHVWMVDVGNLSEVEAAVIAIKSLPAVEPLLPYEFTAQGMLERVYAYLTHQVGLSLNHRGSSRDMSSYHRLFVKDFCSPGPQRWPPSSAMQAVASEGGVSCQDACWARGLVCEPSFFP-LVNTQDAFARLGLRCGAVERRASHLVPAFTHNGSHCLLQEETLLFSCAGAGET--RVCPCRDFRRGQVALCRDC 624          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007392.1 (pep scaffold:Pmarinus_7.0:GL476367:323142:331416:-1 gene:ENSPMAG00000006665.1 transcript:ENSPMAT00000007392.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 1.083e-34
Identity = 81/281 (28.83%), Postives = 132/281 (46.98%), Query Frame = 2
Query:  572 FPECDDKIE-WMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYC----PKLKFREHNMSNVSQTNSITELNLNLSALLDK-IDGKGNQDAFIFMKMRI---QRLWTKAVE-AAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKI-SDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYN----KFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHT 1369
            FP C  K+E W+++ W    CY   GVDGS+CS + YL  VE +C              +  ++ +   EL  ++  L    +    +  A  FM  R+   +R+W  A   A I     P  Q    K IL++ G L +     +  +    GGPLGE+VQW+D + +L+ LGH I++   L D+   L+ +P     C        D+ YTD +G  Q+       F+ + C  R++D+FGT+P +N+  Y ++I +K       L    Q+  ++P +
Sbjct:    9 FPLCQHKVELWLKRVWAQDPCYAFYGVDGSVCSALDYLGTVEHFCPPTPVTPVTPVTPATPATRISEAAELRSDVEPLAAAMVAAHSHLPAVTFMASRLRRMRRMWKSAASNATIAAPSTPRAQ----KKILVHLGLLVEGDGGGLFGEQVTRGGPLGELVQWADALGALYTLGHSISLSMSLTDLKR-LVAVPPGKGSCPITTPLPFDLVYTDYLGLAQMSRNMGLSFLHYHCRYRVVDSFGTEPAYNHAAYAERIGLKSAWGSWGLQPHTQYLTVFPES 284          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007397.1 (pep scaffold:Pmarinus_7.0:GL476367:445169:445646:-1 gene:ENSPMAG00000006680.1 transcript:ENSPMAT00000007397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.4394 bits (106), Expect = 1.333e-6
Identity = 23/73 (31.51%), Postives = 35/73 (47.95%), Query Frame = 2
Query: 1760 PTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFC 1978
            P   +L SQHPY+E  +G P  + ++ ++   +    +  I  ++    VP EFT  G LQRV      Q  C
Sbjct:    1 PPLPQLTSQHPYVETLVGRPHVWTVDASDPAEVARAVRA-IAHSSVTPHVPLEFTAEGTLQRVDAYLRHQWHC 72          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Nematostella
Match: EDO49391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB4])

HSP 1 Score: 455.292 bits (1170), Expect = 4.585e-149
Identity = 270/737 (36.64%), Postives = 396/737 (53.73%), Query Frame = 2
Query:  197 TDDEQLKDEILELSKRYVYVLASQQK-NDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYG-ENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDA--FIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPN-FNVPCQTKLGNRLDIFYTDIIGFNQIYNKFVKF----KCLLRILDTFGTQPIFNNPFYLKKINIKPNG----WMGKLLELKQFYNMYPHTDDNTFLGFIV---PSSMKKIKKRKI-ALVYGKHISMWKN--SESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPA--NPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNC 2344
            +  + LK  I+ LSK Y+  LA ++    +DG  S +    DLKK  AVLLQ++ ER+  LE +V  +       +N++ +  I+     S      L++   L  ++    +   C++  D    +PEC  K+ WMR  W++H+CY  ++GV+G+ICS ++YLSEVE +CPK   R    S  +   +    +L+ S +   +    +QD   F ++K RI ++W + + A     K+   ++   K IL++ G L+ E  L  +     GGPLGE+VQWSDLI SL++LGHD+TV  ++P +     ++      PC T + N  D+ Y D  G  Q+  K  +F    KC  RI+D+FGT+  FN   + +K+   P G    W    L LKQF  M+PH+ DN+FLGF+V   P+     KK+K  ALVYGKH  MWK+    S+L++I  Y E+HATV      K  +P YVINHG+L       LL ++M+FVGLGFPYEGPAPLEAIAHG  F N K++  +    + FFKDKPT R++ SQHPY E  IG+P+ Y ++ N+   I  + K+I+       ++P+EFT  G L+R+ V  E Q FC QN         WP + +     G +  SC+ETCH   L+CE  +    +N +  + + G  C   +    P+   P Y      C  Q  + L+SC  +     R C CRDF  GQ ALC  C
Sbjct:   42 SQPDYLKGRIIHLSKEYIRALAREKGVYGIDGQPSTQQGVGDLKKATAVLLQSMLERIHVLEKQVEGVI------VNSTLEFEILASQIKS------LNTTFSLHLSNHSYVSANSCVIPDDPS--YPECRQKVMWMRNFWKTHECYAKDHGVNGTICSFLVYLSEVENWCPKFPGRMKPTSRATTEGA----DLHRSDVQGLLGLLNDQDPIKFKWIKNRINQMWPQWLSALEDLKKKRDLKKIKQKKILVHIGLLANERALHFAANADKGGPLGELVQWSDLIASLYLLGHDVTVTADIPRLQGIFGKLRGPAKKPCPTTIKNDYDLIYLDYYGVKQMQTKVGQFTQSFKCKFRIVDSFGTEAQFNYAGFTEKV---PGGSMALWGRHNLNLKQFMTMFPHSPDNSFLGFVVGEEPTPDPHPKKKKARALVYGKHYYMWKDLKQRSFLDVINKYMEIHATVG--GGIKKWVPSYVINHGVLPSLEVQKLLQDSMIFVGLGFPYEGPAPLEAIAHGCFFLNTKYHPPRNRINTPFFKDKPTLRQITSQHPYAEDYIGQPYVYTVDINDLNKIEAVMKEIMMAEPVSPYLPYEFTHKGMLERLHVFIENQNFCGQN--------LWPPLNALQARKGAMGSSCKETCHSLGLVCEPQYFP-AINTKERMTRSGFPCNTTRVEDMPSLVAPGYRDDPPVCLRQAQNLLFSCTANSPTTKRLCPCRDFKKGQVALCSKC 746          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Nematostella
Match: EDO37581 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF96])

HSP 1 Score: 359.377 bits (921), Expect = 2.775e-114
Identity = 218/603 (36.15%), Postives = 314/603 (52.07%), Query Frame = 2
Query:  599 WMRQHWR-SHKC-YGENGVDG-SICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEA--AIQFTKQPSFQRPIVKNILLYTG-FLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLG-NRLDIFYTDIIGF----NQIYNKFVKFKCLLRILDTFGTQPIFN--NPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIV--PSSMKKI------KKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNC 2344
            WM+  W+  + C   E+ VD   +CSIIIYLSEVE +CP L  R     N         L      L+D++     QD + +M+ RI+R+W   +    ++     P  + P VK I LY G F +  +  +     FSG PLGE+VQWSD+I  L ILGH + +     ++     Q+      C +K   +  D+ +TD +G      ++   F +++C LRILD+FGT+  FN  NP   + I  K + W  + L L+QF  M+PHT DNTFLGF+V  P+++ K        K+ I LVYGK    W   ++YL ++  + ELH TV  +  + +  PK + NH I+   +Y   L    V+VGLGFPY+GPAPLEAIA G++F N K +       + FFK+KPT RKL SQHPY E  IG+P+ Y ++ +N   +    K+I+     + ++PFE+T  G L+RV+ L   Q FC   S       +WP I       G+  +SC +TC  + L+C+ +F    +N     Q  G+ C +         PSY     +C  Q    L+SC DS   + R C CRDF   Q ALCKNC
Sbjct:    1 WMKSRWQDQYLCIVEEHKVDPFDMCSIIIYLSEVEAWCPILPARRKLPQNAPARRKKAFLERANHNLMDRM----KQDHWRWMRQRIKRMWPLWINGLESLLGKNHPVEEHP-VKKIFLYMGSFANNPAWFR---QAFSGAPLGELVQWSDVIACLTILGHQVVISTRKEELRESTKQVLGQPSSCPSKRREDEYDLVFTDYVGLAFMQKELGPNFSQYRCRLRILDSFGTEAQFNYFNPD--RPITKKTSSWGHQNLHLQQFMTMFPHTQDNTFLGFVVEAPTNITKPVLDPPPGKKPIGLVYGKDSRFWLGKDNYLKVLAKHLELHGTVVGSRMAAV--PKSIKNHRIMNGRDYQAFLRSVKVYVGLGFPYDGPAPLEAIAQGSVFLNAKLDPPHSRDNTAFFKEKPTARKLSSQHPYAEEFIGKPYVYTVDISNMDEVEGAIKEILTTKV-KPYIPFEWTTQGMLERVNALVNNQNFCDHTS-------RWPPIEELKLIQGLETESCTQTCKAKGLLCDPAFFPD-INISKSFQTLGIKCSSEMSKDSLHAPSYSTIDDSCLLQRSALLFSCGDSSPIYRRVCPCRDFQPQQVALCKNC 582          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Nematostella
Match: EDO45788 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRM8])

HSP 1 Score: 328.561 bits (841), Expect = 7.819e-103
Identity = 194/578 (33.56%), Postives = 302/578 (52.25%), Query Frame = 2
Query:  662 CSIIIYLSEVEQYCPKLKFREHNMSNVSQTNS---ITELNLNLSALLDKIDGKG-----NQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTG-FLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDV-NNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGF----NQIYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKK---IKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNC 2344
            CSI+ YLSEVE +CP +    H  +N + T S   +        A + + D +G         + +++MR +  W + VE+      + + +    K I L+ G F++  +K    D  F GGPLGE+VQW+D+I SL+ILGHD+ +   L ++     L + ++    +   G   D   +D+ G      ++   +  + C   +LD+FGT P FN   Y + I    +GW  + +  +Q   MYPH+ DN F+GF VP S +K    KK+  ALVYGK    +++   YL+ +  +FE+HA +     S L  P Y+INHGI+  S    ++ E+ VF+GLGFP+EGPAPL+AIA+G  + NPK    Q    + FF+DKPT RKL SQ+PY E  IG PF Y I+ NNET + +  ++I+        +P+EF+  G LQR++   +   FC           +W  +       G    SC++ C ++ L+CE SF  + +N+  +L++ G+ C++ K       P+ +    +C  Q    L+SC+    +  R C CR +   Q ALCKNC
Sbjct:    1 CSILKYLSEVEPWCPPI----HTKTNTAPTQSKPMVKSFYSATGASVARTDIEGLMKLLRIKEWAWIRMRAKSFWNEWVESYRNLETKQNMRGRQRKRIFLFMGAFIA--NKFFFEDA-FKGGPLGELVQWTDVICSLYILGHDLVISSSLEELRQGKFLTLHDYGCAVKDVKGRDFDFIISDVTGSYILEMELGPTYWHYTCKQLLLDSFGTDPEFNYDLYKEAIPGGRSGWANRNVHQQQLMTMYPHSPDNLFMGFAVPQSARKERPTKKKAQALVYGKQSVYYRDKRQYLDTLHKHFEIHANIAGTVCSLL--PDYIINHGIVNGSTLVKIIQESKVFIGLGFPFEGPAPLDAIANGCFYINPKLIPYQSRENAAFFRDKPTFRKLTSQNPYAEEFIGRPFVYTIDMNNETEVEKTIQEILATKEI-PHLPYEFSLEGMLQRINYFMKNLDFCNIGK-------EWMPLSEMLTVKGREGQSCKDACFQKGLLCEPSFFPQ-LNSVKQLKRNGMRCKSYKSLETLYAPASNSTDGSCLLQEQTLLFSCVARDSHVTRLCPCRTYQKEQVALCKNC 560          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Nematostella
Match: EDO45819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRT5])

HSP 1 Score: 198.749 bits (504), Expect = 9.642e-58
Identity = 102/271 (37.64%), Postives = 149/271 (54.98%), Query Frame = 2
Query: 1532 ENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNC 2344
            +++D +  +PKYV NHG L       LL +  VF+GLGFPYEGPAPLEAI  G +F N KF+       + FFK+KPT RK+ SQHPY E  IG+P  Y I+  N T++    ++I+++    +++P E+T  G L+RV+   E   FC  N+        WP +     F+     SC++ C  + L+CE+S+    +N   ++++  + C   ++      PSY     TC  QT   L+SC+ + E H R C CRDF   Q ALCK C
Sbjct:   30 QSDDEQDYIPKYVKNHGYLRSPQLQKLLKQTKVFIGLGFPYEGPAPLEAIQSGCVFLNAKFDPPHDRVNTPFFKNKPTLRKVTSQHPYAEEFIGKPHVYTIDITNTTVVEAAMQEILQQQV-NAYLPLEWTPEGMLERVNTYVEHVDFCDINA------KPWPPLDQKQVFVSQSGQSCKDLCRSKGLVCESSYFVN-INTADQIKRLNLTCRKEEFAAALHAPSYGHDGHTCILQTHPLLFSCVYAKEGHSRICPCRDFQQQQVALCKKC 292          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Nematostella
Match: EDO45859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRN7])

HSP 1 Score: 132.88 bits (333), Expect = 3.362e-35
Identity = 78/237 (32.91%), Postives = 110/237 (46.41%), Query Frame = 2
Query: 1634 VGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNC 2344
            +GLG P E  APL A++ G +F NPKF+  +    +    DKP+ RKL SQ PY+E  + +P +  ++  N + I    K+ I K   R  +PFEFT  G L+R++     Q FC QNS       QWP        +    DSC +TC    L+CE      + + R+        C   + +     P+       C  Q    LYSC  S  ++ R C CR     Q+ALC NC
Sbjct:    1 MGLGSPLEDMAPLRALSKGCVFINPKFDPPRDRLNTPELADKPSLRKLTSQQPYLEKFVAKPHAVTLDLGNSSQIEAAIKR-IAKTKVRPIIPFEFTTEGLLERLNAYIINQDFC-QNS-------QWPPATELRVKISFPGDSCIKTCSDSGLVCEPELFHAIESRRIH------GCRIKELHKLLVAPAKAFNSTVCMLQKQPLLYSCSASDASYRRVCPCRTRHPQQRALCANC 222          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Medaka
Match: mgat5 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase [Source:NCBI gene;Acc:101168186])

HSP 1 Score: 530.02 bits (1364), Expect = 1.464e-177
Identity = 279/725 (38.48%), Postives = 412/725 (56.83%), Query Frame = 2
Query:  212 LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILD-LDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQ----IYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKK--------IKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            L+ +IL+LSKRY+  LA + ++ +DGPY G +T YDLKKT AVLL NI  RL  LE+KV N+      ++ N         +N  ++           +  D++ GAQE+C L  LD    FP C+ K++WM++ WRS  CY   GVDGS CS  IYLSEVE +CP+L +R   +++ +      E+  +  +L   +     ++ F +M +RI+R+    V A      + +  +   K IL++ G L+KES  KI++  FSGGPLGE+VQWSDLI +L++LGHD+ +   L ++   + ++      C T+    +++ Y DI+G  Q    +   +V ++C+LR+LD+FGT+P FN+  Y +    K   W    L  +QF  M+PHT DN+F+GF+V   +          IK++  +LVYGK  + WK+ + YL+II  Y E+H TV+    S + LP YV NHGIL   +   LL E  +FVGL FPYEGPAPLEAIA+G  F NPKFN  +    + FFK KPT R+L SQHPY E  IG+P  + ++ +N   +    + I+ +     ++P+EFT  G LQRV+   EKQ FC            WP + +    L     SC++ C +Q LICE SF +  +N   +L + GV C+ V+ +     P+Y   +K C  Q+D  L+SC  + ++  R C CRD++ GQ ALCK+CL
Sbjct:   46 LRQQILDLSKRYIKALAEENQSVMDGPYVGTMTAYDLKKTLAVLLDNIMLRLGRLESKVDNIFNGTGGNLTNGTSTATPGSSNAEKV-----------NVADLLTGAQERCELPPLDG---FPHCESKLKWMKEMWRSDACYSNYGVDGSTCSFFIYLSEVENWCPRLLWRTKILADEADQRGQAEIRTSFESLYRSMS---QREEFRWMMLRIKRMAEPWVSAIRSLASKQNLAKRRRKKILVHLGLLTKESGFKIAENAFSGGPLGELVQWSDLITTLYLLGHDVRISASLAELKEIMRKVMGNKSSCPTQGDRVVELIYIDIVGLTQFKKTLGPSWVHYQCMLRVLDSFGTEPEFNHAHYAQSKGHK-TPWGKWNLNPQQFNTMFPHTPDNSFIGFVVEQHLNASDIRHIDDIKRQNQSLVYGKVDNFWKDKKKYLDIIHSYMEVHGTVH--GTSNVHLPSYVKNHGILSGRDLQFLLRETKLFVGLSFPYEGPAPLEAIANGCAFLNPKFNPPKSSKNTDFFKGKPTLRELTSQHPYAEVYIGQPHVWTVDIDNPAEVERALRSILSQK-IEPYLPYEFTCEGMLQRVNAFIEKQDFCHGQV-------MWPPLSALQVKLAEPGQSCKQVCQEQQLICEPSFFQH-LNKDKDLDRWGVACQTVESSADTVVPAYSESRKHCVLQSDLLLFSCAGAHQSLRRVCPCRDYMKGQVALCKDCL 741          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Medaka
Match: MGAT5B (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B [Source:NCBI gene;Acc:101173907])

HSP 1 Score: 404.831 bits (1039), Expect = 8.403e-129
Identity = 238/681 (34.95%), Postives = 347/681 (50.95%), Query Frame = 2
Query:  437 VHIVNDNNNSQILRNPLDSKSHLDFTDIIK-GAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITE-------LNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYN----KFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKKIKKRKI--------ALVYGKHISMWKNS-ESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCT-----------------QNSYELVEVD------QWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            +  +  N ++  +R     +S +  T +++ G   +C +  D+  R+PEC  K++WMR  W S  CY   GVDGS CS +IYLSEVE +CP L +R H+ S  +Q +  T+          +LS LLD+I G   +++  FMK RI+RL  +   AA +   +   +    K IL++ GFL++ES    S     GGPLGE+VQW+D++ +L +LGH++ +   + D+  +L  +P     C        D+ YTD  G  Q+         K KC +R++DTFGT+P +N+  Y      + N W    L  +Q+  M+PHT DN+F+GF V   +   +KR I        A+VYGK  SMWK   ES+L I+  Y E+H TV        ++P YV NHG+L       LL +A +F+G GFPYEGPAPLEA+A+G IF  PKF         +FF+ KPT R+++SQHPY E  IG P    ++ NN        K+I++    + ++P+E+T  G L+RV    + Q                     QNS  LV          WP + S          SC E C     ICE +   R +NN+  L+   V CE V    +   P++   ++ C  Q D  L+SC      + R C CRDF  GQ ALC++CL
Sbjct:  114 IQAIAQNVSNMAVRVEQILQSSMVHTRVVRDGTSSQCDIPRDN--RYPECPGKVDWMRARWTSDPCYAFYGVDGSDCSFLIYLSEVEWFCPPLPWRNHS-SPPTQHSQYTKSPKRQAAFRTDLSMLLDQIGG--GKESLSFMKRRIRRLTQQWATAASRLEAKLGQRWRDQKKILIHVGFLTEESGDVFSPKVLKGGPLGEMVQWADILTALHVLGHNLKISMSVKDLQGFL-GVPPGRGSCPLTGPLPFDLIYTDYHGLQQMKQHMGLSLKKHKCHIRVIDTFGTEPAYNHEEYATLHGYRTN-WGYWNLNSRQYMTMFPHTPDNSFMGF-VSEELNATEKRSIQQNKVNNMAVVYGKEASMWKQGKESFLEILHRYMEVHGTVYYETQRPPEVPAYVKNHGLLPQHELQQLLRKAKLFIGFGFPYEGPAPLEAVANGCIFLQPKFQPPHSSLNHEFFRGKPTSREVFSQHPYAEQYIGRPHVMTVDYNNSLEFESAIKEIMRSKV-QPYLPYEYTCEGMLERVHAYIQNQVTIPSCDSNLLTTTGPLFVPLQNSTALVWASDVRAPTAWPPLSSLRLLASQEGQSCVEACGLTGFICEPAHF-RFINNKEALRGLEVQCEVVDSEINHILPAFSVMRRECGLQRDPLLFSCAGHSPKYRRLCPCRDFRRGQVALCRDCL 784          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Medaka
Match: ENSORLT00000015586.2 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B [Source:NCBI gene;Acc:101163172])

HSP 1 Score: 396.356 bits (1017), Expect = 2.182e-125
Identity = 228/648 (35.19%), Postives = 336/648 (51.85%), Query Frame = 2
Query:  527 GAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITE--LNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYN----KFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPS-------SMKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQ-------NSYE---------------------LVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            GA  +C +  D   R+P+C  K++WMR  W S  CY   GVDGS CS +IYLSEVE +CP L +R    +   +  +  +     ++ ALL+++ G G +++  FMK RI+RL  + V AA +  ++   +    K IL++ GFL++ES    S     GGPLGE+VQW+D++ +L +LGH++ +   L +++ +L  +P     C        D+ YTD  G  Q+         K KC +R++DTFGT+P +N+  Y      + N W    L  +Q+  M+PHT DN+F+GF+           +++ K   +A+VYGK  SMWK+ E +L ++  Y E+H TV        ++P +V NHG+L       LL +A VF+G GFPYEGPAPLEAIA+G IF  PKF   +    ++FF+ KPT RK+ SQHPY E  IG+P    I+ NN          I+K N    F+P+E+T  G L+R+    + Q FC+        NS E                     ++    WP + +      +   SC E C  + L CE +F  R +N +   +  G  CE V+   +   P++      C  Q D  L+SC  S   H R C CRD  +GQ ALCK CL
Sbjct:  159 GAFGQCEIPKDP--RYPDCTSKMDWMRARWTSDPCYAFYGVDGSDCSFLIYLSEVEWFCPPLVWRNQTTTPTVKPLARKQAVFQSDIGALLEQV-GTG-KESLSFMKRRIRRLAAQWVSAARRLDEKLRNRWRDKKKILVHIGFLTEESGDVFSPKVLKGGPLGEMVQWADIVTALHVLGHNVKISVSLKELHGFL-GVPPGRGSCPLTGALPFDLIYTDYHGLQQMKQHMGLSLRKHKCHIRVIDTFGTEPAYNHEEYATLHGYRTN-WGYWNLHGQQYMTMFPHTPDNSFMGFVAEELNETERLYIQRNKVNNMAVVYGKDASMWKDKEKFLAVLNRYMEIHGTVYYETQRPPEVPAFVKNHGLLPQQELQQLLRKAKVFIGFGFPYEGPAPLEAIANGCIFLQPKFKPARSSLNNEFFRGKPTSRKVSSQHPYAEQYIGKPHVITIDFNNSAEFDAAIHDIMKINV-EPFLPYEYTCEGMLERLHAYIQNQDFCSPEVPFPPVNSSEALLERFFIREPNSRILSWASSIISFPSWPPLTALRLLTSLQGQSCVEACQSKGLTCEPAFY-RFINIKEAFKALGFQCEVVESEMNHLFPAFSTEHGECSLQVDPLLFSCAGSSAKHQRLCPCRDHRDGQVALCKECL 798          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Medaka
Match: ENSORLT00000037856.1 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B [Source:NCBI gene;Acc:101163172])

HSP 1 Score: 392.119 bits (1006), Expect = 9.108e-124
Identity = 229/651 (35.18%), Postives = 336/651 (51.61%), Query Frame = 2
Query:  527 GAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITE--LNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYN----KFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPS-------SMKKIKKRKIALVYGKHISMWKNS---ESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQ-------NSYE---------------------LVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            GA  +C +  D   R+P+C  K++WMR  W S  CY   GVDGS CS +IYLSEVE +CP L +R    +   +  +  +     ++ ALL+++ G G +++  FMK RI+RL  + V AA +  ++   +    K IL++ GFL++ES    S     GGPLGE+VQW+D++ +L +LGH++ +   L +++ +L  +P     C        D+ YTD  G  Q+         K KC +R++DTFGT+P +N+  Y      + N W    L  +Q+  M+PHT DN+F+GF+           +++ K   +A+VYGK  SMWK S   E +L ++  Y E+H TV        ++P +V NHG+L       LL +A VF+G GFPYEGPAPLEAIA+G IF  PKF   +    ++FF+ KPT RK+ SQHPY E  IG+P    I+ NN          I+K N    F+P+E+T  G L+R+    + Q FC+        NS E                     ++    WP + +      +   SC E C  + L CE +F  R +N +   +  G  CE V+   +   P++      C  Q D  L+SC  S   H R C CRD  +GQ ALCK CL
Sbjct:  150 GAFGQCEIPKDP--RYPDCTSKMDWMRARWTSDPCYAFYGVDGSDCSFLIYLSEVEWFCPPLVWRNQTTTPTVKPLARKQAVFQSDIGALLEQV-GTG-KESLSFMKRRIRRLAAQWVSAARRLDEKLRNRWRDKKKILVHIGFLTEESGDVFSPKVLKGGPLGEMVQWADIVTALHVLGHNVKISVSLKELHGFL-GVPPGRGSCPLTGALPFDLIYTDYHGLQQMKQHMGLSLRKHKCHIRVIDTFGTEPAYNHEEYATLHGYRTN-WGYWNLHGQQYMTMFPHTPDNSFMGFVAEELNETERLYIQRNKVNNMAVVYGKDASMWKVSKDKEKFLAVLNRYMEIHGTVYYETQRPPEVPAFVKNHGLLPQQELQQLLRKAKVFIGFGFPYEGPAPLEAIANGCIFLQPKFKPARSSLNNEFFRGKPTSRKVSSQHPYAEQYIGKPHVITIDFNNSAEFDAAIHDIMKINV-EPFLPYEYTCEGMLERLHAYIQNQDFCSPEVPFPPVNSSEALLERFFIREPNSRILSWASSIISFPSWPPLTALRLLTSLQGQSCVEACQSKGLTCEPAFY-RFINIKEAFKALGFQCEVVESEMNHLFPAFSTEHGECSLQVDPLLFSCAGSSAKHQRLCPCRDHRDGQVALCKECL 792          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Medaka
Match: ENSORLT00000009000.2 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B [Source:NCBI gene;Acc:101162079])

HSP 1 Score: 348.977 bits (894), Expect = 1.263e-108
Identity = 193/553 (34.90%), Postives = 280/553 (50.63%), Query Frame = 2
Query:  527 GAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSI----TELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFN-VPCQTKLGNRLDIFYTDIIGFNQIYNK----FVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMK-----------KIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERM 2125
            G  EKC  D+ +   +P C +K E+++ HW S  CY   GVDG+ CSI+ YLS++E +CP    R H+     Q   +      +  +LS+L +++    +  A  F++ R++R+  + ++A ++  +  S        +LLY G L+ ++          GGPLGE+VQW+DL   L ILGH +T       ++  +   P     P Q  L    D+ YTD  G   ++      F  +KC  RILD+FGT+P FN   Y +    K   W    L   Q+ NM+PHT DN+FLGF+   ++K             +K +IA+VYGK   MW+    Y+ II +  E H TV + +     LP +V NHG+L    +  LL  A VF+GLGFPYEGPAP+EAIA G IF  P+F+       + F+K KPT RK+ SQHPY E  IG+P+   ++  N T +RE  K I+     + F P EFT  G L+RV      Q FC+        V  WP   +    LG +  SC   C   +L CE +    +
Sbjct:  135 GFTEKC--DMPTDPAYPVCAEKTEFLQAHWESDPCYAFYGVDGTTCSILSYLSQIENFCPPRPGRNHSSLPWHQKTHLNAKTAHIRDSLSSLYEELSNSSSL-AIKFIRSRVERMSERWIKAGLRMKQNGSDTGSAELKVLLYPGALAGKAGQHFEAMVERGGPLGELVQWADLSACLTILGHHLTFSSSQRQLHRLIGAAPGHGGCPIQRPL--MFDLIYTDYHGLAHLHGAMGLAFNHYKCRFRILDSFGTEPTFNLASYAQSRGYK-TLWGSWGLRPLQYMNMFPHTPDNSFLGFVSEEALKTEKSKDRLEPESYRKERIAVVYGKQDYMWQGKSEYVRIISEELETHGTVYQASHHSSNLPSFVKNHGLLTQEQFLKLLHRAKVFIGLGFPYEGPAPIEAIALGCIFLQPRFDPPHTSDNNNFYKGKPTTRKISSQHPYAEQFIGKPYVLTVDMTNTTAVREAVKSILNTEV-KPFTPREFTCVGMLERVHSYITYQNFCS------TSVPTWPPESALKVHLGPLGQSCVSVCQHSSLWCEPALFHHL 674          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Planmine SMEST
Match: SMESG000015150.1 (SMESG000015150.1)

HSP 1 Score: 1503.03 bits (3890), Expect = 0.000e+0
Identity = 756/762 (99.21%), Postives = 760/762 (99.74%), Query Frame = 2
Query:   62 MSTKRHYRNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXYACNKTKTDDEQLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            MSTKRHYRNFSKSIKSLSSKHLLIIIVITIIIWLCLLIYACNKTKTDDEQLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSI+ELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGIL DSNYTNLLD+AMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREIC+KIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFC+Q SYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL
Sbjct:    1 MSTKRHYRNFSKSIKSLSSKHLLIIIVITIIIWLCLLIYACNKTKTDDEQLKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSISELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILLDSNYTNLLDQAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICEKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCSQTSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 762          
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Planmine SMEST
Match: SMESG000015150.1 (SMESG000015150.1)

HSP 1 Score: 1498.41 bits (3878), Expect = 0.000e+0
Identity = 756/763 (99.08%), Postives = 760/763 (99.61%), Query Frame = 2
Query:   62 MSTKRHYRNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXYACNKTKTDDEQLK-DEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 2347
            MSTKRHYRNFSKSIKSLSSKHLLIIIVITIIIWLCLLIYACNKTKTDDEQLK DEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSI+ELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGIL DSNYTNLLD+AMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREIC+KIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFC+Q SYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL
Sbjct:    1 MSTKRHYRNFSKSIKSLSSKHLLIIIVITIIIWLCLLIYACNKTKTDDEQLKVDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFERLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDFTDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSICSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSISELNLNLSALLDKIDGKGNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSKESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLLQIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYNKFVKFKCLLRILDTFGTQPIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSMKKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLPKYVINHGILLDSNYTNLLDQAMVFVGLGFPYEGPAPLEAIAHGAIFFNPKFNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIREICEKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCSQTSYELVEVDQWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGVWCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDFINGQKALCKNCL 763          
The following BLAST results are available for this feature:
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MGAT50.000e+040.63alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
MGAT50.000e+040.63alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
MGAT5B4.120e-13034.60alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
MGAT5B4.192e-13034.60alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
MGAT5B4.809e-12834.50alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
back to top
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gly-21.526e-12036.41Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
back to top
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mgat54.152e-17739.40alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
MGAT5B1.083e-8034.02mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acet... [more]
ccdc1265.705e-1040.24coiled-coil domain containing 126 [Source:ZFIN;Acc... [more]
ccdc1265.705e-1040.24coiled-coil domain containing 126 [Source:ZFIN;Acc... [more]
back to top
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
socs40.000e+039.97suppressor of cytokine signaling 4 [Source:Xenbase... [more]
socs41.867e-18039.97suppressor of cytokine signaling 4 [Source:Xenbase... [more]
ENSXETT00000011615.19.507e-12934.36alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
ENSXETT00000011608.13.129e-12833.61alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
ccdc1261.456e-1152.46coiled-coil domain containing 126 [Source:NCBI gen... [more]
back to top
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mgat50.000e+040.91mannoside acetylglucosaminyltransferase 5 [Source:... [more]
Mgat50.000e+040.91mannoside acetylglucosaminyltransferase 5 [Source:... [more]
Mgat5b8.556e-12833.76mannoside acetylglucosaminyltransferase 5, isoenzy... [more]
Mgat5b1.702e-4941.67mannoside acetylglucosaminyltransferase 5, isoenzy... [more]
Ccdc1262.651e-947.54coiled-coil domain containing 126 [Source:MGI Symb... [more]
back to top
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08834|MGT5A_RAT0.000e+041.05Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
sp|Q09328|MGT5A_HUMAN0.000e+040.63Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
sp|Q8R4G6|MGT5A_MOUSE0.000e+040.91Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
sp|P97259|MGT5A_CRIGR0.000e+040.77Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
sp|Q3V5L5|MGT5B_HUMAN2.310e-12734.50Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
back to top
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3KF810.000e+040.57alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
A0A1S3KFQ40.000e+039.92alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
A0A210Q6870.000e+040.35Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
A0A2T7PXH70.000e+040.28Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A384AXD60.000e+041.32alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
back to top
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mgat51.718e-17138.69alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
mgat51.021e-15738.97alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
mgat54.892e-13940.27alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
mgat54.892e-13940.27alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
ENSAMXT00000016342.21.811e-12833.29pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MGAT5B1.248e-11936.02alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
ENSPMAT00000003543.15.187e-11735.44pep scaffold:Pmarinus_7.0:GL476475:308158:335573:1... [more]
MGAT5B2.359e-11534.93alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
ENSPMAT00000007392.11.083e-3428.83pep scaffold:Pmarinus_7.0:GL476367:323142:331416:-... [more]
ENSPMAT00000007397.11.333e-631.51pep scaffold:Pmarinus_7.0:GL476367:445169:445646:-... [more]
back to top
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493914.585e-14936.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375812.775e-11436.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457887.819e-10333.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458199.642e-5837.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458593.362e-3532.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mgat51.464e-17738.48alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
MGAT5B8.403e-12934.95alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
ENSORLT00000015586.22.182e-12535.19alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
ENSORLT00000037856.19.108e-12435.18alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
ENSORLT00000009000.21.263e-10834.90alpha-1,6-mannosylglycoprotein 6-beta-N-acetylgluc... [more]
back to top
BLAST of Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000015150.10.000e+099.21SMESG000015150.1[more]
SMESG000015150.10.000e+099.08SMESG000015150.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035558 ID=SMED30035558|Name=Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2489bp
ATTTCAAATTGTTTATTTTTTGAAATTTTAATTTAGTGTTTTCATAACTT
TTGCATGATATATGTCCACTAAGCGACATTATAGGAACTTTTCAAAATCA
ATTAAGTCTCTCTCTTCGAAGCATTTATTGATAATAATAGTAATCACAAT
TATAATATGGCTTTGCTTATTAATTTATGCTTGCAATAAAACGAAAACAG
ACGATGAACAATTAAAAGATGAAATTTTAGAATTGTCAAAACGCTATGTG
TATGTGTTAGCATCGCAACAGAAAAATGACGTTGATGGCCCTTATTCTGG
TAGACTTACTGGATATGATTTAAAGAAAACGTTTGCAGTGCTATTGCAAA
ACATATTCGAAAGATTAACAAATCTCGAAAACAAAGTTGTAAATTTGACT
GCTTTTAATAAGCAATCAATAAATAATTCTGCAGATGTTCATATTGTTAA
TGACAATAATAATTCTCAGATATTGCGCAACCCTTTAGATTCTAAAAGCC
ACCTAGATTTCACTGATATTATCAAAGGAGCACAAGAAAAATGCATTCTC
GACCTCGACAGTAAATTAAGATTCCCTGAATGTGATGACAAAATTGAATG
GATGCGTCAACATTGGCGTAGTCACAAGTGCTACGGGGAAAACGGAGTAG
ATGGATCTATTTGCTCTATTATTATTTATTTAAGTGAGGTTGAACAATAT
TGCCCAAAATTGAAATTTAGAGAGCATAATATGTCAAATGTTTCACAAAC
CAACTCAATAACTGAATTAAACTTAAACTTGTCGGCTTTACTTGACAAAA
TTGACGGTAAAGGCAATCAAGATGCATTTATTTTTATGAAAATGAGAATT
CAGCGTTTGTGGACCAAGGCAGTTGAAGCTGCGATACAATTTACCAAACA
ACCTTCCTTTCAACGTCCAATAGTTAAAAATATTTTGCTATATACTGGGT
TTTTATCTAAAGAAAGCAAATTAAAAATATCAGATACAACCTTTAGTGGA
GGACCTCTGGGAGAAATAGTTCAATGGAGCGATCTCATTATGTCATTATT
TATTTTAGGTCATGATATAACTGTATTATATGAGTTGCCAGACGTCAATA
ATTACCTTTTACAAATACCAAATTTTAATGTTCCTTGCCAAACAAAATTA
GGAAATCGATTGGATATATTTTATACTGATATTATTGGATTTAATCAAAT
TTATAATAAATTCGTTAAATTTAAATGTCTTCTGCGAATTCTCGATACCT
TTGGCACTCAGCCAATTTTCAATAATCCGTTTTATTTAAAAAAAATCAAC
ATCAAGCCTAATGGGTGGATGGGTAAACTATTAGAGTTAAAACAATTTTA
CAACATGTATCCCCACACTGATGACAATACGTTTTTGGGTTTCATTGTAC
CATCATCTATGAAAAAGATAAAGAAAAGAAAAATAGCTTTAGTTTATGGA
AAACACATATCTATGTGGAAAAATTCAGAATCATACTTGAATATAATTAA
AGACTATTTTGAATTACACGCTACAGTTAATGAAAATAACGATAGCAAAT
TGAAATTGCCAAAGTATGTTATAAATCATGGAATACTTTTTGATTCCAAT
TATACAAATTTGCTTGATGAAGCAATGGTTTTTGTTGGATTAGGATTTCC
ATATGAAGGTCCAGCCCCTCTTGAGGCTATTGCACATGGCGCAATCTTTT
TCAATCCGAAATTCAATGATAAGCAAATAGATGCAACTTCTCAATTTTTC
AAAGATAAGCCTACTAAAAGAAAACTATATAGTCAGCATCCATATATCGA
ATATAATATTGGAGAACCATTTTCCTATTTAATAAATACCAATAACGAAA
CCATGATTCGCGAAATTTGTAAGAAAATAATAAAGAAGAACGCTTTTCGT
TCATTTGTCCCATTTGAATTTACTGAAGCTGGATTCTTACAAAGAGTTTC
TGTATTAACAGAAAAACAAGGATTTTGTACGCAAAATTCATATGAATTGG
TTGAAGTTGATCAGTGGCCAAGTATTCGATCAGCTCATTTTTTTCTCGGC
GTCGTCAATGATTCGTGTGAAGAAACATGTCACAAACAAAATTTAATATG
TGAAGCTTCTTTTATAGAACGAATGATGAATAATCGCTTGGAATTACAAC
AGCGTGGTGTCTGGTGTGAAAACGTCAAATATAATCCCCATCCTGCAAAC
CCATCGTATGACCCATATCAGAAAACATGCTATTTTCAAACAGATCATTT
TTTATATAGTTGCATTGACTCATTGGAAAACCATATGCGATTTTGTGGTT
GCCGAGATTTTATAAATGGACAAAAGGCTTTATGCAAAAATTGTCTTTGA
TTTTTTGTTGTATGCCATTCCTCTGAAGGAGATAATTTTTTCATTCTCTG
TGATTAATTATATGCTCCATATTTTCAAATTTTTCAAAACACGCTCTGTA
TACTTTTGAAGTGTCTTCTGTTCATTATATTTTGAAATA
back to top

protein sequence of SMED30035558-orf-1

>SMED30035558-orf-1 ID=SMED30035558-orf-1|Name=SMED30035558-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=763bp
MSTKRHYRNFSKSIKSLSSKHLLIIIVITIIIWLCLLIYACNKTKTDDEQ
LKDEILELSKRYVYVLASQQKNDVDGPYSGRLTGYDLKKTFAVLLQNIFE
RLTNLENKVVNLTAFNKQSINNSADVHIVNDNNNSQILRNPLDSKSHLDF
TDIIKGAQEKCILDLDSKLRFPECDDKIEWMRQHWRSHKCYGENGVDGSI
CSIIIYLSEVEQYCPKLKFREHNMSNVSQTNSITELNLNLSALLDKIDGK
GNQDAFIFMKMRIQRLWTKAVEAAIQFTKQPSFQRPIVKNILLYTGFLSK
ESKLKISDTTFSGGPLGEIVQWSDLIMSLFILGHDITVLYELPDVNNYLL
QIPNFNVPCQTKLGNRLDIFYTDIIGFNQIYNKFVKFKCLLRILDTFGTQ
PIFNNPFYLKKINIKPNGWMGKLLELKQFYNMYPHTDDNTFLGFIVPSSM
KKIKKRKIALVYGKHISMWKNSESYLNIIKDYFELHATVNENNDSKLKLP
KYVINHGILFDSNYTNLLDEAMVFVGLGFPYEGPAPLEAIAHGAIFFNPK
FNDKQIDATSQFFKDKPTKRKLYSQHPYIEYNIGEPFSYLINTNNETMIR
EICKKIIKKNAFRSFVPFEFTEAGFLQRVSVLTEKQGFCTQNSYELVEVD
QWPSIRSAHFFLGVVNDSCEETCHKQNLICEASFIERMMNNRLELQQRGV
WCENVKYNPHPANPSYDPYQKTCYFQTDHFLYSCIDSLENHMRFCGCRDF
INGQKALCKNCL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004864protein phosphatase inhibitor activity
GO:0030145manganese ion binding
GO:0008375acetylglucosaminyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0030144alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0018279protein N-linked glycosylation via asparagine
GO:0030335positive regulation of cell migration
GO:1903614negative regulation of protein tyrosine phosphatase activity
GO:1904894positive regulation of STAT cascade
GO:0006486protein glycosylation
GO:0006487protein N-linked glycosylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR026116GlyclTrfase_18
IPR027833DUF4525
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026116Glycosyltransferase family 18PFAMPF15024Glyco_transf_18coord: 190..747
e-value: 9.2E-178
score: 592.3
IPR027833Domain of unknown function DUF4525PFAMPF15027DUF4525coord: 13..136
e-value: 1.6E-24
score: 86.2
NoneNo IPR availablePANTHERPTHR15075ALPHA-MANNOSIDE BETA-1,6-N-ACETYLGLUCOSAMINYLTRANSFERASEcoord: 47..762
NoneNo IPR availableTMHMMTMhelixcoord: 21..40