Vacuolar protein sorting-associated protein 13A/C

Overview
NameVacuolar protein sorting-associated protein 13A/C
Smed IDSMED30035556
Length (bp)11003
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vacuolar protein sorting-associated protein 13A/C (SMED30035556) t-SNE clustered cells

Violin plots show distribution of expression levels for Vacuolar protein sorting-associated protein 13A/C (SMED30035556) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vacuolar protein sorting-associated protein 13A/C (SMED30035556) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vacuolar protein sorting-associated protein 13A/C (SMED30035556) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035556

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30035556SMESG000037244.1 dd_Smed_v4_1648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30035556SMESG000037244.1 dd_Smed_v4_1648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035556SMESG000037244.1 dd_Smed_v4_1648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30035556SMESG000037244.1 dd_Smed_v6_1648_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035556SMESG000037244.1 dd_Smed_v6_1648_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30035556SMESG000037244.1 dd_Smed_v6_1648_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Human
Match: VPS13A (vacuolar protein sorting 13 homolog A [Source:HGNC Symbol;Acc:HGNC:1908])

HSP 1 Score: 1219.91 bits (3155), Expect = 0.000e+0
Identity = 1025/3433 (29.86%), Postives = 1663/3433 (48.44%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKE-TETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFF-KSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSS-------SLASDGSDELQKKVRSE-----FTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGS-VPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSE-RTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQ-----TAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSN--FNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDE-----------SITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELI--RNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLE---VYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFS--PKDNEGPSRGNVSEREIN---TLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPT-----LLTSNGKIYISVKQLNTE--ISNSGALWNIG-KNAQPSDTQILLC----KSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISY-----QSQIFSHDIKPGCLELVRTACL-KVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFY---ESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQ-ELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSN-NLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKW-NQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVE-GLEVDLSKK----LMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEA-MFVKDCQMIR-----ASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--------LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLF 10049
            MVFES+VV+++N++LGDYVV LD SQL LG+  G   L+NL IKENA    D+P KV+ GHI  L L IPWK+LY++PV A L+ +Y+LI+P+S +KYDP KE   L E KQ+EL RIEE K K  D ++   E +D+F EKL  QI+KNLQ+ IS+IHIRYED  T  ++  + GI+L NLS QT D      +   D T +   K +++D+L  YWN   + F   +       +KN I +         F+ +PIS +A + ++ + +  +F+ P+++L+++L  I   FN+ QY  I   L+S+D       +RK++P+VP+  +   WW +  + +LE  V  R  MWSWK+I+ HR + + Y +++++KL  KK       +++  E+ LD+ NIT+ RQ AE++                        G+     G  D E +        S +   ++E Q  V+ E      T EEKA LY+AIGYSE   DP +   + +LK  + L+ +  ++ +N  K  +L+ +VI   S  + QR  A AI     +++  +TG   PD S  P L+S+   +  M+L  + FE NPLD++ +Q+  I AEPLEIIYD+ TVN IV+F  PP+E+ L +++   L  +EE +  TATGL ++ + +   D+K+++K SY I+P+ G ++    +LL+DLG + + S+ R+ +P          K G+ N   + + AYD F I L+++Q L    GD+WR+ R    S  HIL P  F   L K ++  D  +PK  + G LP + + ISD+ LQ ++ELI  IP P+     +AP K      S     S     I P L L S     +     D+  + L   +             L+  D +V              NM      F +    ++    + +  +       +V+++V  +G  + ++ +D+   A++    L  P+++D   K PV L  T  +T  ++LL +  +  EK  PD  + + N    ++  F S+++ LH EALL  +N++++++P      EEK+   S+         T  E + + I+ L                + L+T +  + L+                              I A L  L++ + ++K  NI +I I G+ +++      TE++  + ++ + D    A+YKK ++I   E +FS ++  +   T+   Y  D++ VD  VN+ VG I+++F+  F+  I  F+++FQ + Q +A    + +  AA  +  + +   SSR  LDIN+KAPV+ IP++  S N  + D G +T  N F +      S   V++   I LS +R+ RS  + +  +    +L P+N+ + + RNL W     +P  ++ A++  +   +SQ D       L  N  + +  +  P+V + +    S         SG A   +               T+   FK + L + L+        +     P   L + K EN+     M+ + +   S  L N  +LD +    KK    +    +  D  D + IK+ + ++      V    +Y+C  V++L  + + F++A                  E + + +  K      E     +EI+V +  PEI+ V DM   D+ A+++ T   + Y    E+  +   I D Q   CPF    RK     ++ P  +     +   +     ++++ L + ++P +I ++  I + L   +T ET       I  +      + WEK++    +  F+ +   E EKI    + V  G               + I + +  I ++LE+ +  + VPML+ +    G+ KN  + I L   + + V Y+N+   VWEPLLE   +   E  R ++  I+        + + +  E+   +      I   S+D L +T+SK  L +L+NL KAF +A +           AP+++ N+ G  +    +  F +         K Y+  +GE    D +  K +            F    S+S +   I  T V        P    G     V  RE     +++       G K++ +RS +Q+ N+    +++Y            +   LL        +N+P+ +      L    + Y   + ++ E  I N GAL     ++  PS    L+     K N   +  YS                   Y + +  P+ L N LP KI+Y     ++ +F+  +  G    + TA L K + ++K+   Y   +W     + P  +++S ++F       ++ +D+ VH+    GQ  V  +SPYWM+N        K G   Q + D                           I +K    Y    L + +                  N+  N N       K  L + DS  S++FS+DTVGS G V CK   + Y+VGV I+LSS  +T+IVTF P+YMI N+S   +   E   N  W+ +   + +PFWP     K ++   + ED       P   Y   + + IL++L+ +  GI  EV + E + +I    Y +G A   LINH  +++ + + Q +  + E  LP  + V Y W D    R   WR    +K H       D +    + E   Y VSF     RI+LFT D  V K    S   E  +QEI ++L  +G+SLV+N  +QE+AYI ITSS V W  + ++K R KP+ +  +E LE  F E+     T  +  E+ +++++  + V L+       +++P    L R + P + ++Y TS HQ    ++IY+IQI NQ+    FP VF P  PP+SV +D+  KP  ++S V+  +G +   R KYF+VLIQEM L LD GF+ ++ D ++ +  T + E  +F KD +  +     ASL++ S +          +++ FHISPIK+HLS SLS      K +        +HS  LNL L+S+G  +TD+QDV+FKL +FE        + + S +  HY  QA++QMYVL+LGLDVLGNPFG+IR  ++GVE  FYEP +GA+ GPEEFVEG+A G+K+L G AVGG AGA S+I G M KG+AA+T+D DYQ+KRRE + K+P     G+ +GGKGL+ GFV G+TG+VTKPI GA+K G  GFFKGVGKGLVG V RP  G++D ASS+F+GI+R  +T+ EV  +RPPRF  +DG+IR Y LR+  GN + +++ E         Y  HV   +K +++ +T + +  + +    G  + +WQ ++++    P I   +  +    KE+ + +F
Sbjct:    1 MVFESVVVDVLNRFLGDYVVDLDTSQLSLGIWKGAVALKNLQIKENALSQLDVPFKVKVGHIGNLKLIIPWKNLYTQPVEAVLEEIYLLIVPSSRIKYDPLKEEKQLMEAKQQELKRIEEAKQKVVDQEQHLPEKQDTFAEKLVTQIIKNLQVKISSIHIRYEDDITNRDKPLSFGISLQNLSMQTTDQYWVPCL--HDETEKLVRKLIRLDNLFAYWNVKSQMFYLSDYDNSLDDLKNGIVNENIVPEGYDFVFRPISANAKLVMNRRSDF-DFSAPKINLEIELHNIAIEFNKPQYFSIMELLESVDMMAQNLPYRKFKPDVPLHHHAREWWAYAIHGVLEVNVCPRLWMWSWKHIRKHRQKVKQYKELYKKKLTSKKPPGELLVSLEELEKTLDVFNITIARQTAEVE--------------------VKKAGYKIYKEGVKDPEDNKGWFSWLWSWSEQNTNEQQPDVQPETLEEMLTPEEKALLYEAIGYSETAVDPTLLKTFEALKFFVHLKSMSIVLRENHQKP-ELVDIVIEEFSTLIVQRPGAQAIKFETKIDSFHITGL--PDNSEKPRLLSSLDDA--MSLFQITFEINPLDETVSQRCIIEAEPLEIIYDARTVNSIVEFFRPPKEVHLAQLTAATLTKLEEFRSKTATGLLYIIETQKVLDLKINLKASYIIVPQDGIFSPTSNLLLLDLGHLKVTSKSRSELPDV--------KQGEANLKEIMDRAYDSFDIQLTSVQLLYSRVGDNWREARKLSVSTQHILVPMHFNLELSKAMVFMDVRMPKFKIYGKLPLISLRISDKKLQGIMELIESIPKPEPVTEVSAPVKSFQIQTSTSLGTSQISQKIIPLLELPSVSEDDSEEEFFDAPCSPLEEPLQFPTGVKSIRTRKLQKQDCSV--------------NMTTFKIRFEVPKVLIEFYHLVGDCELS------VVEILVLGLGAEIEIRTYDLKANAFLKEFCLKCPEYLD-ENKKPVYLVTTLDNTM-EDLLTLEYVKAEKNVPDLKSTYNNVLQLIKVNFSSLDIHLHTEALLNTINYLHNILPQ----SEEKSAPVST---------TETEDKGDVIKKLA---------------LKLSTNEDIITLQ------------------------------ILAELSCLQIFIQDQK-CNISEIKIEGLDSEMIMRPSETEINAKLRNIIVLDSDITAIYKKAVYITGKE-VFSFKMVSYMDATAGSAYT-DMNVVDIQVNLIVGCIEVVFVTKFLYSILAFIDNFQAAKQALAEATVQAAGMAATGVKELAQR--SSRMALDINIKAPVVVIPQSPVSENVFVADFGLITMTNTFHMITESQSSPPPVIDLITIKLSEMRLYRSRFINDAYQEVLDLLLPLNLEVVVERNLCWEWYQEVPCFNVNAQLKPMEFILSQEDITTIFKTLHGNIWYEKDGSASPAVTKDQYSATSGVTTNASHHSGGATVVTAAVVEVHSRALLVKTTLNISFKTDDLTMVLYSPGPKQASFTDVRDPSLKLAEFKLENIISTLKMYTDGSTFSSFSLKNC-ILDDKRPHVKKATPRMIGLTVGFDKKDMMDIKYRKVRDGCVTDAV-FQEMYICASVEFLQTVANVFLEAYTTGT-----------AVETSVQTWTAKEEVPTQES--VKWEINVIIKNPEIVFVADMTKNDAPALVITTQCEICYKGNLENSTMTAAIKDLQVRACPFLPVKRKGKITTVLQPCDLFYQTTQKGTDPQVIDMSVKSLTLKVSPVIINTMITITSAL--YTTKET-------IPEETASSTAHLWEKKDTKTLKMWFLEES-NETEKIAPTTELVPKG---------------EMIKMNIDSIFIVLEAGIGHRTVPMLLAKSRFSGEGKNWSSLINLHCQLELEVHYYNEMFGVWEPLLEPLEIDQTEDFRPWNLGIKMKKKAKMAIVESDPEEENYKVPEYKTVISFHSKDQLNITLSKCGLVMLNNLVKAFTEAATGSSADFVKDL-APFMILNSLGLTISVSPSDSFSVLNIPMA---KSYVLKNGESLSMDYIRTKDN----------DHFNAMTSLSSKLFFILLTPVNHSTADKIPLTKVGRRLYTVRHRESGVERSIVCQIDTVEGSKKVTIRSPVQIRNHFSVPLSVY------------EGDTLLGTASPENEFNIPLGSYRSFIFLKPEDENYQMCEGIDFEEIIKNDGALLKKKCRSKNPSKESFLINIVPEKDNLTSLSVYS------------EDGWDLPYIMHLWPPILLRNLLPYKIAYYIEGIENSVFT--LSEGHSAQICTAQLGKARLHLKL-LDYLNHDWKSEYHIKPNQQDISFVSFTCVTEMEKTDLDIAVHMTYNTGQTVVAFHSPYWMVN--------KTGRMLQYKADG--------------------------IHRKHPPNYKKPVLFSFQP-----------------NHFFNNN-------KVQLMVTDSELSNQFSIDTVGSHGAVKCKGLKMDYQVGVTIDLSSFNITRIVTFTPFYMIKNKSKYHISVAE-EGNDKWLSLDLEQCIPFWPEYASSKLLIQVERSED------PPKRIYFNKQENCILLRLDNELGGIIAEVNLAEHSTVITFLDYHDGAATFLLINHTKNEL-VQYNQSSLSEIEDSLPPGKAVFYTWADPVGSRRLKWRC---RKSHGEVTQKDDMMMPIDLGEKTIYLVSFFEGLQRIILFTEDPRVFKVTYESEKAELAEQEIAVALQDVGISLVNNYTKQEVAYIGITSSDVVWETKPKKKARWKPMSVKHTEKLEREFKEY-----TESSPSEDKVIQLDTNVPVRLTPTGHNMKILQPHVIALRRNYLPALKVEYNTSAHQSSFRIQIYRIQIQNQIHGAVFPFVFYPVKPPKSVTMDSAPKPFTDVSIVMRSAGHSQISRIKYFKVLIQEMDLRLDLGFIYALTDLMTEAEVTENTEVELFHKDIEAFKEEYKTASLVDQSQV---------SLYEYFHISPIKLHLSVSLSSGREEAKDSKQNGGLIPVHS--LNLLLKSIGATLTDVQDVVFKLAFFELNYQFHTTSDLQSEVIRHYSKQAIKQMYVLILGLDVLGNPFGLIREFSEGVEAFFYEPYQGAIQGPEEFVEGMALGLKALVGGAVGGLAGAASKITGAMAKGVAAMTMDEDYQQKRREAMNKQPAGFREGITRGGKGLVSGFVSGITGIVTKPIKGAQKGGAAGFFKGVGKGLVGAVARPTGGIIDMASSTFQGIKRATETS-EVESLRPPRFFNEDGVIRPYRLRDGTGNQM-LQVMENGR-FAKYKYFTHVMI-NKTDMLMITRRGVLFVTKG-TFGQLTCEWQYSFDEFTKEPFIVHGRR-LRIEAKERVKSVF 3140          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Human
Match: VPS13A (vacuolar protein sorting 13 homolog A [Source:HGNC Symbol;Acc:HGNC:1908])

HSP 1 Score: 1217.22 bits (3148), Expect = 0.000e+0
Identity = 1011/3352 (30.16%), Postives = 1629/3352 (48.60%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKE-TETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSS-------SLASDGSDELQKKVRSE-----FTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGS-VPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSE-RTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQ-----TAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSN--FNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDE-----------SITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELI--RNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLE---VYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFS--PKDNEGPSRGNVSEREIN---TLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPT-----LLTSNGKIYISVKQLNTE--ISNSGALWNIG-KNAQPSDTQILLC----KSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISY-----QSQIFSHDIKPGCLELVRTACL-KVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFY---ESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQ-ELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSN-NLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKW-NQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVE-GLEVDLSKK----LMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEA-MFVKDCQMIR-----ASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--------LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKI 9809
            MVFES+VV+++N++LGDYVV LD SQL LG+  G   L+NL IKENA    D+P KV+ GHI  L L IPWK+LY++PV A L+ +Y+LI+P+S +KYDP KE   L E KQ+EL RIEE K K  D ++   E +D+F EKL  QI+KNLQ+ IS+IHIRYED  T  ++  + GI+L NLS QT D      +  +++ +   K +++D+L  YWN   + F   +       +KN I +         F+ +PIS +A + ++ + +  +F+ P+++L+++L  I   FN+ QY  I   L+S+D       +RK++P+VP+  +   WW +  + +LE  V  R  MWSWK+I+ HR + + Y +++++KL  KK       +++  E+ LD+ NIT+ RQ AE++                        G+     G  D E +        S +   ++E Q  V+ E      T EEKA LY+AIGYSE   DP +   + +LK  + L+ +  ++ +N  K  +L+ +VI   S  + QR  A AI     +++  +TG   PD S  P L+S+   +  M+L  + FE NPLD++ +Q+  I AEPLEIIYD+ TVN IV+F  PP+E+ L +++   L  +EE +  TATGL ++ + +   D+K+++K SY I+P+ G ++    +LL+DLG + + S+ R+ +P          K G+ N   + + AYD F I L+++Q L    GD+WR+ R    S  HIL P  F   L K ++  D  +PK  + G LP + + ISD+ LQ ++ELI  IP P+     +AP K      S     S     I P L L S     +     D+  + L   +             L+  D +V              NM      F +    ++    + +  +       +V+++V  +G  + ++ +D+   A++    L  P+++D   K PV L  T  +T  ++LL +  +  EK  PD  + + N    ++  F S+++ LH EALL  +N++++++P      EEK+   S+         T  E + + I+ L                + L+T +  + L+                              I A L  L++ + ++K  NI +I I G+ +++      TE++  + ++ + D    A+YKK ++I   E +FS ++  +   T+   Y  D++ VD  VN+ VG I+++F+  F+  I  F+++FQ + Q +A    + +  AA  +  + +   SSR  LDIN+KAPV+ IP++  S N  + D G +T  N F +      S   V++   I LS +R+ RS  + +  +    +L P+N+ + + RNL W     +P  ++ A++  +   +SQ D       L  N  + +  +  P+V + +    S         SG A   +               T+   FK + L + L+        +     P   L + K EN+     M+ + +   S  L N  +LD +    KK    +    +  D  D + IK+ + ++      V    +Y+C  V++L  + + F++A                  E + + +  K      E     +EI+V +  PEI+ V DM   D+ A+++ T   + Y    E+  +   I D Q   CPF    RK     ++ P  +     +   +     ++++ L + ++P +I ++  I + L   +T ET       I  +      + WEK++    +  F+ +   E EKI    + V  G               + I + +  I ++LE+ +  + VPML+ +    G+ KN  + I L   + + V Y+N+   VWEPLLE   +   E  R ++  I+        + + +  E+   +      I   S+D L +T+SK  L +L+NL KAF +A +           AP+++ N+ G  +    +  F +         K Y+  +GE    D +  K +            F    S+S +   I  T V        P    G     V  RE     +++       G K++ +RS +Q+ N+    +++Y            +   LL        +N+P+ +      L    + Y   + ++ E  I N GAL     ++  PS    L+     K N   +  YS                   Y + +  P+ L N LP KI+Y     ++ +F+  +  G    + TA L K + ++K+   Y   +W     + P  +++S ++F       ++ +D+ VH+    GQ  V  +SPYWM+N        K G   Q + D                           I +K    Y    L + +                  N+  N N       K  L + DS  S++FS+DTVGS G V CK   + Y+VGV I+LSS  +T+IVTF P+YMI N+S   +   E   N  W+ +   + +PFWP     K ++   + ED       P   Y   + + IL++L+ +  GI  EV + E + +I    Y +G A   LINH  +++ + + Q +  + E  LP  + V Y W D    R   WR    +K H       D +    + E   Y VSF     RI+LFT D  V K    S   E  +QEI ++L  +G+SLV+N  +QE+AYI ITSS V W  + ++K R KP+ +  +E LE  F E+     T  +  E+ +++++  + V L+       +++P    L R + P + ++Y TS HQ    ++IY+IQI NQ+    FP VF P  PP+SV +D+  KP  ++S V+  +G +   R KYF+VLIQEM L LD GF+ ++ D ++ +  T + E  +F KD +  +     ASL++ S +          +++ FHISPIK+HLS SLS      K +        +HS  LNL L+S+G  +TD+QDV+FKL +FE        + + S +  HY  QA++QMYVL+LGLDVLGNPFG+IR  ++GVE  FYEP +GA+ GPEEFVEG+A G+K+L G AVGG AGA S+I G M KG+AA+T+D DYQ+KRRE + K+P     G+ +GGKGL+ GFV G+TG+VTKPI GA+K G  GFFKGVGKGLVG V RP  G++D ASS+F+GI+R  +T+ EV  +RPPRF  +DG+IR Y LR+  GN +  KI
Sbjct:    1 MVFESVVVDVLNRFLGDYVVDLDTSQLSLGIWKGAVALKNLQIKENALSQLDVPFKVKVGHIGNLKLIIPWKNLYTQPVEAVLEEIYLLIVPSSRIKYDPLKEEKQLMEAKQQELKRIEEAKQKVVDQEQHLPEKQDTFAEKLVTQIIKNLQVKISSIHIRYEDDITNRDKPLSFGISLQNLSMQTTDQYWVPCL-HDETEKLVRKLIRLDNLFAYWNVKSQMFYLSDYDNSLDDLKNGIVNENIVPEGYDFVFRPISANAKLVMNRRSDF-DFSAPKINLEIELHNIAIEFNKPQYFSIMELLESVDMMAQNLPYRKFKPDVPLHHHAREWWAYAIHGVLEVNVCPRLWMWSWKHIRKHRQKVKQYKELYKKKLTSKKPPGELLVSLEELEKTLDVFNITIARQTAEVE--------------------VKKAGYKIYKEGVKDPEDNKGWFSWLWSWSEQNTNEQQPDVQPETLEEMLTPEEKALLYEAIGYSETAVDPTLLKTFEALKFFVHLKSMSIVLRENHQKP-ELVDIVIEEFSTLIVQRPGAQAIKFETKIDSFHITGL--PDNSEKPRLLSSLDDA--MSLFQITFEINPLDETVSQRCIIEAEPLEIIYDARTVNSIVEFFRPPKEVHLAQLTAATLTKLEEFRSKTATGLLYIIETQKVLDLKINLKASYIIVPQDGIFSPTSNLLLLDLGHLKVTSKSRSELPDV--------KQGEANLKEIMDRAYDSFDIQLTSVQLLYSRVGDNWREARKLSVSTQHILVPMHFNLELSKAMVFMDVRMPKFKIYGKLPLISLRISDKKLQGIMELIESIPKPEPVTEVSAPVKSFQIQTSTSLGTSQISQKIIPLLELPSVSEDDSEEEFFDAPCSPLEEPLQFPTGVKSIRTRKLQKQDCSV--------------NMTTFKIRFEVPKVLIEFYHLVGDCELS------VVEILVLGLGAEIEIRTYDLKANAFLKEFCLKCPEYLD-ENKKPVYLVTTLDNTM-EDLLTLEYVKAEKNVPDLKSTYNNVLQLIKVNFSSLDIHLHTEALLNTINYLHNILPQ----SEEKSAPVST---------TETEDKGDVIKKLA---------------LKLSTNEDIITLQ------------------------------ILAELSCLQIFIQDQK-CNISEIKIEGLDSEMIMRPSETEINAKLRNIIVLDSDITAIYKKAVYITGKE-VFSFKMVSYMDATAGSAYT-DMNVVDIQVNLIVGCIEVVFVTKFLYSILAFIDNFQAAKQALAEATVQAAGMAATGVKELAQR--SSRMALDINIKAPVVVIPQSPVSENVFVADFGLITMTNTFHMITESQSSPPPVIDLITIKLSEMRLYRSRFINDAYQEVLDLLLPLNLEVVVERNLCWEWYQEVPCFNVNAQLKPMEFILSQEDITTIFKTLHGNIWYEKDGSASPAVTKDQYSATSGVTTNASHHSGGATVVTAAVVEVHSRALLVKTTLNISFKTDDLTMVLYSPGPKQASFTDVRDPSLKLAEFKLENIISTLKMYTDGSTFSSFSLKNC-ILDDKRPHVKKATPRMIGLTVGFDKKDMMDIKYRKVRDGCVTDAV-FQEMYICASVEFLQTVANVFLEAYTTGT-----------AVETSVQTWTAKEEVPTQES--VKWEINVIIKNPEIVFVADMTKNDAPALVITTQCEICYKGNLENSTMTAAIKDLQVRACPFLPVKRKGKITTVLQPCDLFYQTTQKGTDPQVIDMSVKSLTLKVSPVIINTMITITSAL--YTTKET-------IPEETASSTAHLWEKKDTKTLKMWFLEES-NETEKIAPTTELVPKG---------------EMIKMNIDSIFIVLEAGIGHRTVPMLLAKSRFSGEGKNWSSLINLHCQLELEVHYYNEMFGVWEPLLEPLEIDQTEDFRPWNLGIKMKKKAKMAIVESDPEEENYKVPEYKTVISFHSKDQLNITLSKCGLVMLNNLVKAFTEAATGSSADFVKDL-APFMILNSLGLTISVSPSDSFSVLNIPMA---KSYVLKNGESLSMDYIRTKDN----------DHFNAMTSLSSKLFFILLTPVNHSTADKIPLTKVGRRLYTVRHRESGVERSIVCQIDTVEGSKKVTIRSPVQIRNHFSVPLSVY------------EGDTLLGTASPENEFNIPLGSYRSFIFLKPEDENYQMCEGIDFEEIIKNDGALLKKKCRSKNPSKESFLINIVPEKDNLTSLSVYS------------EDGWDLPYIMHLWPPILLRNLLPYKIAYYIEGIENSVFT--LSEGHSAQICTAQLGKARLHLKL-LDYLNHDWKSEYHIKPNQQDISFVSFTCVTEMEKTDLDIAVHMTYNTGQTVVAFHSPYWMVN--------KTGRMLQYKADG--------------------------IHRKHPPNYKKPVLFSFQP-----------------NHFFNNN-------KVQLMVTDSELSNQFSIDTVGSHGAVKCKGLKMDYQVGVTIDLSSFNITRIVTFTPFYMIKNKSKYHISVAE-EGNDKWLSLDLEQCIPFWPEYASSKLLIQVERSED------PPKRIYFNKQENCILLRLDNELGGIIAEVNLAEHSTVITFLDYHDGAATFLLINHTKNEL-VQYNQSSLSEIEDSLPPGKAVFYTWADPVGSRRLKWRC---RKSHGEVTQKDDMMMPIDLGEKTIYLVSFFEGLQRIILFTEDPRVFKVTYESEKAELAEQEIAVALQDVGISLVNNYTKQEVAYIGITSSDVVWETKPKKKARWKPMSVKHTEKLEREFKEY-----TESSPSEDKVIQLDTNVPVRLTPTGHNMKILQPHVIALRRNYLPALKVEYNTSAHQSSFRIQIYRIQIQNQIHGAVFPFVFYPVKPPKSVTMDSAPKPFTDVSIVMRSAGHSQISRIKYFKVLIQEMDLRLDLGFIYALTDLMTEAEVTENTEVELFHKDIEAFKEEYKTASLVDQSQV---------SLYEYFHISPIKLHLSVSLSSGREEAKDSKQNGGLIPVHS--LNLLLKSIGATLTDVQDVVFKLAFFELNYQFHTTSDLQSEVIRHYSKQAIKQMYVLILGLDVLGNPFGLIREFSEGVEAFFYEPYQGAIQGPEEFVEGMALGLKALVGGAVGGLAGAASKITGAMAKGVAAMTMDEDYQQKRREAMNKQPAGFREGITRGGKGLVSGFVSGITGIVTKPIKGAQKGGAAGFFKGVGKGLVGAVARPTGGIIDMASSTFQGIKRATETS-EVESLRPPRFFNEDGVIRPYRLRDGTGNQMLQKI 3065          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Human
Match: VPS13A (vacuolar protein sorting 13 homolog A [Source:HGNC Symbol;Acc:HGNC:1908])

HSP 1 Score: 1215.29 bits (3143), Expect = 0.000e+0
Identity = 1009/3348 (30.14%), Postives = 1627/3348 (48.60%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKE-TETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSS-------SLASDGSDELQKKVRSE-----FTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGS-VPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSE-RTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQ-----TAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSN--FNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDE-----------SITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELI--RNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLE---VYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFS--PKDNEGPSRGNVSEREIN---TLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPT-----LLTSNGKIYISVKQLNTE--ISNSGALWNIG-KNAQPSDTQILLC----KSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISY-----QSQIFSHDIKPGCLELVRTACL-KVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFY---ESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQ-ELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSN-NLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKW-NQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVE-GLEVDLSKK----LMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEA-MFVKDCQMIR-----ASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--------LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNI 9797
            MVFES+VV+++N++LGDYVV LD SQL LG+  G   L+NL IKENA    D+P KV+ GHI  L L IPWK+LY++PV A L+ +Y+LI+P+S +KYDP KE   L E KQ+EL RIEE K K  D ++   E +D+F EKL  QI+KNLQ+ IS+IHIRYED  T  ++  + GI+L NLS QT D      +  +++ +   K +++D+L  YWN   + F   +       +KN I +         F+ +PIS +A + ++ + +  +F+ P+++L+++L  I   FN+ QY  I   L+S+D       +RK++P+VP+  +   WW +  + +LE  V  R  MWSWK+I+ HR + + Y +++++KL  KK       +++  E+ LD+ NIT+ RQ AE++                        G+     G  D E +        S +   ++E Q  V+ E      T EEKA LY+AIGYSE   DP +   + +LK  + L+ +  ++ +N  K  +L+ +VI   S  + QR  A AI     +++  +TG   PD S  P L+S+   +  M+L  + FE NPLD++ +Q+  I AEPLEIIYD+ TVN IV+F  PP+E+ L +++   L  +EE +  TATGL ++ + +   D+K+++K SY I+P+ G ++    +LL+DLG + + S+ R+ +P          K G+ N   + + AYD F I L+++Q L    GD+WR+ R    S  HIL P  F   L K ++  D  +PK  + G LP + + ISD+ LQ ++ELI  IP P+     +AP K      S     S     I P L L S     +     D+  + L   +             L+  D +V              NM      F +    ++    + +  +       +V+++V  +G  + ++ +D+   A++    L  P+++D   K PV L  T  +T  ++LL +  +  EK  PD  + + N    ++  F S+++ LH EALL  +N++++++P      EEK+   S+         T  E + + I+ L                + L+T +  + L+                              I A L  L++ + ++K  NI +I I G+ +++      TE++  + ++ + D    A+YKK ++I   E +FS ++  +   T+   Y  D++ VD  VN+ VG I+++F+  F+  I  F+++FQ + Q +A    + +  AA  +  + +   SSR  LDIN+KAPV+ IP++  S N  + D G +T  N F +      S   V++   I LS +R+ RS  + +  +    +L P+N+ + + RNL W     +P  ++ A++  +   +SQ D       L  N  + +  +  P+V + +    S         SG A   +               T+   FK + L + L+        +     P   L + K EN+     M+ + +   S  L N  +LD +    KK    +    +  D  D + IK+ + ++      V    +Y+C  V++L  + + F++A                  E + + +  K      E     +EI+V +  PEI+ V DM   D+ A+++ T   + Y    E+  +   I D Q   CPF    RK     ++ P  +     +   +     ++++ L + ++P +I ++  I + L   +T ET       I  +      + WEK++    +  F+ +   E EKI    + V  G               + I + +  I ++LE+ +  + VPML+ +    G+ KN  + I L   + + V Y+N+   VWEPLLE   +   E  R ++  I+        + + +  E+   +      I   S+D L +T+SK  L +L+NL KAF +A +           AP+++ N+ G  +    +  F +         K Y+  +GE    D +  K +            F    S+S +   I  T V        P    G     V  RE     +++       G K++ +RS +Q+ N+    +++Y            +   LL        +N+P+ +      L    + Y   + ++ E  I N GAL     ++  PS    L+     K N   +  YS                   Y + +  P+ L N LP KI+Y     ++ +F+  +  G    + TA L K + ++K+   Y   +W     + P  +++S ++F       ++ +D+ VH+    GQ  V  +SPYWM+N        K G   Q + D                           I +K    Y    L + +                  N+  N N       K  L + DS  S++FS+DTVGS G V CK   + Y+VGV I+LSS  +T+IVTF P+YMI N+S   +   E   N  W+ +   + +PFWP     K ++   + ED       P   Y   + + IL++L+ +  GI  EV + E + +I    Y +G A   LINH  +++ + + Q +  + E  LP  + V Y W D    R   WR    +K H       D +    + E   Y VSF     RI+LFT D  V K    S   E  +QEI ++L  +G+SLV+N  +QE+AYI ITSS V W  + ++K R KP+ +  +E LE  F E+     T  +  E+ +++++  + V L+       +++P    L R + P + ++Y TS HQ    ++IY+IQI NQ+    FP VF P  PP+SV +D+  KP  ++S V+  +G +   R KYF+VLIQEM L LD GF+ ++ D ++ +  T + E  +F KD +  +     ASL++ S +          +++ FHISPIK+HLS SLS      K +        +HS  LNL L+S+G  +TD+QDV+FKL +FE        + + S +  HY  QA++QMYVL+LGLDVLGNPFG+IR  ++GVE  FYEP +GA+ GPEEFVEG+A G+K+L G AVGG AGA S+I G M KG+AA+T+D DYQ+KRRE + K+P     G+ +GGKGL+ GFV G+TG+VTKPI GA+K G  GFFKGVGKGLVG V RP  G++D ASS+F+GI+R  +T+ EV  +RPPRF  +DG+IR Y LR+  GN +
Sbjct:    1 MVFESVVVDVLNRFLGDYVVDLDTSQLSLGIWKGAVALKNLQIKENALSQLDVPFKVKVGHIGNLKLIIPWKNLYTQPVEAVLEEIYLLIVPSSRIKYDPLKEEKQLMEAKQQELKRIEEAKQKVVDQEQHLPEKQDTFAEKLVTQIIKNLQVKISSIHIRYEDDITNRDKPLSFGISLQNLSMQTTDQYWVPCL-HDETEKLVRKLIRLDNLFAYWNVKSQMFYLSDYDNSLDDLKNGIVNENIVPEGYDFVFRPISANAKLVMNRRSDF-DFSAPKINLEIELHNIAIEFNKPQYFSIMELLESVDMMAQNLPYRKFKPDVPLHHHAREWWAYAIHGVLEVNVCPRLWMWSWKHIRKHRQKVKQYKELYKKKLTSKKPPGELLVSLEELEKTLDVFNITIARQTAEVE--------------------VKKAGYKIYKEGVKDPEDNKGWFSWLWSWSEQNTNEQQPDVQPETLEEMLTPEEKALLYEAIGYSETAVDPTLLKTFEALKFFVHLKSMSIVLRENHQKP-ELVDIVIEEFSTLIVQRPGAQAIKFETKIDSFHITGL--PDNSEKPRLLSSLDDA--MSLFQITFEINPLDETVSQRCIIEAEPLEIIYDARTVNSIVEFFRPPKEVHLAQLTAATLTKLEEFRSKTATGLLYIIETQKVLDLKINLKASYIIVPQDGIFSPTSNLLLLDLGHLKVTSKSRSELPDV--------KQGEANLKEIMDRAYDSFDIQLTSVQLLYSRVGDNWREARKLSVSTQHILVPMHFNLELSKAMVFMDVRMPKFKIYGKLPLISLRISDKKLQGIMELIESIPKPEPVTEVSAPVKSFQIQTSTSLGTSQISQKIIPLLELPSVSEDDSEEEFFDAPCSPLEEPLQFPTGVKSIRTRKLQKQDCSV--------------NMTTFKIRFEVPKVLIEFYHLVGDCELS------VVEILVLGLGAEIEIRTYDLKANAFLKEFCLKCPEYLD-ENKKPVYLVTTLDNTM-EDLLTLEYVKAEKNVPDLKSTYNNVLQLIKVNFSSLDIHLHTEALLNTINYLHNILPQ----SEEKSAPVST---------TETEDKGDVIKKLA---------------LKLSTNEDIITLQ------------------------------ILAELSCLQIFIQDQK-CNISEIKIEGLDSEMIMRPSETEINAKLRNIIVLDSDITAIYKKAVYITGKE-VFSFKMVSYMDATAGSAYT-DMNVVDIQVNLIVGCIEVVFVTKFLYSILAFIDNFQAAKQALAEATVQAAGMAATGVKELAQR--SSRMALDINIKAPVVVIPQSPVSENVFVADFGLITMTNTFHMITESQSSPPPVIDLITIKLSEMRLYRSRFINDAYQEVLDLLLPLNLEVVVERNLCWEWYQEVPCFNVNAQLKPMEFILSQEDITTIFKTLHGNIWYEKDGSASPAVTKDQYSATSGVTTNASHHSGGATVVTAAVVEVHSRALLVKTTLNISFKTDDLTMVLYSPGPKQASFTDVRDPSLKLAEFKLENIISTLKMYTDGSTFSSFSLKNC-ILDDKRPHVKKATPRMIGLTVGFDKKDMMDIKYRKVRDGCVTDAV-FQEMYICASVEFLQTVANVFLEAYTTGT-----------AVETSVQTWTAKEEVPTQES--VKWEINVIIKNPEIVFVADMTKNDAPALVITTQCEICYKGNLENSTMTAAIKDLQVRACPFLPVKRKGKITTVLQPCDLFYQTTQKGTDPQVIDMSVKSLTLKVSPVIINTMITITSAL--YTTKET-------IPEETASSTAHLWEKKDTKTLKMWFLEES-NETEKIAPTTELVPKG---------------EMIKMNIDSIFIVLEAGIGHRTVPMLLAKSRFSGEGKNWSSLINLHCQLELEVHYYNEMFGVWEPLLEPLEIDQTEDFRPWNLGIKMKKKAKMAIVESDPEEENYKVPEYKTVISFHSKDQLNITLSKCGLVMLNNLVKAFTEAATGSSADFVKDL-APFMILNSLGLTISVSPSDSFSVLNIPMA---KSYVLKNGESLSMDYIRTKDN----------DHFNAMTSLSSKLFFILLTPVNHSTADKIPLTKVGRRLYTVRHRESGVERSIVCQIDTVEGSKKVTIRSPVQIRNHFSVPLSVY------------EGDTLLGTASPENEFNIPLGSYRSFIFLKPEDENYQMCEGIDFEEIIKNDGALLKKKCRSKNPSKESFLINIVPEKDNLTSLSVYS------------EDGWDLPYIMHLWPPILLRNLLPYKIAYYIEGIENSVFT--LSEGHSAQICTAQLGKARLHLKL-LDYLNHDWKSEYHIKPNQQDISFVSFTCVTEMEKTDLDIAVHMTYNTGQTVVAFHSPYWMVN--------KTGRMLQYKADG--------------------------IHRKHPPNYKKPVLFSFQP-----------------NHFFNNN-------KVQLMVTDSELSNQFSIDTVGSHGAVKCKGLKMDYQVGVTIDLSSFNITRIVTFTPFYMIKNKSKYHISVAE-EGNDKWLSLDLEQCIPFWPEYASSKLLIQVERSED------PPKRIYFNKQENCILLRLDNELGGIIAEVNLAEHSTVITFLDYHDGAATFLLINHTKNEL-VQYNQSSLSEIEDSLPPGKAVFYTWADPVGSRRLKWRC---RKSHGEVTQKDDMMMPIDLGEKTIYLVSFFEGLQRIILFTEDPRVFKVTYESEKAELAEQEIAVALQDVGISLVNNYTKQEVAYIGITSSDVVWETKPKKKARWKPMSVKHTEKLEREFKEY-----TESSPSEDKVIQLDTNVPVRLTPTGHNMKILQPHVIALRRNYLPALKVEYNTSAHQSSFRIQIYRIQIQNQIHGAVFPFVFYPVKPPKSVTMDSAPKPFTDVSIVMRSAGHSQISRIKYFKVLIQEMDLRLDLGFIYALTDLMTEAEVTENTEVELFHKDIEAFKEEYKTASLVDQSQV---------SLYEYFHISPIKLHLSVSLSSGREEAKDSKQNGGLIPVHS--LNLLLKSIGATLTDVQDVVFKLAFFELNYQFHTTSDLQSEVIRHYSKQAIKQMYVLILGLDVLGNPFGLIREFSEGVEAFFYEPYQGAIQGPEEFVEGMALGLKALVGGAVGGLAGAASKITGAMAKGVAAMTMDEDYQQKRREAMNKQPAGFREGITRGGKGLVSGFVSGITGIVTKPIKGAQKGGAAGFFKGVGKGLVGAVARPTGGIIDMASSTFQGIKRATETS-EVESLRPPRFFNEDGVIRPYRLRDGTGNQM 3061          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Human
Match: VPS13A (vacuolar protein sorting 13 homolog A [Source:HGNC Symbol;Acc:HGNC:1908])

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 647/2226 (29.07%), Postives = 1053/2226 (47.30%), Query Frame = 3
Query: 3582 TEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSN--FNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDE-----------SITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELI--RNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLE---VYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFS--PKDNEGPSRGNVSEREIN---TLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPT-----LLTSNGKIYISVKQLNTE--ISNSGALWNIG-KNAQPSDTQILLC----KSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISY-----QSQIFSHDIKPGCLELVRTACL-KVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFY---ESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQ-ELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSN-NLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKW-NQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVE-GLEVDLSKK----LMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEA-MFVKDCQMIR-----ASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--------LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLF 10049
            TE++  + ++ + D    A+YKK ++I   E +FS ++  +   T+   Y  D++ VD  VN+ VG I+++F+  F+  I  F+++FQ + Q +A    + +  AA  +  + +   SSR  LDIN+KAPV+ IP++  S N  + D G +T  N F +      S   V++   I LS +R+ RS  + +  +    +L P+N+ + + RNL W     +P  ++ A++  +   +SQ D       L  N  + +  +  P+V + +    S         SG A   +               T+   FK + L + L+        +     P   L + K EN+     M+ + +   S  L N  +LD +    KK    +    +  D  D + IK+ + ++      V    +Y+C  V++L  + + F++A                  E + + +  K      E     +EI+V +  PEI+ V DM   D+ A+++ T   + Y    E+  +   I D Q   CPF    RK     ++ P  +     +   +     ++++ L + ++P +I ++  I + L   +T ET       I  +      + WEK++    +  F+ +   E EKI    + V  G               + I + +  I ++LE+ +  + VPML+ +    G+ KN  + I L   + + V Y+N+   VWEPLLE   +   E  R ++  I+        + + +  E+   +      I   S+D L +T+SK  L +L+NL KAF +A +           AP+++ N+ G  +    +  F +         K Y+  +GE    D +  K +            F    S+S +   I  T V        P    G     V  RE     +++       G K++ +RS +Q+ N+    +++Y            +   LL        +N+P+ +      L    + Y   + ++ E  I N GAL     ++  PS    L+     K N   +  YS                   Y + +  P+ L N LP KI+Y     ++ +F+  +  G    + TA L K + ++K+   Y   +W     + P  +++S ++F       ++ +D+ VH+    GQ  V  +SPYWM+N        K G   Q + D                           I +K    Y    L + +                  N+  N N       K  L + DS  S++FS+DTVGS G V CK   + Y+VGV I+LSS  +T+IVTF P+YMI N+S   +   E   N  W+ +   + +PFWP     K ++   + ED       P   Y   + + IL++L+ +  GI  EV + E + +I    Y +G A   LINH  +++ + + Q +  + E  LP  + V Y W D    R   WR    +K H       D +    + E   Y VSF     RI+LFT D  V K    S   E  +QEI ++L  +G+SLV+N  +QE+AYI ITSS V W  + ++K R KP+ +  +E LE  F E+     T  +  E+ +++++  + V L+       +++P    L R + P + ++Y TS HQ    ++IY+IQI NQ+    FP VF P  PP+SV +D+  KP  ++S V+  +G +   R KYF+VLIQEM L LD GF+ ++ D ++ +  T + E  +F KD +  +     ASL++ S +          +++ FHISPIK+HLS SLS      K +        +HS  LNL L+S+G  +TD+QDV+FKL +FE        + + S +  HY  QA++QMYVL+LGLDVLGNPFG+IR  ++GVE  FYEP +GA+ GPEEFVEG+A G+K+L G AVGG AGA S+I G M KG+AA+T+D DYQ+KRRE + K+P     G+ +GGKGL+ GFV G+TG+VTKPI GA+K G  GFFKGVGKGLVG V RP  G++D ASS+F+GI+R  +T+ EV  +RPPRF  +DG+IR Y LR+  GN + +++ E         Y  HV   +K +++ +T + +  + +    G  + +WQ ++++    P I   +  +    KE+ + +F
Sbjct: 1052 TEINAKLRNIIVLDSDITAIYKKAVYITGKE-VFSFKMVSYMDATAGSAYT-DMNVVDIQVNLIVGCIEVVFVTKFLYSILAFIDNFQAAKQALAEATVQAAGMAATGVKELAQR--SSRMALDINIKAPVVVIPQSPVSENVFVADFGLITMTNTFHMITESQSSPPPVIDLITIKLSEMRLYRSRFINDAYQEVLDLLLPLNLEVVVERNLCWEWYQEVPCFNVNAQLKPMEFILSQEDITTIFKTLHGNIWYEKDGSASPAVTKDQYSATSGVTTNASHHSGGATVVTAAVVEVHSRALLVKTTLNISFKTDDLTMVLYSPGPKQASFTDVRDPSLKLAEFKLENIISTLKMYTDGSTFSSFSLKNC-ILDDKRPHVKKATPRMIGLTVGFDKKDMMDIKYRKVRDGCVTDAV-FQEMYICASVEFLQTVANVFLEAYTTGT-----------AVETSVQTWTAKEEVPTQES--VKWEINVIIKNPEIVFVADMTKNDAPALVITTQCEICYKGNLENSTMTAAIKDLQVRACPFLPVKRKGKITTVLQPCDLFYQTTQKGTDPQVIDMSVKSLTLKVSPVIINTMITITSAL--YTTKET-------IPEETASSTAHLWEKKDTKTLKMWFLEES-NETEKIAPTTELVPKG---------------EMIKMNIDSIFIVLEAGIGHRTVPMLLAKSRFSGEGKNWSSLINLHCQLELEVHYYNEMFGVWEPLLEPLEIDQTEDFRPWNLGIKMKKKAKMAIVESDPEEENYKVPEYKTVISFHSKDQLNITLSKCGLVMLNNLVKAFTEAATGSSADFVKDL-APFMILNSLGLTISVSPSDSFSVLNIPMA---KSYVLKNGESLSMDYIRTKDN----------DHFNAMTSLSSKLFFILLTPVNHSTADKIPLTKVGRRLYTVRHRESGVERSIVCQIDTVEGSKKVTIRSPVQIRNHFSVPLSVY------------EGDTLLGTASPENEFNIPLGSYRSFIFLKPEDENYQMCEGIDFEEIIKNDGALLKKKCRSKNPSKESFLINIVPEKDNLTSLSVYS------------EDGWDLPYIMHLWPPILLRNLLPYKIAYYIEGIENSVFT--LSEGHSAQICTAQLGKARLHLKL-LDYLNHDWKSEYHIKPNQQDISFVSFTCVTEMEKTDLDIAVHMTYNTGQTVVAFHSPYWMVN--------KTGRMLQYKADG--------------------------IHRKHPPNYKKPVLFSFQP-----------------NHFFNNN-------KVQLMVTDSELSNQFSIDTVGSHGAVKCKGLKMDYQVGVTIDLSSFNITRIVTFTPFYMIKNKSKYHISVAE-EGNDKWLSLDLEQCIPFWPEYASSKLLIQVERSED------PPKRIYFNKQENCILLRLDNELGGIIAEVNLAEHSTVITFLDYHDGAATFLLINHTKNEL-VQYNQSSLSEIEDSLPPGKAVFYTWADPVGSRRLKWRC---RKSHGEVTQKDDMMMPIDLGEKTIYLVSFFEGLQRIILFTEDPRVFKVTYESEKAELAEQEIAVALQDVGISLVNNYTKQEVAYIGITSSDVVWETKPKKKARWKPMSVKHTEKLEREFKEY-----TESSPSEDKVIQLDTNVPVRLTPTGHNMKILQPHVIALRRNYLPALKVEYNTSAHQSSFRIQIYRIQIQNQIHGAVFPFVFYPVKPPKSVTMDSAPKPFTDVSIVMRSAGHSQISRIKYFKVLIQEMDLRLDLGFIYALTDLMTEAEVTENTEVELFHKDIEAFKEEYKTASLVDQSQV---------SLYEYFHISPIKLHLSVSLSSGREEAKDSKQNGGLIPVHS--LNLLLKSIGATLTDVQDVVFKLAFFELNYQFHTTSDLQSEVIRHYSKQAIKQMYVLILGLDVLGNPFGLIREFSEGVEAFFYEPYQGAIQGPEEFVEGMALGLKALVGGAVGGLAGAASKITGAMAKGVAAMTMDEDYQQKRREAMNKQPAGFREGITRGGKGLVSGFVSGITGIVTKPIKGAQKGGAAGFFKGVGKGLVGAVARPTGGIIDMASSTFQGIKRATETS-EVESLRPPRFFNEDGVIRPYRLRDGTGNQM-LQVMENGR-FAKYKYFTHVMI-NKTDMLMITRRGVLFVTKG-TFGQLTCEWQYSFDEFTKEPFIVHGRR-LRIEAKERVKSVF 3101          

HSP 2 Score: 536.184 bits (1380), Expect = 4.271e-152
Identity = 355/1072 (33.12%), Postives = 569/1072 (53.08%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKE-TETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSS-------SLASDGSDELQKKVRSE-----FTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGS-VPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSE-RTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQ-----TAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIP 3179
            MVFES+VV+++N++LGDYVV LD SQL LG+  G   L+NL IKENA    D+P KV+ GHI  L L IPWK+LY++PV A L+ +Y+LI+P+S +KYDP KE   L E KQ+EL RIEE K K  D ++   E +D+F EKL  QI+KNLQ+ IS+IHIRYED  T  ++  + GI+L NLS QT D       + +++ +   K +++D+L  YWN   + F   +       +KN I +         F+ +PIS +A + ++ + +  +F+ P+++L+++L  I   FN+ QY  I   L+S+D       +RK++P+VP+  +   WW +  + +LE  V  R  MWSWK+I+ HR + + Y +++++KL  KK       +++  E+ LD+ NIT+ RQ AE                     +    G+     G  D E +        S +   ++E Q  V+ E      T EEKA LY+AIGYSE   DP +   + +LK  + L+ +  ++ +N  K  +L+ +VI   S  + QR  A AI     +++  +TG   PD S  P L+S+   +  M+L  + FE NPLD++ +Q+  I AEPLEIIYD+ TVN IV+F  PP+E+ L +++   L  +EE +  TATGL ++ + +   D+K+++K SY I+P+ G ++    +LL+DLG + + S+ R+ +P          K G+ N   + + AYD F I L+++Q L    GD+WR+ R    S  HIL P  F   L K ++  D  +PK  + G LP + + ISD+ LQ ++ELI  IP P+     +AP K      S     S     I P L L S     +     D+  + L   +             L+  D +V              NM      F +    ++    + +  +       +V+++V  +G  + ++ +D+   A++    L  P+++D   K PV L  T  +T  ++LL +  +  EK  PD  + + N    ++  F S+++ LH EALL  +N++++++P
Sbjct:    1 MVFESVVVDVLNRFLGDYVVDLDTSQLSLGIWKGAVALKNLQIKENALSQLDVPFKVKVGHIGNLKLIIPWKNLYTQPVEAVLEEIYLLIVPSSRIKYDPLKEEKQLMEAKQQELKRIEEAKQKVVDQEQHLPEKQDTFAEKLVTQIIKNLQVKISSIHIRYEDDITNRDKPLSFGISLQNLSMQTTDQYWVP-CLHDETEKLVRKLIRLDNLFAYWNVKSQMFYLSDYDNSLDDLKNGIVNENIVPEGYDFVFRPISANAKLVMNRRSD-FDFSAPKINLEIELHNIAIEFNKPQYFSIMELLESVDMMAQNLPYRKFKPDVPLHHHAREWWAYAIHGVLEVNVCPRLWMWSWKHIRKHRQKVKQYKELYKKKLTSKKPPGELLVSLEELEKTLDVFNITIARQTAE--------------------VEVKKAGYKIYKEGVKDPEDNKGWFSWLWSWSEQNTNEQQPDVQPETLEEMLTPEEKALLYEAIGYSETAVDPTLLKTFEALKFFVHLKSMSIVLRENHQKP-ELVDIVIEEFSTLIVQRPGAQAIKFETKIDSFHITGL--PDNSEKPRLLSSLDDA--MSLFQITFEINPLDETVSQRCIIEAEPLEIIYDARTVNSIVEFFRPPKEVHLAQLTAATLTKLEEFRSKTATGLLYIIETQKVLDLKINLKASYIIVPQDGIFSPTSNLLLLDLGHLKVTSKSRSELPDV--------KQGEANLKEIMDRAYDSFDIQLTSVQLLYSRVGDNWREARKLSVSTQHILVPMHFNLELSKAMVFMDVRMPKFKIYGKLPLISLRISDKKLQGIMELIESIPKPEPVTEVSAPVKSFQIQTSTSLGTSQISQKIIPLLELPSVSEDDSEEEFFDAPCSPLEEPLQFPTGVKSIRTRKLQKQDCSV--------------NMTTFKIRFEVPKVLIEFYHLVGDCEL------SVVEILVLGLGAEIEIRTYDLKANAFLKEFCLKCPEYLD-ENKKPVYLVTTLDNTM-EDLLTLEYVKAEKNVPDLKSTYNNVLQLIKVNFSSLDIHLHTEALLNTINYLHNILP 1015          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Human
Match: VPS13C (vacuolar protein sorting 13 homolog C [Source:HGNC Symbol;Acc:HGNC:23594])

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 444/1466 (30.29%), Postives = 751/1466 (51.23%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEE--NKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSE--TASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIP----VLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQV----PSVPESKE 4373
            MV ES+V +L+N++LGDYV  L+KSQLKLG+ GGN  L+NL IKENA  + D+P KV+ G I KLTLKIPWK+LY E V+A L+GLY+L++P + +KYD  KE   L + KQKEL+RIEE   K    D  KE + KD+F EKLA Q++KN+Q+ I++IHI+YED  T P R  + G+TL  LS  T +   T  I+ E + +  +K +++DSL+ YWN N       +R  +   +KN I +S     +  ++ QPIS SA ++++   E +    P++  +++++ I     + QY  +   L+S+D       +RKY+P +P+ +N   WW +  + +LE  +RR  +MWSW  I+ HR   + Y   ++ KL   K+S+  Q  I+  E+ LD+ NI L RQQA+++V +     + K       +     G +     K   +   SL  +  D+L        T EEK KL+ AIGYSE T +  +P +YV+  + L+L      I +N     +++K+ I  +   V QR  A A+ V   + +  +TG +  D  VP+LV++   +   +LL + FETNP D  A+Q + ++++P+E+IYD+ TVN +V+F    + L L +I++  L  +EE+KE TATGL H+ + R   D+++++KPSY ++P+ G + +   +L++D G+  + S+   +  + ++ L          + + + AYDKF + +  +Q L     + W+K R Q  S  HIL+P      L K ++  D  + +  V G LP + V ISD+ ++ VL L+  IP PQ +  +      S +   SG   G+     L ++ +L  +    D E   A           +  E K A E+ +                  +I+L   F I    L+  +  K           I+   V ++GT  T++ FD+ V +Y+  + L   + ++ S + P+ L  +     G +LL +  +  +K  P F T    T   ++  F S+ + L  +AL+  +N++ ++IP     +++ +E +  T      E+ +K +TL K   +  D              +D ID                            ++F            A L    VIV NEK NNI +I I G+ + +        +   + ++ + D  P  V+KK + I  +E +F   + L+   T    Y  D+S+VD ++++ VG I+I++L+ F++ +  FLN+FQ + ++++    + +E AA  + ++ +   S R  ++I++KAPVI IP++S S NA++VDLG +   N F++    D     V++   + L+ L + R+++       +  +LHPIN+   + RNL+ +  H +P + I   + S++V ++Q D N+   +L  N  E    +    P V E+ E
Sbjct:    1 MVLESVVADLLNRFLGDYVENLNKSQLKLGIWGGNVALDNLQIKENALSELDVPFKVKAGQIDKLTLKIPWKNLYGEAVVATLEGLYLLVVPGASIKYDAVKEEKSLQDVKQKELSRIEEALQKAAEKDKPKEAK-KDTFVEKLATQVIKNVQVKITDIHIKYEDDVTDPKRPLSFGVTLGELSLLTANEHWTPCILNE-ADKIIYKLIRLDSLSAYWNVNCSMSYQRSREQILDQLKNEILTSGNIPPNYQYIFQPISASAKLYMNPYAE-SELKTPKLDCNIEIQNIAIELTKPQYLSMIDLLESVDYMVRNAPYRKYKPYLPLHTNGRRWWKYAIDSVLEVHIRRYTQMWSWSNIKKHRQLLKSYKIAYKNKLTQSKVSEEIQKEIQDLEKTLDVFNIILARQQAQVEVIRSGQKLRKKSADTGEKRGGWFSGLWGKKESK--KKDEESLIPETIDDL-------MTPEEKDKLFTAIGYSESTHNLTLPKQYVAHIMTLKLVSTSVTIRENK-NIPEILKIQIIGLGTQVSQRPGAQALKVEAKLEHWYITGLRQQD-IVPSLVASIGDTT-SSLLKIKFETNPEDSPADQTLIVQSQPVEVIYDAKTVNAVVEFFQSNKGLDLEQITSATLMKLEEIKERTATGLTHIIETRKVLDLRINLKPSYLVVPQTGFHHEKSDLLILDFGTFQLNSKDQGLQKTTNSSL----------EEIMDKAYDKFDVEIKNVQLLFARAEETWKKCRFQHPSTMHILQPMDIHVELAKAMVEKDIRMARFKVSGGLPLMHVRISDQKMKDVLYLMNSIPLPQKSSAQSPERQVSSIPIISGGTKGL-----LGTSLLLDTVESESDDEYFDAEDGEPQTCKSMKGSELKKAAEVPNE----------------ELINLLLKFEIKEVILEFTKQQKE-------EDTILVFNVTQLGTEATMRTFDLTVVSYLKKISLDYHE-IEGSKRKPLHLISSSDKP-GLDLLKVEYIKADKNGPSFQTAFGKTEQTVKVAFSSLNLLLQTQALVASINYLTTIIPSDDQSISVAKEVQIST------EKQQKNSTLPKAIVSSRD--------------SDIIDF---------------------------RLF------------AKLNAFCVIVCNEK-NNIAEIKIQGLDSSLSLQSRKQSLFARLENIIVTDVDPKTVHKKAVSIMGNE-VFRFNLDLYPDATEGDLYT-DMSKVDGVLSLNVGCIQIVYLHKFLMSLLNFLNNFQTAKESLSAATAQAAERAATSVKDLAQR--SFRVSINIDLKAPVIVIPQSSISTNAVVVDLGLIRVHNQFSLVSDEDYLNPPVIDRMDVQLTKLTLYRTVIQPGIYHPDIQLLHPINLEFLVNRNLAASWYHKVPVVEIKGHLDSMNVSLNQEDLNLLFRILTENLCEGTEDLDKVKPRVQETGE 1347          

HSP 2 Score: 551.206 bits (1419), Expect = 1.550e-156
Identity = 383/920 (41.63%), Postives = 561/920 (60.98%), Query Frame = 3
Query: 7377 KAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG-----WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFY--ESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDF-YINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEG-LEVDLSKKLMIK--PEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEA------MFVKDCQMIRASLIETS-TIKTILSGGKKCVFDNFHISPIKIHLSFSL------SRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCK-SKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDN 10061
            K  LKI+ S WS  FSLDTVGS G V C    + Y VGV I +SS  L++IVT  P+  I N+SS+ L   E+  +       W  +   E +PFWP S  GK  +     E      ++PF FY  + +  L+ LE    GI V+V   E + +I    Y EG A   ++NH   D+ + +KQ  +P+E++L   Q  ++AW D    R+  W    +  +H  +L  DG   F Y   ++ +WVSF+    R+LLFT+D+ +   A  + ++E  D EIT+SLHS+GLSLV+N  +QE++YI ITSSGV W +++ K + KP    Q   LE ++       +  +   +   +K++   EV+  K  M    P +  + R F  G+ ++++ S HQ  +  R+Y +Q+DNQ+    FPVVF P  PP+S+ALD+  KP I++S +   +  +  +++KYF VLIQEM L +DQGF+ +I+   +   PT D EA      +  +D   + A L+ETS T  +ILS      F++FHISP+K+HLS SL      S   +    A+HS  +NL L+S+G  +TD+ D+IFKL Y+E +      +Q++ S+  HY  Q L+QMYVLVLGLDVLGNPFG+IRG+++GVE LFYEP +GAV GPEEF EG+  GV+SLFGH VGGAAG VSRI G++GKG+AA+T+D +YQ+KRRE+L+++P + G  LA+GGKG + G V GVTG++TKP++GAKK+G  GFFKG+GKGLVG V RP  G+VD ASS+F+GI+R A++  EV  +RPPR I +DGIIR Y  +E+EG+++   +      +  E Y +H     SKK ++ +TN+R+  +   EILG+  + WQ  +E    PP+++E+    V  +  K++ LF K +
Sbjct: 2772 KVQLKISTSAWSSSFSLDTVGSYGCVKCPANNMEYLVGVSIKMSSFNLSRIVTLTPFCTIANKSSLELEVGEIASDGSMPTNKWNYIASSECLPFWPESLSGKLCVRVVGCEGS----SKPF-FYNRQDNGTLLSLEDLNGGILVDVNTAEHSTVITFSDYHEGSAPALIMNHTPWDI-LTYKQSGSPEEMVLLPRQARLFAWADPTGTRKLTWTYAANVGEH--DLLKDGCGQFPYDANIQIHWVSFLDGRQRVLLFTDDVALVSKALQAEEMEQADYEITLSLHSLGLSLVNNESKQEVSYIGITSSGVVW-EVKPKQKWKPFSQKQIILLEQSY-------QKHQISRDHGWIKLDNNFEVNFDKDPMEMRLPIRSPIKRDFLSGIQIEFKQSSHQRSLRARLYWLQVDNQLPGAMFPVVFHPVAPPKSIALDSEPKPFIDVSVITRFNEYSKVLQFKYFMVLIQEMALKIDQGFLGAIIALFT---PTTDPEAERRRTKLIQQDIDALNAELMETSMTDMSILS-----FFEHFHISPVKLHLSLSLGSGGEESDKEKQEMFAVHS--VNLLLKSIGATLTDVDDLIFKLAYYEIRYQFYKRDQLIWSVVRHYSEQFLKQMYVLVLGLDVLGNPFGLIRGLSEGVEALFYEPFQGAVQGPEEFAEGLVIGVRSLFGHTVGGAAGVVSRITGSVGKGLAAITMDKEYQQKRREELSRQPRDFGDSLARGGKGFLRGVVGGVTGIITKPVEGAKKEGAAGFFKGIGKGLVGAVARPTGGIVDMASSTFQGIQRAAESTEEVSSLRPPRLIHEDGIIRPYDRQESEGSDL---LENHIKKLEGETYRYHCAIPGSKKTILMVTNRRVLCIKEVEILGLMCVDWQCPFEDFVFPPSVSEN----VLKISVKEQGLFHKKD 3658          

HSP 3 Score: 322.398 bits (825), Expect = 5.713e-87
Identity = 316/1282 (24.65%), Postives = 579/1282 (45.16%), Query Frame = 3
Query: 3468 ITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKI--------LPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELI--RNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXX--XXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQ-IYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDA------YSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKP-CNSDEEFKVYLKADG---EVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDN---EGPSRGNVSEREIN-----TLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKC---YNVPIPT-----LLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKS---NTGVMYYYSVALSIEEVQIVNSSETLR-TYKLDINVPLALHNQLPIKISY--QSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAV 7166
            ITA L    V V ++K  NI DI IHGM A +      T+V   + D+ + +    +++KK + I  DE +F  Q+ L+   T    Y  D+S+VD  ++ +VG I+I++++ F + +  FLN+FQ + + ++    + +E AA+ + ++ ++  S R  +DIN+KAPVI IP++S S NA++ DLG +  +N F++      S   V+++  I L+ L++SR+IL  +  +N+  IL P+N+ + + RNL+      IP + I  ++  + V +S+ D  +   +L  N  EA +Q       +E V+ RK+        L + +    ++ + ++ +++QF F  E L + L+  D N     +       L +++   ++  G M  + +M VSV+L    + D +    +  + +I  +N ++++S  I I + QDKN  S++   +  +Y+C  V++LM + DFF+KA P        +  ++P R       K  K     P      +  +   +  PE++ V  +   D+ A+       L  S  K   ++   + D + + CPF  E R KN   ++ P S+ +      +     ++ ++  II I+P ++ ++  IM  L+ ++ +     DGS   +++   ++N W               G+      NT   GV++  ++ +    +E    ++   + +  I+V LE  +  + VP+L+ E    G++KN  + +     V++ V Y+N+   VWEPL+E    +       +++     D  L   +DF     I    ++I + S + + +T+SKS L+V +NL K F +       YSL          AP+ VKN  G  +         +KP CN        L+  G   +  ++D VD  Q+L  E         G    +SR+  S +   +    ++   N     P R   + R  N     +++V   A  G K + LRS LQ+ N+      +Y            KN  LLE +   +    ++VP+ +      +   G +    K+  T IS     W    +       +L C S   +   +   +VAL  E   I    E     Y + +   L L N LP  + Y  +    +H++  G    V  + +  +    V   YQ K W G   +   + E   + F + +    + +DL VH+     +  ++++SPYW++NKT   L Y++ +D  V+H A   D +
Sbjct: 1558 ITAELNAFNVFVCDQK-CNIADIKIHGMDASISVKPKQTDVFARLKDIIVMNVDLQSIHKKAVSILGDE-VFRFQLTLYPDATEGEAYA-DMSKVDGKLSFKVGCIQIVYVHKFFMSLLNFLNNFQTAKEALSTATVQAAERAASSMKDLAQK--SFRLLMDINLKAPVIIIPQSSVSPNAVIADLGLIRVENKFSLVPMEHYSLPPVIDKMNIELTQLKLSRTILQASLPQNDIEILKPVNMLLSIQRNLAAAWYVQIPGMEIKGKLKPMQVALSEDDLTVLMKILLENLGEASSQPSPTQSVQETVRVRKVDVSSVPDHLKEQEDWTDSKLSMNQIVSLQFDFHFESLSIILYNNDINQESGVAFHNDSFQLGELRLHLMASSGKMFKDGSMNVSVKLKTCTLDDLREGIERATSRMIDRKNDQDNNSSMIDISYKQDKN-GSQIDAVLDKLYVCASVEFLMTVADFFIKAVPQSPENVAKETQILP-RQTATGKVKIEKDDSVRP------NMTLKAMITDPEVVFVASLTKADAPALTASFQCNLSLSTSKLEQMMEASVRDLKVLACPFLREKRGKNITTVLQPCSLFMEKCTWASGKQNINIMVKEFIIKISPIILNTVLTIMAALSPKTKE-----DGSKDTSKE---MENLW---------------GIKSINDYNTWFLGVDTATEITESFKGIEHSLIEENCGVVVESIQVTLECGLGHRTVPLLLAESKFSGNIKNWTSLMAAVADVTLQVHYYNEIHAVWEPLIERVEGKRQWNLRLDVKKNPVQDKSLLPGDDF-----IPEPQMAIHISSGNTMNITISKSCLNVFNNLAKGFSEGTASTFDYSLKDR-------APFTVKNAVGVPI--------KVKPNCN--------LRVMGFPEKSDIFD-VDAGQNLELEYASMVPSSQGNLSILSRQESSFFTLTIVPHGYTEVANIPVARPGRRLYNVRNPNASHSDSVLVQIDATEGNKVITLRSPLQIKNHFSIAFIIYKF---------VKNVKLLERIGIARPEEEFHVPLDSYRCQLFIQPAGILEHQYKESTTYIS-----WKEELHRSREVRCMLQCPSVEVSFLPLIVNTVALPDELSYICTHGEDWDVAYIIHLYPSLTLRNLLPYSLRYLLEGTAETHELAEGSTADVLHSRISGEIMELVLVKYQGKNWNGHFRIRDTLPEFFPVCF-SSDSTEVTTVDLSVHVRRIGSRMVLSVFSPYWLINKTTRVLQYRS-EDIHVKHPADFRDII 2758          

HSP 4 Score: 57.3806 bits (137), Expect = 8.305e-7
Identity = 36/120 (30.00%), Postives = 66/120 (55.00%), Query Frame = 3
Query: 2820 EKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIP 3179
            EK G + + +L V ++G    +K +DM  +AY+  + +    F D S   P+ +  +   T  + LL + L   +   P+F T+H +T+ +L+  F S+++ LH EALL  ++F++S  P
Sbjct: 1400 EKKG-RPLHELNVLQLGMEAKVKTYDMTAKAYLKKISMQCFDFTD-SKGEPLHIINSSNVTD-EPLLKMLLTKADSDGPEFKTIHDSTKQRLKVSFASLDLVLHLEALLSFMDFLSSAAP 1516          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Celegans
Match: T08G11.1 (pep chromosome:WBcel235:I:8905644:8916805:-1 gene:WBGene00011629.1 transcript:T08G11.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T08G11.1)

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 668/2470 (27.04%), Postives = 1179/2470 (47.73%), Query Frame = 3
Query: 2862 EIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLIT-DRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAAN----KITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAID-QSTSVVLEESKITLSNLRVSRSILLEN--TVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKIL-----PKDDKSGSARTASDESITVQ-------FGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFF--VXXXXXXXXXXXXXMVPVRGYEKNPRKYRK-----KPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDI---INVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGS-LTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQL-IVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLR------MPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGE-VQLY-----DAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQL-ELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNT------GVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDT-----VESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKI-NDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMM-MRCKVE-DREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMK---AYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCE--LSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVP--TYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA-------LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFS 10052
            ++   L ++ FDM V A +GS+ +++P+F     K            +G  L+ +  +     SP F T +A T   ++ +F  + V LHQE +L +  F  +L   LN                E +K T  EK+ E       +K   S+M + +  R     EKR  +    + +++ D +                +  I AS   L +++  +K      ++I  + A+VK +    EV  T+  + ++D +P AVYKK++ +   E +       + Q T      +  S VD +V + + +++ +FL  ++ R+  +L  FQ      A  AQ  +   A      +  ++E+ P  R +LD+ ++AP I +P  S S + +++ LG L  KN+   D +    +++   I +++      ++ E+   V +   IL PI+  + + RNL++     +P+I + A + SI   MS  DY      L  N  E  +     P     ++S         P  +K    R A+     ++       F F ++ +   L++G+A       E         ++ +N+   G +  ++++  ++ L     +D +     KI++L+    +    F+ + F QD  +N ++ + ++  ++C+C ++L  LT FF   +++    +    A VP +    +P          K  + P +P +    ID  +   E++LVED ++P+S   ++ +  V   S   E      +NV + +       ++S  R + T  +++P  I    N         + L M  L I ++P++I+ +S +    +  S    +   GS      +L    N+++ +  D  ++ F +  + +        + VE   DV Q     ++ R D +  +      +  I   LE+      VP++  +  ++ +  +  + + +   VSV +SY+N+ ++VWEP++E    E      +++  ++       D  D      ++  A  +L ++     L++     +V +   K      + HL        +P+VV N  G  V     K  D +     E  +      GE V ++       V++++  I +E+    +KF  A ++ RE   I R E R +   P+ ++G  +          LIV+ T     ++L  L S ++  N+    + +Y       K +T  +  L   V  G+   + +P L + +G IY+       E+S     W+   N + +  Q + C++++      G+  Y    +  E++Q     +T   Y + ++ PL  HN LP  I+ +       +  G   L+        S +K    Y  +++   + +    +++ V+    + G  E  + LG+H   + G   V +Y+P+W++N T   L +       + + A                        +++V   ++  ++Q L T     +  PA DL                      +K  KA ++I N S WS++F LDTVG++ ++ CK     +++ V I L  SGLTKIVTF P+Y++ N     +   E  +  GW+ +P    V  WP     + +M +R K E + E L+   FP  E++  L  ++ + +G+ V V   E +  I+L  +  GM  V+++N+L   V + F Q    +  + P  +   ++W    + +  +  V+       + L  +   D  I++     +Y+ +F+    R+LLFT D+ +AK A  S + + +D +  ISL   GLS+VDN + +E+ Y++I+SS + W +  +K R KPL +   + LE   +++   L T   + E     +E  EV++++ +M K +  E  L R+FE G++  Y  S  +  +H +I  IQIDNQ+  C FP V +  PPP+SV +D   KP IELS +  +   +     +Y  VLIQE  + +DQG +N++L  +SG V    Y +E MF +D ++   +L ET++  T  S   K  +++ HISPI +HLSFS  +   +G  A       + SE++N+ L+SVG+ +T++QDV+FKL YFE++       Q+ S I SHY  Q ++Q+YVLVLGLD++GNPFG++R ++ GVEDLFY+P +GA+ GPEEF  GVA GV+S+FGHAVGGAAGAV RI GT+GKG+AALT D DY +KR+E L ++P++ G G+A+G KGL +G V G+TGVVTKPI+GAK++G  GF KGVGKGL+GVVTRPVSGVVDFAS +   +R VA TN E   +RPPR + +D I++ Y   +A G  ++ K T++ +    + +V +    S+K V+ +T++R+    R +++G+W  +W   Y K+  P  I    + +   LKEK++    
Sbjct:  872 KMACKLQMRTFDMVVTAELGSIKISMPEFKSLDEKREHLYLIDNDELQGA-LMTLKFVQANPESPFFATEYALTEQSVDFRFTKLAVSLHQEGVLELKAFGEALQAQLN----------------ELQKNTPEEKKVEETARKISRKLSDSVMSIASMSRTPSGKEKRQRKKTVGSATQEMDVS-------------RNIKQRIKASFGSLALMIGTQKHLET-SLAIENINANVKITEKAMEVVATLRAISMKDRTPGAVYKKLLSVTGKEDMLRFDFVQY-QRTDEQRALMKSSDVDMVVKMRLAQMRFVFLNLWLARLMAWLAPFQNEAVLAAQAAQAAAAEKAATAAQNVKQIMEQSPP-RIQLDVILEAPFIVVPRLSTSRDVIVLHLGRLALKNEIRGDSEYPKAIIDRMDILMTDCSFGMGVMNEDVSAVSSSCLILKPISFKLALQRNLTFAVAKELPEIVVDAHIHSIEAEMSDADYKTLMQTLSGNLAEGADLAIPPPPPPSSLESSNTAAALTSPGKEKEKKDREANAGPPVIEKSHTRIVFQFVLDKISAVLYEGEAV----NGERKESDAFAALRLKNVKTSGKIGEDNSIVFAMSLDAFT-MDDERKEKTKISKLMDKKGSKDDRFLDMSFNQDAEANKQIRLKMSAFFICLCPEFLGCLTRFFNVPQSEEQLEKQAVTANVPTKAVSASPSASSTFTGGTKTSSGPPQP-VGTLAIDCDMHGVEVILVEDSMHPESTQALILSFNVTAASHPNEQTKDTKMNVAVENLTIFSSYYQSSRRNEVTYQVLTPVRIEALVNMNTERKTTDAVLKMSALDIKMSPSIIRLLSAVSAEFSKSSAPGET---GSISQKAAKLRKWPNYFDSKPIDHRKYWFFAAPVAQ--------EAVEEELDVTQ----EDKSRTDSMIGKESAKVDIERISFTLEAGTGAIPVPLIFLDMLVNAEAYDWSSAMRVSSGVSVQMSYYNESVSVWEPIIEPVENEKGEFERWKLA-MTMKSRNKQDSSDSSPQTEVKIEADKMLNVTVTKSLLSLLNKLSEVFATAAKQITPTKTRHLPGI-----SPFVVLNETGISV-----KVLDTETIRVSENGQAVDATHGEFVDVFLKNRKSDVEDRRLSIEQEEITGDLKFELAGTV-RE-TKIGRAEKRVIHL-PRVSDGGHKW---------LIVAETTVENSRRLVTLNSHVKFTNHLSYAVEIY------SKRDTTLD--LFGTVEHGETIPLAVPLLFSPSGDIYLKPVDDKYEVSFESLCWH---NFEHNRRQAVRCEADSTDGSFSGI--YIDSVVHEEKIQDGIDDQTTSIYHVHLHPPLEFHNNLPFDINIELP-EQKVLGAGMSTLLNVVA---GSPVKAWLTYLGEKYVLDMSIPEIKKDVEVVALNTETGSDE--LLLGLHWTSEYGDQKVYLYAPFWLVNNTDKMLRHVESSGNMLSNTARGCVPCG----------------KKSVVTSQENDDAVQHLPTENPIILPFPAIDL----------------------SKKKKARVRIENLSEWSEEFPLDTVGNAARITCKGSEHDFDLTVDIKLCQSGLTKIVTFAPFYLVSNLGKNPMEIREEGQK-GWVDIPAETCVGIWPVERKKRKLMCVRYKEEPEAESLL---FPITENYETLCHMDGEAIGVEVSVSTGESSVAIHLSSFVPGMCPVQVMNNL--TVPVTFGQKGHIKTTVGPN-EFAHFSWSSIIEPK--VLEVDIGDWHFEDKLDQNRFGDLQIDKSVRRFSYYSNFLIGRQRVLLFTPDVDIAKAAYGSWETDVVDMQAEISLQGFGLSVVDNIVGREIIYMAISSSDILWEEEVKKGRFKPLAVKYMQVLE---EKYQAHLVTPNDDYE----AMEAFEVNVNRMIMKKKKGKEVKLRRIFEKGLWACYGKSSQRTRLHAKINHIQIDNQLDACIFPRVLSVVPPPKSVIVDNTPKPFIELSLLQRQPEFSSIAEIEYGHVLIQEFSVQVDQGLINALLLLISGEVTRKPYGKE-MFDEDIKICHVTLSETAS--TYRSQRPKSFYNDLHISPIMMHLSFS--QGGTSGDVAASGVSMPIQSEMINVLLRSVGVTLTELQDVVFKLAYFERKCVFYSPEQLNSEIISHYAKQFIKQVYVLVLGLDIIGNPFGLVRDLSAGVEDLFYQPFQGAIQGPEEFAAGVALGVQSMFGHAVGGAAGAVGRITGTVGKGVAALTFDDDYMKKRQEDLNRKPQSFGEGMARGLKGLGMGVVGGITGVVTKPIEGAKQEGGFGFVKGVGKGLIGVVTRPVSGVVDFASGTMNSVRAVAGTNREAGPLRPPRVLREDKIVKPYSSGDAYGFKVF-KDTDRGELAETDEFVTYASI-SEKMVLIITDRRLVLSKRTDMMGVWQTEWGSEYCKIKEPEFI---PNGVKILLKEKKKGFLG 3181          

HSP 2 Score: 456.833 bits (1174), Expect = 2.850e-128
Identity = 282/826 (34.14%), Postives = 458/826 (55.45%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSS-ENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPET--TNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNV-PMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGT-----KGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQT 2474
            MVFESLV +L+N++LGD+V  LD SQL +G+ GG+  L+NL +KE A DDFDLP+K++ G++S L LKIPWK+LY+EPVIA +DGL ++++PN  + Y+ EK    + E KQK L R+EE + +R  PK      D+F EK+  QI+KNLQIS+SNIH+R+ED  T  +R FA+GITL  L+F+T D +    I K D  +  +K V + +LA+YWNS+ +  S  +++  ++  ++  I + +      +++++PI   A + ++ KPET  +N+ +P++ L + +  +  A  + QY D+  FL++ +R     ++ KYRPN+   + +   WW F Y  ILEE+VRRRR  WSW  +Q HR   R Y   W ++  +       Q TIK  E++LD+ N+ + RQQAE            + + ++ ++ T    W   WFG     T       G+ ++  + +   T EEKAKL++AI Y E     + P E+V  K + +L ++  ++ D ++   +L+KLV     A V+QR SA A+ V   +  +++ G      +  D S+P           M+ L+   +TNPL  + +Q + +   P+ I Y +  +N+ +    PPE ++L +++   ++  EEVK  +ATGL +  + R    + V I+P+   + E G Y+ +   LL D+G + +V+   S   S DT       G      + E AYD+FH+ LS +     E  +       ++ S  H+L+P G +  + K  I +D  L K+ V G LP++ + ISD  L  +++L L IP P+ 
Sbjct:    1 MVFESLVADLLNRFLGDFVDNLDSSQLNIGIWGGDVKLDNLQVKETALDDFDLPIKLKYGYLSSLVLKIPWKNLYNEPVIATVDGLNLIVVPNKGVVYNEEKVAKNIQEIKQKTLARLEEARKERRKPKD--PQADTFTEKMITQIIKNLQISVSNIHVRFEDRYTNRHRPFAMGITLEKLNFKTTDENWRETIHK-DVVKIIYKLVSLQNLAIYWNSSTEFISDLDDKEAIRKKLQETIHNGKNGPEGYNYILEPIQMEAKLKLNQKPETDGSNWKIPKIDLAVDMHALSIAIGKFQYQDVLLFLEAQERFNAAGQYLKYRPNLNEFKGHYKAWWKFAYTSILEEKVRRRRNNWSWDRMQKHRQLVRKYQKAWVRRQTEASPGADVQATIKEAEKKLDVFNVNVARQQAE-------LEIDREGLTRQEDKPTGWVAWGKSWFGGGGGPTPDK--KKGAKDIGSQFQEAMTPEEKAKLFEAIDYQENIPPTNYPKEFVENKFDFKLGQVAIVV-DGAVS-MQLLKLV-----ASVEQRPSASAMHVESSIQELRMDGCGTEIIRVRDPSIP----------WMSFLL---DTNPLKGNYDQLVKLAVAPINIKYQAPAINNAIDVFKPPESVRLNQLTALAMSRYEEVKARSATGLAYAVEHRSRLVLDVQIQPARIYVSEGGTYSSEKPTLLADMGLLSVVTVDNS---SVDT------SGMNKMAALMEKAYDRFHVKLSNVVIAFAENVETAENCVFEKESPLHVLKPTGLDIQIHKSSI-DDLKLAKMRVIGDLPNIVIGISDDRLIGLMKLGLSIPTPKA 784          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Celegans
Match: T08G11.1 (pep chromosome:WBcel235:I:8905644:8916805:-1 gene:WBGene00011629.1 transcript:T08G11.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T08G11.1)

HSP 1 Score: 484.567 bits (1246), Expect = 8.223e-137
Identity = 352/914 (38.51%), Postives = 546/914 (59.74%), Query Frame = 3
Query: 7362 FAKTVKAHLKI-NDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMM-MRCKVE-DREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMK---AYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCE--LSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVP--TYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA-------LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFS 10052
             +K  KA ++I N S WS++F LDTVG++ ++ CK     +++ V I L  SGLTKIVTF P+Y++ N     +   E  +  GW+ +P    V  WP     + +M +R K E + E L+   FP  E++  L  ++ + +G+ V V   E +  I+L  +  GM  V+++N+L   V + F Q    +  + P  +   ++W    + +  +  V+       + L  +   D  I++     +Y+ +F+    R+LLFT D+ +AK A  S + + +D +  ISL   GLS+VDN + +E+ Y++I+SS + W +  +K R KPL +   + LE   +++   L T   + E     +E  EV++++ +M K +  E  L R+FE G++  Y  S  +  +H +I  IQIDNQ+  C FP V +  PPP+SV +D   KP IELS +  +   +     +Y  VLIQE  + +DQG +N++L  +SG V    Y +E MF +D ++   +L ET++  T  S   K  +++ HISPI +HLSFS  +   +G  A       + SE++N+ L+SVG+ +T++QDV+FKL YFE++       Q+ S I SHY  Q ++Q+YVLVLGLD++GNPFG++R ++ GVEDLFY+P +GA+ GPEEF  GVA GV+S+FGHAVGGAAGAV RI GT+GKG+AALT D DY +KR+E L ++P++ G G+A+G KGL +G V G+TGVVTKPI+GAK++G  GF KGVGKGL+GVVTRPVSGVVDFAS +   +R VA TN E   +RPPR + +D I++ Y   +A G  ++ K T++ +    + +V +    S+K V+ +T++R+    R +++G+W  +W   Y K+  P  I    + +   LKEK++    
Sbjct: 2267 LSKKKKARVRIENLSEWSEEFPLDTVGNAARITCKGSEHDFDLTVDIKLCQSGLTKIVTFAPFYLVSNLGKNPMEIREEGQK-GWVDIPAETCVGIWPVERKKRKLMCVRYKEEPEAESLL---FPITENYETLCHMDGEAIGVEVSVSTGESSVAIHLSSFVPGMCPVQVMNNL--TVPVTFGQKGHIKTTVGPN-EFAHFSWSSIIEPK--VLEVDIGDWHFEDKLDQNRFGDLQIDKSVRRFSYYSNFLIGRQRVLLFTPDVDIAKAAYGSWETDVVDMQAEISLQGFGLSVVDNIVGREIIYMAISSSDILWEEEVKKGRFKPLAVKYMQVLE---EKYQAHLVTPNDDYE----AMEAFEVNVNRMIMKKKKGKEVKLRRIFEKGLWACYGKSSQRTRLHAKINHIQIDNQLDACIFPRVLSVVPPPKSVIVDNTPKPFIELSLLQRQPEFSSIAEIEYGHVLIQEFSVQVDQGLINALLLLISGEVTRKPYGKE-MFDEDIKICHVTLSETAS--TYRSQRPKSFYNDLHISPIMMHLSFS--QGGTSGDVAASGVSMPIQSEMINVLLRSVGVTLTELQDVVFKLAYFERKCVFYSPEQLNSEIISHYAKQFIKQVYVLVLGLDIIGNPFGLVRDLSAGVEDLFYQPFQGAIQGPEEFAAGVALGVQSMFGHAVGGAAGAVGRITGTVGKGVAALTFDDDYMKKRQEDLNRKPQSFGEGMARGLKGLGMGVVGGITGVVTKPIEGAKQEGGFGFVKGVGKGLIGVVTRPVSGVVDFASGTMNSVRAVAGTNREAGPLRPPRVLREDKIVKPYSSGDAYGFKVF-KDTDRGELAETDEFVTYASI-SEKMVLIITDRRLVLSKRTDMMGVWQTEWGSEYCKIKEPEFI---PNGVKILLKEKKKGFLG 3154          

HSP 2 Score: 456.447 bits (1173), Expect = 2.896e-128
Identity = 282/826 (34.14%), Postives = 458/826 (55.45%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSS-ENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPET--TNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNV-PMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGT-----KGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQT 2474
            MVFESLV +L+N++LGD+V  LD SQL +G+ GG+  L+NL +KE A DDFDLP+K++ G++S L LKIPWK+LY+EPVIA +DGL ++++PN  + Y+ EK    + E KQK L R+EE + +R  PK      D+F EK+  QI+KNLQIS+SNIH+R+ED  T  +R FA+GITL  L+F+T D +    I K D  +  +K V + +LA+YWNS+ +  S  +++  ++  ++  I + +      +++++PI   A + ++ KPET  +N+ +P++ L + +  +  A  + QY D+  FL++ +R     ++ KYRPN+   + +   WW F Y  ILEE+VRRRR  WSW  +Q HR   R Y   W ++  +       Q TIK  E++LD+ N+ + RQQAE            + + ++ ++ T    W   WFG     T       G+ ++  + +   T EEKAKL++AI Y E     + P E+V  K + +L ++  ++ D ++   +L+KLV     A V+QR SA A+ V   +  +++ G      +  D S+P           M+ L+   +TNPL  + +Q + +   P+ I Y +  +N+ +    PPE ++L +++   ++  EEVK  +ATGL +  + R    + V I+P+   + E G Y+ +   LL D+G + +V+   S   S DT       G      + E AYD+FH+ LS +     E  +       ++ S  H+L+P G +  + K  I +D  L K+ V G LP++ + ISD  L  +++L L IP P+ 
Sbjct:    1 MVFESLVADLLNRFLGDFVDNLDSSQLNIGIWGGDVKLDNLQVKETALDDFDLPIKLKYGYLSSLVLKIPWKNLYNEPVIATVDGLNLIVVPNKGVVYNEEKVAKNIQEIKQKTLARLEEARKERRKPKD--PQADTFTEKMITQIIKNLQISVSNIHVRFEDRYTNRHRPFAMGITLEKLNFKTTDENWRETIHK-DVVKIIYKLVSLQNLAIYWNSSTEFISDLDDKEAIRKKLQETIHNGKNGPEGYNYILEPIQMEAKLKLNQKPETDGSNWKIPKIDLAVDMHALSIAIGKFQYQDVLLFLEAQERFNAAGQYLKYRPNLNEFKGHYKAWWKFAYTSILEEKVRRRRNNWSWDRMQKHRQLVRKYQKAWVRRQTEASPGADVQATIKEAEKKLDVFNVNVARQQAE-------LEIDREGLTRQEDKPTGWVAWGKSWFGGGGGPTPDK--KKGAKDIGSQFQEAMTPEEKAKLFEAIDYQENIPPTNYPKEFVENKFDFKLGQVAIVV-DGAVS-MQLLKLV-----ASVEQRPSASAMHVESSIQELRMDGCGTEIIRVRDPSIP----------WMSFLL---DTNPLKGNYDQLVKLAVAPINIKYQAPAINNAIDVFKPPESVRLNQLTALAMSRYEEVKARSATGLAYAVEHRSRLVLDVQIQPARIYVSEGGTYSSEKPTLLADMGLLSVVTVDNS---SVDT------SGMNKMAALMEKAYDRFHVKLSNVVIAFAENVETAENCVFEKESPLHVLKPTGLDIQIHKSSI-DDLKLAKMRVIGDLPNIVIGISDDRLIGLMKLGLSIPTPKA 784          

HSP 3 Score: 222.631 bits (566), Expect = 2.863e-57
Identity = 309/1475 (20.95%), Postives = 616/1475 (41.76%), Query Frame = 3
Query: 2862 EIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLIT-DRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAAN----KITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAID-QSTSVVLEESKITLSNLRVSRSILLEN--TVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKIL-----PKDDKSGSARTASDESITVQ-------FGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFF--VXXXXXXXXXXXXXMVPVRGYEKNPRKYR-----KKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKES---DIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGS-LTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQL-IVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIY------LRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGE-VQLY-----DAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQL-ELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSN------TGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQ 7133
            ++   L ++ FDM V A +GS+ +++P+F     K            +G  L+ +  +     SP F T +A T   ++ +F  + V LHQE +L +  F  +L   LN                E +K T  EK+ E       +K   S+M + +  R     EKR  +    + +++ D +                +  I AS   L +++  +K      ++I  + A+VK +    EV  T+  + ++D +P AVYKK++ +   E +       + Q T      +  S VD +V + + +++ +FL  ++ R+  +L  FQ      A  AQ  +   A      +  ++E+ P  R +LD+ ++AP I +P  S S + +++ LG L  KN+   D +    +++   I +++      ++ E+   V +   IL PI+  + + RNL++     +P+I + A + SI   MS  DY      L  N  E  +     P     ++S         P  +K    R A+     ++       F F ++ +   L++G+A       E         ++ +N+   G +  ++++  ++ L     +D +     KI++L+    +    F+ + F QD  +N ++ + ++  ++C+C ++L  LT FF   +++    +    A VP +    +P          K  + P +P +    ID  +   E++LVED ++P+S   ++ +  V   S   E      +NV + +       ++S  R + T  +++P  I    N         + L M  L I ++P++I+ +S +    +  S    +   GS      +L    N+++ +  D  ++ F +  + +        + VE   DV Q     ++ R D +       + +  I   LE+      VP++  +  ++ +  +  + + +   VSV +SY+N+ ++VWEP++E    E      +++  ++       D  D      ++  A  +L ++     L++     +V +   K      + HL        +P+VV N  G  V     K  D +     E  +      GE V ++       V++++  I +E+    +KF  A ++ RE   I R E R +   P+ ++G  +          LIV+ T     ++L  L S ++  N+    + +Y       K +T  +  L   V  G+   + +P L + +G IY+       E+S     W+   N + +  Q + C+++      +G+  Y    +  E++Q     +T   Y + ++ PL  HN LP  I+ +       +  G   L+        S +K    Y  +++   + +    +++ V+    + G  E  + LG+H   + G   V +Y+P+W++N T   L +   D  Q
Sbjct:  872 KMACKLQMRTFDMVVTAELGSIKISMPEFKSLDEKREHLYLIDNDELQGA-LMTLKFVQANPESPFFATEYALTEQSVDFRFTKLAVSLHQEGVLELKAFGEALQAQLN----------------ELQKNTPEEKKVEETARKISRKLSDSVMSIASMSRTPSGKEKRQRKKTVGSATQEMDVS-------------RNIKQRIKASFGSLALMIGTQKHLET-SLAIENINANVKITEKAMEVVATLRAISMKDRTPGAVYKKLLSVTGKEDMLRFDFVQY-QRTDEQRALMKSSDVDMVVKMRLAQMRFVFLNLWLARLMAWLAPFQNEAVLAAQAAQAAAAEKAATAAQNVKQIMEQSPP-RIQLDVILEAPFIVVPRLSTSRDVIVLHLGRLALKNEIRGDSEYPKAIIDRMDILMTDCSFGMGVMNEDVSAVSSSCLILKPISFKLALQRNLTFAVAKELPEIVVDAHIHSIEAEMSDADYKTLMQTLSGNLAEGADLAIPPPPPPSSLESSNTAAALTSPGKEKEKKDREANAGPPVIEKSHTRIVFQFVLDKISAVLYEGEAV----NGERKESDAFAALRLKNVKTSGKIGEDNSIVFAMSLDAFT-MDDERKEKTKISKLMDKKGSKDDRFLDMSFNQDAEANKQIRLKMSAFFICLCPEFLGCLTRFFNVPQSEEQLEKQAVTANVPTKAVSASPSASSTFTGGTKTSSGPPQP-VGTLAIDCDMHGVEVILVEDSMHPESTQALILSFNVTAASHPNEQTKDTKMNVAVENLTIFSSYYQSSRRNEVTYQVLTPVRIEALVNMNTERKTTDAVLKMSALDIKMSPSIIRLLSAVSAEFSKSSAPGET---GSISQKAAKLRKWPNYFDSKPIDHRKYWFFAAPVAQ--------EAVEEELDVTQ----EDKSRTDSMIGKESAKVDIERISFTLEAGTGAIPVPLIFLDMLVNAEAYDWSSAMRVSSGVSVQMSYYNESVSVWEPIIEPVENEKGEFERWKLA-MTMKSRNKQDSSDSSPQTEVKIEADKMLNVTVTKSLLSLLNKLSEVFATAAKQITPTKTRHLPGI-----SPFVVLNETGISV-----KVLDTETIRVSENGQAVDATHGEFVDVFLKNRKSDVEDRRLSIEQEEITGDLKFELAGTV-RE-TKIGRAEKRVIHL-PRVSDGGHKW---------LIVAETTVENSRRLVTLNSHVKFTNHLSYAVEIY------SKRDTTLD--LFGTVEHGETIPLAVPLLFSPSGDIYLKPVDDKYEVSFESLCWH---NFEHNRRQAVRCEADSTDGSFSGI--YIDSVVHEEKIQDGIDDQTTSIYHVHLHPPLEFHNNLPFDINIELP-EQKVLGAGMSTLLNVVA---GSPVKAWLTYLGEKYVLDMSIPEIKKDVEVVALNTETGSDE--LLLGLHWTSEYGDQKVYLYAPFWLVNNTDKMLRHVNDDAVQ 2250          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Celegans
Match: C25H3.11 (pep chromosome:WBcel235:II:5669788:5689030:-1 gene:WBGene00016120.1 transcript:C25H3.11b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C25H3.11)

HSP 1 Score: 169.474 bits (428), Expect = 3.444e-41
Identity = 114/391 (29.16%), Postives = 199/391 (50.90%), Query Frame = 3
Query:   27 VFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIP-NSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKE------TETKDS-FGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSS-ENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFT----VPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTK----NRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLL 1148
            + E++V  ++N Y+G+Y+  L+  QL + LL G   LEN+ +K+ A    DLPV+V+ G + KLTL +P  H+ SEP   +L  + +++ P +SE +YD E       E ++KE   +EE +L+      +       E++DS +G  L + ++ N+Q+ ++N+HIRYED +T P + F  GI +  ++ QT +        +       FK +++   ++YWNS      + E+   LK I+    SS+       +++IQP  CSA   + M+  ++ F     VPR    ++ + +G    R+Q       L +++R W +     + RK+RP   +  N   WW F YN +LEE  RR     +W +     +R   Y   + ++L+
Sbjct:    1 MLENVVAWVLNNYIGEYLEDLNTDQLSVALLSGQVELENVPLKKTALRKLDLPVEVKSGLLGKLTLSVPITHIRSEPWTLKLSDVLIIVGPLSSEKRYDVEAVEQ--VEQQRKE-QMLEELELRHKTALFDLCGIPIPESQDSWWGASLISTVLNNIQLILNNVHIRYEDDTTIPGQTFNCGIRIQKMTMQTTNHHWKPGFAEPQKGTNTFKKLELGGFSIYWNSKTTMTENIEDSKQLKLILAPETSSN-------AYIIQP--CSA--ELRMEKNSSKFPLKSKVPRFKFFMRPDILGLELTRHQMTQ----LRAVNREWARFERARQHRKWRPLCTIGENAKEWWKFAYNRVLEES-RRANANRTWDFAHERASRFNAYCRAYRKRLI 372          

HSP 2 Score: 60.8474 bits (146), Expect = 2.878e-8
Identity = 40/169 (23.67%), Postives = 79/169 (46.75%), Query Frame = 3
Query: 8958 HLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAK 9464
            H+  S+  V+++G        L L  Q   + +   ++    L  F + +     + ++ S+   Y+++  +Q   +++ LD  GNP G++  +    + LF E   G V   + FV G+ YG+ +           +VS++  +M  G+ ALT D D++ KRR  + +
Sbjct: 2900 HVGLSVVTVSKSGL----PRDLRLLKQQFNVKLISFENASVALPPFRQYHYFETSSFLLESLQKFYLAELQKQTLSIIVTLDAFGNPLGLVTDLKDSFQGLFIE---GDV---QRFVAGLGYGLSN-----------SVSKVASSMASGVGALTFDQDHELKRRHNMIR 3047          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Celegans
Match: C25H3.11 (pep chromosome:WBcel235:II:5669788:5689030:-1 gene:WBGene00016120.1 transcript:C25H3.11c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C25H3.11)

HSP 1 Score: 169.474 bits (428), Expect = 3.470e-41
Identity = 114/391 (29.16%), Postives = 199/391 (50.90%), Query Frame = 3
Query:   27 VFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIP-NSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKE------TETKDS-FGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSS-ENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFT----VPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTK----NRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLL 1148
            + E++V  ++N Y+G+Y+  L+  QL + LL G   LEN+ +K+ A    DLPV+V+ G + KLTL +P  H+ SEP   +L  + +++ P +SE +YD E       E ++KE   +EE +L+      +       E++DS +G  L + ++ N+Q+ ++N+HIRYED +T P + F  GI +  ++ QT +        +       FK +++   ++YWNS      + E+   LK I+    SS+       +++IQP  CSA   + M+  ++ F     VPR    ++ + +G    R+Q       L +++R W +     + RK+RP   +  N   WW F YN +LEE  RR     +W +     +R   Y   + ++L+
Sbjct:    1 MLENVVAWVLNNYIGEYLEDLNTDQLSVALLSGQVELENVPLKKTALRKLDLPVEVKSGLLGKLTLSVPITHIRSEPWTLKLSDVLIIVGPLSSEKRYDVEAVEQ--VEQQRKE-QMLEELELRHKTALFDLCGIPIPESQDSWWGASLISTVLNNIQLILNNVHIRYEDDTTIPGQTFNCGIRIQKMTMQTTNHHWKPGFAEPQKGTNTFKKLELGGFSIYWNSKTTMTENIEDSKQLKLILAPETSSN-------AYIIQP--CSA--ELRMEKNSSKFPLKSKVPRFKFFMRPDILGLELTRHQMTQ----LRAVNREWARFERARQHRKWRPLCTIGENAKEWWKFAYNRVLEES-RRANANRTWDFAHERASRFNAYCRAYRKRLI 372          

HSP 2 Score: 60.8474 bits (146), Expect = 2.902e-8
Identity = 40/169 (23.67%), Postives = 79/169 (46.75%), Query Frame = 3
Query: 8958 HLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAK 9464
            H+  S+  V+++G        L L  Q   + +   ++    L  F + +     + ++ S+   Y+++  +Q   +++ LD  GNP G++  +    + LF E   G V   + FV G+ YG+ +           +VS++  +M  G+ ALT D D++ KRR  + +
Sbjct: 2892 HVGLSVVTVSKSGL----PRDLRLLKQQFNVKLISFENASVALPPFRQYHYFETSSFLLESLQKFYLAELQKQTLSIIVTLDAFGNPLGLVTDLKDSFQGLFIE---GDV---QRFVAGLGYGLSN-----------SVSKVASSMASGVGALTFDQDHELKRRHNMIR 3039          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Celegans
Match: C25H3.11 (pep chromosome:WBcel235:II:5669788:5689030:-1 gene:WBGene00016120.1 transcript:C25H3.11a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C25H3.11)

HSP 1 Score: 169.474 bits (428), Expect = 3.532e-41
Identity = 114/391 (29.16%), Postives = 199/391 (50.90%), Query Frame = 3
Query:   27 VFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIP-NSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKE------TETKDS-FGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSS-ENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFT----VPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTK----NRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLL 1148
            + E++V  ++N Y+G+Y+  L+  QL + LL G   LEN+ +K+ A    DLPV+V+ G + KLTL +P  H+ SEP   +L  + +++ P +SE +YD E       E ++KE   +EE +L+      +       E++DS +G  L + ++ N+Q+ ++N+HIRYED +T P + F  GI +  ++ QT +        +       FK +++   ++YWNS      + E+   LK I+    SS+       +++IQP  CSA   + M+  ++ F     VPR    ++ + +G    R+Q       L +++R W +     + RK+RP   +  N   WW F YN +LEE  RR     +W +     +R   Y   + ++L+
Sbjct:    1 MLENVVAWVLNNYIGEYLEDLNTDQLSVALLSGQVELENVPLKKTALRKLDLPVEVKSGLLGKLTLSVPITHIRSEPWTLKLSDVLIIVGPLSSEKRYDVEAVEQ--VEQQRKE-QMLEELELRHKTALFDLCGIPIPESQDSWWGASLISTVLNNIQLILNNVHIRYEDDTTIPGQTFNCGIRIQKMTMQTTNHHWKPGFAEPQKGTNTFKKLELGGFSIYWNSKTTMTENIEDSKQLKLILAPETSSN-------AYIIQP--CSA--ELRMEKNSSKFPLKSKVPRFKFFMRPDILGLELTRHQMTQ----LRAVNREWARFERARQHRKWRPLCTIGENAKEWWKFAYNRVLEES-RRANANRTWDFAHERASRFNAYCRAYRKRLI 372          

HSP 2 Score: 60.8474 bits (146), Expect = 2.855e-8
Identity = 40/169 (23.67%), Postives = 79/169 (46.75%), Query Frame = 3
Query: 8958 HLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAK 9464
            H+  S+  V+++G        L L  Q   + +   ++    L  F + +     + ++ S+   Y+++  +Q   +++ LD  GNP G++  +    + LF E   G V   + FV G+ YG+ +           +VS++  +M  G+ ALT D D++ KRR  + +
Sbjct: 2902 HVGLSVVTVSKSGL----PRDLRLLKQQFNVKLISFENASVALPPFRQYHYFETSSFLLESLQKFYLAELQKQTLSIIVTLDAFGNPLGLVTDLKDSFQGLFIE---GDV---QRFVAGLGYGLSN-----------SVSKVASSMASGVGALTFDQDHELKRRHNMIR 3049          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Fly
Match: Vps13 (gene:FBgn0033194 transcript:FBtr0310024)

HSP 1 Score: 523.857 bits (1348), Expect = 1.277e-148
Identity = 353/907 (38.92%), Postives = 534/907 (58.88%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG-WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLE-KKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEM-KAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIR-RKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIR---ASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLF 10049
            +++ F    KA ++I++  WS+K  LD  GS G+V+C      Y VGV  +L+ + LTK +TF+P+Y++ N+    +   E    A  W+ + P E  P WPR++   ++++R   +     +T  F F E    L+KLE  K+ GI V+VQ TE    I    Y+   A   LINH G  +  H K   T  E IL A  T+MYAW D    +  ++   G  K+ ++ L  DGI +  + +  K  WVSF+    R+LLFT +  +A     +A L+SI Q I + +H IGLS+++N    ++ Y+ +TSSG+ W   +  KNR K L + ++  LE  + +++  +  S  +V+ + +      +D    ++ K  +  L R F P ++L  ++SP Q  +H++I +IQ+DNQ  D  FPVV AP PPP+SVA  T LKP IE S V      +   ++KY R+LIQE    +D  F+ +I +  +  V        F +D + I    ++  E  +++      +K  +DN H+ P+KIH+SFS++       T      L   +Q VG+ +TD+ DV+F+L +FE++       Q+++ ITSHY  QAL+Q+YVLVLGLDVLGNP+G++ G+ +GVEDLFYEP +GA+ GP EF EG+  GVKSLFGH VGGAAGAVS+I G MGKG+AALT D DYQ+KRR+ +  +P+N   GLA+  KGL++GFV GVTGVVTKP+ GA+ +G+EGFFKG+GKG +G+V RP +GVVDFAS SFE ++R AD + +V R+RPPRF   D ++R Y L EA GN I +K T+K      + ++       K   + +TN R+ ++ RNE+ G+W+  W   + ++    ++  +   + FT+K   +K+ 
Sbjct: 2394 RDKLFFDKKKASIRIDNGQWSEKIPLDVAGSVGEVICFANNQKYPVGVHNHLTQNSLTKQITFIPFYIVCNKCHFDIELQEQSRPADPWLHLEPNEMEPLWPRNDTKNNLVVRVDGK-----ITPAFDFTEVICTLLKLEDSKYGGINVDVQTTEGGVYITFTDYKPADAPGLLINHTGKQIVYHEK--GTKNEHILNAKSTIMYAWDDPTGPKMLVF---GTNKEETD-LKRDGIGEVIMQDGGKVLWVSFLDGLQRVLLFTENESIANRTESTASLQSITQSIDLRIHGIGLSVINNETGLDILYLGVTSSGIIWESKKVTKNRFKELTINENALLEIEYQKYL--VHKSVNDVQTYKLD-NKFPIDFDLMILKKTVERNLRRSFYPAIWLSRKSSPFQSQLHVKINRIQVDNQFLDPIFPVVLAPIPPPKSVASTTSLKPFIECSMVQRIMPNSTVRQFKYARILIQEFLFKVDLNFLTAIAEMFAKEVSDEAAAKQFRQDVESIELPLSAFFEEHSLEE-----QKSFYDNLHLGPLKIHVSFSMA----GSDTKALPGFLGSLVQGVGVTLTDVNDVVFRLAFFEREYQFFSQKQLINEITSHYTGQALKQLYVLVLGLDVLGNPYGLVVGLKKGVEDLFYEPFQGAIQGPGEFAEGLVLGVKSLFGHTVGGAAGAVSKITGAMGKGLAALTFDEDYQKKRRQGIQNKPKNFHEGLARSSKGLVMGFVDGVTGVVTKPVTGARDNGVEGFFKGLGKGAIGLVARPTAGVVDFASGSFEAVKRAADASEDVKRMRPPRFQHYDFVLRPYCLMEATGNKI-MKETDKGKFATTDNFIHCEEIIQKSEYLVVTNYRVMYVQRNEMFGVWTSLWSYLWNEIS---SVAATARGVQFTVKTDGKKVL 3273          

HSP 2 Score: 459.144 bits (1180), Expect = 7.651e-129
Identity = 276/838 (32.94%), Postives = 463/838 (55.25%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIE---ENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTN--FTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRP-NVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFII------SDNSLKEY-KLMKLVIHSMS---AHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKY-TKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRK-LRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPP 2483
            MVFE++V +++NK LGDY+  LD++QLK+G+ GG+  L+NL I+ENA D+ DLPV++  G++ KL LKIPWK+LYS+PVI  ++ LYVL+ PN+ ++Y+ EKE  Y  + K+  L+ +E   + +L+ + PK +      F EKL AQIV NLQ+ I+N+H+RYEDT+T     F+ GI+L  L   T D       + + ++ + FK   +  L+ Y N   + +++ N++ L    K NI+  E K  + ++++ PISC+A + ++M PE  +  F  P++ L L++E++       Q+ ++    D+M+R      +RKYRP N+P + +   WWHF    ILEE+VR+ R  W+W +I+ HR RC  Y   ++++ L KK S    +T ++ E ELD+ N+ L RQ+              ++      +     GW  G   K D +T+S        +L +K  +  T EEK K+Y+AIGY E     D+P  Y ++++N +L  L+  +      S  + K++ +L  LV+ + S   A + QR +A+AIS+   M  ++VTG    D + P LV ++   +  NLL V FETNPLDK  +Q++ + A PL+I YD+ T+  ++     P ++ L +        I   KE +ATG++++ D++   D+ + + P+  ++P +G Y   +  +L+V +G + + S+              G+D       + E AYD+F + +  +Q L++  G+ W+  L    S++ H+LRP   +     CV+ ND  LP I V   LP + V +S+  +   +++   IP P+   P
Sbjct:    1 MVFEAVVADVLNKVLGDYIENLDRNQLKIGIWGGDVVLQNLKIRENALDELDLPVQLIYGYLGKLVLKIPWKNLYSQPVIVNIEDLYVLVSPNNNVQYNAEKEAKYEMDLKKAALDALEAARKKELEMDQPKADA----GFAEKLTAQIVNNLQVQITNVHLRYEDTTTT-GSPFSFGISLHELELYTTDCDWEKCYMAQQAS-QVFKIANLSCLSAYLNCGGQLYAN-NKSDLSQQFKTNIACKETK-PNYNYVLGPISCNAKLKLNMNPELDDPPFEKPKIDLTLEMEKLNVGLTNTQFDNLMKLGDAMNRQQLGIPYRKYRPYNIPYKGHARDWWHFAITSILEEEVRKPRESWTWGHIKTHRERCNTYAQKYKEQCLSKKPSAVLTETCRLLETELDVFNLLLIRQRVN-------IEIAKQREAVPEQKSGWFSGWGWGGGAKKDDQTTSQ-------KLVEKFEAAMTSEEKEKMYRAIGYQENAKPTDLPESYEAIRMNFKLIALEVGLYKDERNSSAATKDFHELPSLVLLNFSMATALITQRPAAEAISIIAGMREIKVTGLTRNDYT-PLLVESKITDEF-NLLEVFFETNPLDKLCDQRVKVVARPLQITYDAPTILALINAFQTPGDVTLSKFEDAASTKISNFKERSATGMQYMIDKKAVLDVDILLMPNILVVPHKGVYDAGNVSLLVVSMGQVHLSSQPRRESNKLQHLFSAGEDKDEILKTVMENAYDRFTVAVDDVQMLVVRAGEPWQNALAEANSTEMHVLRPVSLKVTAALCVVDNDPRLPNIKVDIDLPAILVNVSEDRIFLAIKVATSIPLPEQKEP 814          

HSP 3 Score: 223.402 bits (568), Expect = 2.498e-57
Identity = 257/1087 (23.64%), Postives = 501/1087 (46.09%), Query Frame = 3
Query: 2988 TKKHTKGQNLLF-INLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMT-QWAITASLQKLRVIVANEKDNNILDISIHGMRAD--VKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKND----FAIDQSTSVVLEESKITLSNLRVSRSILLENT------VKNEKGIL------HPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESI---------TVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKI----------------NELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXM-VPVRGYEKNPRKYRKKP--LAS----PVEPRLAD-----FEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLL---EVYPEEHNRQYS-FEIEYISCDDSGLFD-EEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINK 6062
            T K     N LF ++  I +K+SP+F T + +T   +   F+ +++ LHQE L  ++  +N+    L++V               TR +  +                 SI G   D I     KRT+ +  E   E    +     KK     +  T +  + A+L ++ +++   K   I ++++    +   +K+SY  TEV+I + D+++ D +P  ++K I+ I   ++ F+ Q+ ++N+   T  Y  D    D  + +++G +KIIFL  FV  +  FLN+F  +  T++      +E+A  K  +  E   ++R KL+I +KAP+I +P  S+  NAL++DLG L   N+       ++    V++E K+ + ++++S+ +LL+        V  E G L      +P++  + +TRNLS+     +P+++++ R+ SI + +   DY +  LVL  N NE + + P   E+ +E + R   P+   S + R +    +         +++F F+ + + + L +G+               L +     LSV+G+   N  +  SV L NI + D + +S  +I                +E+I    N+ +  + +  I  K  ++   V + G  + +C+D+L+ LT F         +        PV    ++ +   +    LA+    PVE    +       + + +  P+I+LVE++ + +++ I+      L Y  + +  I+N  I   +   C F  E R+     I+ P  ISL  + P   GM  SL +  +IIN++PA I+ ++K M ++++ +  + +  + S   N       N W +  F    + F         K+    D +E+  +   +  D E+++ ++  + +P I +++ES V     P++  +  +     N    +    +++++++Y+N  +  WEP++   EV      R+Y+ +E+++    + G+   + + ED    E  A+ + + S + LE+T+SK+ L +LS L +AF  A   +      I  APYV++N  G DV   + K
Sbjct:  973 TPKQENSSNYLFTVSCTIADKSSPEFSTKYNSTEQLVVANFEVLQIVLHQECLQRIMEVVNNFQRNLDLV------------LSSTRPRDRM----------------GSIGG--GDGI-----KRTLNVILEDTEEIMTTDQMKRRKKTRRTHVVETVKVRVIANLDQVGLVLTGRK-RPIAEMNVKKFVSSLIIKSSY--TEVNIGLKDIQVLDLNPYTIHKNILSIVGKDA-FNCQIVIYNK-EETQDYNSD----DMKITVDIGCMKIIFLNWFVAGVMNFLNNFTAAQATISQAGAAAAESARQKAMDAYET--ATRMKLNIRIKAPIIIVPIGSQDRNALLLDLGLLELTNNTVEVAVAEEERLAVIDEIKLQICDVKISKIVLLDGNESTVDEVDAEVGFLSKFNMMNPMSCTLSITRNLSYTWYRDVPELNLSGRLKSIELTLFADDYALVMLVLNRNLNEGLEEFPPSEEAPQEAQVR---PERRNSRAGRLSRTVQVSPIREKIHESIKFNFQFDGVVINLMEGEG------------AGLARFGIYFLSVKGTKLDNGTLSTSVVLCNIQMDDMRSNSKSQIRQYLSRKDWVQPKLDTDEIIDACYNERNFMVDVTAII-KEDDTFAEVRVRGFDLIVCIDFLLKLTTFLTLPPEENPRESVYIKPAPVSETARDTKHSIRSSAILAAQELVPVESSSHEVPNRKMNLILHIDEPDIILVENLEDLNTSCIIFNAQVHLNYRSINDKQIVNGQIDALKMYMCAFLPERREMTRHYILHPCVISLQGSTPEEEGMHISLKLSDIIINVSPATIELLNKAMLSVSSGTMTKCAIAEES--RN-----YSNLWHQHHFHSRTYWFT--------KVEQGVDALEA--EQRSVSTDNEKQKTEKCVIEIPSITLVIESGVGYYTKPLISLDTRITAVFNNWSRSLTAHGSLTLNMNYYNQALAEWEPIIELNEVIGRNGVREYTPWELKF----EMGMEKVQSELED--DAEQQAMHMNIHSAETLEITLSKTCLGLLSELAEAFSQAIDQNGLTKPDIV-APYVLENDTGFDVNLNLRK 1973          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Fly
Match: Vps13 (gene:FBgn0033194 transcript:FBtr0088910)

HSP 1 Score: 523.857 bits (1348), Expect = 1.277e-148
Identity = 353/907 (38.92%), Postives = 534/907 (58.88%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG-WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLE-KKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEM-KAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIR-RKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIR---ASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLF 10049
            +++ F    KA ++I++  WS+K  LD  GS G+V+C      Y VGV  +L+ + LTK +TF+P+Y++ N+    +   E    A  W+ + P E  P WPR++   ++++R   +     +T  F F E    L+KLE  K+ GI V+VQ TE    I    Y+   A   LINH G  +  H K   T  E IL A  T+MYAW D    +  ++   G  K+ ++ L  DGI +  + +  K  WVSF+    R+LLFT +  +A     +A L+SI Q I + +H IGLS+++N    ++ Y+ +TSSG+ W   +  KNR K L + ++  LE  + +++  +  S  +V+ + +      +D    ++ K  +  L R F P ++L  ++SP Q  +H++I +IQ+DNQ  D  FPVV AP PPP+SVA  T LKP IE S V      +   ++KY R+LIQE    +D  F+ +I +  +  V        F +D + I    ++  E  +++      +K  +DN H+ P+KIH+SFS++       T      L   +Q VG+ +TD+ DV+F+L +FE++       Q+++ ITSHY  QAL+Q+YVLVLGLDVLGNP+G++ G+ +GVEDLFYEP +GA+ GP EF EG+  GVKSLFGH VGGAAGAVS+I G MGKG+AALT D DYQ+KRR+ +  +P+N   GLA+  KGL++GFV GVTGVVTKP+ GA+ +G+EGFFKG+GKG +G+V RP +GVVDFAS SFE ++R AD + +V R+RPPRF   D ++R Y L EA GN I +K T+K      + ++       K   + +TN R+ ++ RNE+ G+W+  W   + ++    ++  +   + FT+K   +K+ 
Sbjct: 2394 RDKLFFDKKKASIRIDNGQWSEKIPLDVAGSVGEVICFANNQKYPVGVHNHLTQNSLTKQITFIPFYIVCNKCHFDIELQEQSRPADPWLHLEPNEMEPLWPRNDTKNNLVVRVDGK-----ITPAFDFTEVICTLLKLEDSKYGGINVDVQTTEGGVYITFTDYKPADAPGLLINHTGKQIVYHEK--GTKNEHILNAKSTIMYAWDDPTGPKMLVF---GTNKEETD-LKRDGIGEVIMQDGGKVLWVSFLDGLQRVLLFTENESIANRTESTASLQSITQSIDLRIHGIGLSVINNETGLDILYLGVTSSGIIWESKKVTKNRFKELTINENALLEIEYQKYL--VHKSVNDVQTYKLD-NKFPIDFDLMILKKTVERNLRRSFYPAIWLSRKSSPFQSQLHVKINRIQVDNQFLDPIFPVVLAPIPPPKSVASTTSLKPFIECSMVQRIMPNSTVRQFKYARILIQEFLFKVDLNFLTAIAEMFAKEVSDEAAAKQFRQDVESIELPLSAFFEEHSLEE-----QKSFYDNLHLGPLKIHVSFSMA----GSDTKALPGFLGSLVQGVGVTLTDVNDVVFRLAFFEREYQFFSQKQLINEITSHYTGQALKQLYVLVLGLDVLGNPYGLVVGLKKGVEDLFYEPFQGAIQGPGEFAEGLVLGVKSLFGHTVGGAAGAVSKITGAMGKGLAALTFDEDYQKKRRQGIQNKPKNFHEGLARSSKGLVMGFVDGVTGVVTKPVTGARDNGVEGFFKGLGKGAIGLVARPTAGVVDFASGSFEAVKRAADASEDVKRMRPPRFQHYDFVLRPYCLMEATGNKI-MKETDKGKFATTDNFIHCEEIIQKSEYLVVTNYRVMYVQRNEMFGVWTSLWSYLWNEIS---SVAATARGVQFTVKTDGKKVL 3273          

HSP 2 Score: 459.144 bits (1180), Expect = 7.651e-129
Identity = 276/838 (32.94%), Postives = 463/838 (55.25%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIE---ENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTN--FTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRP-NVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFII------SDNSLKEY-KLMKLVIHSMS---AHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKY-TKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRK-LRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPP 2483
            MVFE++V +++NK LGDY+  LD++QLK+G+ GG+  L+NL I+ENA D+ DLPV++  G++ KL LKIPWK+LYS+PVI  ++ LYVL+ PN+ ++Y+ EKE  Y  + K+  L+ +E   + +L+ + PK +      F EKL AQIV NLQ+ I+N+H+RYEDT+T     F+ GI+L  L   T D       + + ++ + FK   +  L+ Y N   + +++ N++ L    K NI+  E K  + ++++ PISC+A + ++M PE  +  F  P++ L L++E++       Q+ ++    D+M+R      +RKYRP N+P + +   WWHF    ILEE+VR+ R  W+W +I+ HR RC  Y   ++++ L KK S    +T ++ E ELD+ N+ L RQ+              ++      +     GW  G   K D +T+S        +L +K  +  T EEK K+Y+AIGY E     D+P  Y ++++N +L  L+  +      S  + K++ +L  LV+ + S   A + QR +A+AIS+   M  ++VTG    D + P LV ++   +  NLL V FETNPLDK  +Q++ + A PL+I YD+ T+  ++     P ++ L +        I   KE +ATG++++ D++   D+ + + P+  ++P +G Y   +  +L+V +G + + S+              G+D       + E AYD+F + +  +Q L++  G+ W+  L    S++ H+LRP   +     CV+ ND  LP I V   LP + V +S+  +   +++   IP P+   P
Sbjct:    1 MVFEAVVADVLNKVLGDYIENLDRNQLKIGIWGGDVVLQNLKIRENALDELDLPVQLIYGYLGKLVLKIPWKNLYSQPVIVNIEDLYVLVSPNNNVQYNAEKEAKYEMDLKKAALDALEAARKKELEMDQPKADA----GFAEKLTAQIVNNLQVQITNVHLRYEDTTTT-GSPFSFGISLHELELYTTDCDWEKCYMAQQAS-QVFKIANLSCLSAYLNCGGQLYAN-NKSDLSQQFKTNIACKETK-PNYNYVLGPISCNAKLKLNMNPELDDPPFEKPKIDLTLEMEKLNVGLTNTQFDNLMKLGDAMNRQQLGIPYRKYRPYNIPYKGHARDWWHFAITSILEEEVRKPRESWTWGHIKTHRERCNTYAQKYKEQCLSKKPSAVLTETCRLLETELDVFNLLLIRQRVN-------IEIAKQREAVPEQKSGWFSGWGWGGGAKKDDQTTSQ-------KLVEKFEAAMTSEEKEKMYRAIGYQENAKPTDLPESYEAIRMNFKLIALEVGLYKDERNSSAATKDFHELPSLVLLNFSMATALITQRPAAEAISIIAGMREIKVTGLTRNDYT-PLLVESKITDEF-NLLEVFFETNPLDKLCDQRVKVVARPLQITYDAPTILALINAFQTPGDVTLSKFEDAASTKISNFKERSATGMQYMIDKKAVLDVDILLMPNILVVPHKGVYDAGNVSLLVVSMGQVHLSSQPRRESNKLQHLFSAGEDKDEILKTVMENAYDRFTVAVDDVQMLVVRAGEPWQNALAEANSTEMHVLRPVSLKVTAALCVVDNDPRLPNIKVDIDLPAILVNVSEDRIFLAIKVATSIPLPEQKEP 814          

HSP 3 Score: 223.402 bits (568), Expect = 2.498e-57
Identity = 257/1087 (23.64%), Postives = 501/1087 (46.09%), Query Frame = 3
Query: 2988 TKKHTKGQNLLF-INLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMT-QWAITASLQKLRVIVANEKDNNILDISIHGMRAD--VKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKND----FAIDQSTSVVLEESKITLSNLRVSRSILLENT------VKNEKGIL------HPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESI---------TVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKI----------------NELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXM-VPVRGYEKNPRKYRKKP--LAS----PVEPRLAD-----FEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLL---EVYPEEHNRQYS-FEIEYISCDDSGLFD-EEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINK 6062
            T K     N LF ++  I +K+SP+F T + +T   +   F+ +++ LHQE L  ++  +N+    L++V               TR +  +                 SI G   D I     KRT+ +  E   E    +     KK     +  T +  + A+L ++ +++   K   I ++++    +   +K+SY  TEV+I + D+++ D +P  ++K I+ I   ++ F+ Q+ ++N+   T  Y  D    D  + +++G +KIIFL  FV  +  FLN+F  +  T++      +E+A  K  +  E   ++R KL+I +KAP+I +P  S+  NAL++DLG L   N+       ++    V++E K+ + ++++S+ +LL+        V  E G L      +P++  + +TRNLS+     +P+++++ R+ SI + +   DY +  LVL  N NE + + P   E+ +E + R   P+   S + R +    +         +++F F+ + + + L +G+               L +     LSV+G+   N  +  SV L NI + D + +S  +I                +E+I    N+ +  + +  I  K  ++   V + G  + +C+D+L+ LT F         +        PV    ++ +   +    LA+    PVE    +       + + +  P+I+LVE++ + +++ I+      L Y  + +  I+N  I   +   C F  E R+     I+ P  ISL  + P   GM  SL +  +IIN++PA I+ ++K M ++++ +  + +  + S   N       N W +  F    + F         K+    D +E+  +   +  D E+++ ++  + +P I +++ES V     P++  +  +     N    +    +++++++Y+N  +  WEP++   EV      R+Y+ +E+++    + G+   + + ED    E  A+ + + S + LE+T+SK+ L +LS L +AF  A   +      I  APYV++N  G DV   + K
Sbjct:  973 TPKQENSSNYLFTVSCTIADKSSPEFSTKYNSTEQLVVANFEVLQIVLHQECLQRIMEVVNNFQRNLDLV------------LSSTRPRDRM----------------GSIGG--GDGI-----KRTLNVILEDTEEIMTTDQMKRRKKTRRTHVVETVKVRVIANLDQVGLVLTGRK-RPIAEMNVKKFVSSLIIKSSY--TEVNIGLKDIQVLDLNPYTIHKNILSIVGKDA-FNCQIVIYNK-EETQDYNSD----DMKITVDIGCMKIIFLNWFVAGVMNFLNNFTAAQATISQAGAAAAESARQKAMDAYET--ATRMKLNIRIKAPIIIVPIGSQDRNALLLDLGLLELTNNTVEVAVAEEERLAVIDEIKLQICDVKISKIVLLDGNESTVDEVDAEVGFLSKFNMMNPMSCTLSITRNLSYTWYRDVPELNLSGRLKSIELTLFADDYALVMLVLNRNLNEGLEEFPPSEEAPQEAQVR---PERRNSRAGRLSRTVQVSPIREKIHESIKFNFQFDGVVINLMEGEG------------AGLARFGIYFLSVKGTKLDNGTLSTSVVLCNIQMDDMRSNSKSQIRQYLSRKDWVQPKLDTDEIIDACYNERNFMVDVTAII-KEDDTFAEVRVRGFDLIVCIDFLLKLTTFLTLPPEENPRESVYIKPAPVSETARDTKHSIRSSAILAAQELVPVESSSHEVPNRKMNLILHIDEPDIILVENLEDLNTSCIIFNAQVHLNYRSINDKQIVNGQIDALKMYMCAFLPERREMTRHYILHPCVISLQGSTPEEEGMHISLKLSDIIINVSPATIELLNKAMLSVSSGTMTKCAIAEES--RN-----YSNLWHQHHFHSRTYWFT--------KVEQGVDALEA--EQRSVSTDNEKQKTEKCVIEIPSITLVIESGVGYYTKPLISLDTRITAVFNNWSRSLTAHGSLTLNMNYYNQALAEWEPIIELNEVIGRNGVREYTPWELKF----EMGMEKVQSELED--DAEQQAMHMNIHSAETLEITLSKTCLGLLSELAEAFSQAIDQNGLTKPDIV-APYVLENDTGFDVNLNLRK 1973          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Fly
Match: Vps13D (gene:FBgn0052113 transcript:FBtr0273390)

HSP 1 Score: 130.954 bits (328), Expect = 2.127e-29
Identity = 92/347 (26.51%), Postives = 166/347 (47.84%), Query Frame = 3
Query:   27 VFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDS------FGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWN---SNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTV-----PRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHF 1025
            +   L+  ++N YLG Y+  L+ +QL + LL G   LEN+ I+++A   F+LPV+V  G I K+ L+IP +   + P    ++GL+ +I P +   +D EKE+    E K   L+  E         + E+    S      +G  +A  I+ N+++ IS++H R+ED           GI + +L+ Q+CD   T+   K ++    +K V++  L+VYW+    + K  S  N+  L+ +       S  +L   +F+I+PI  +A      K +     +     PR+S +L + ++    ++ Q   +   L  + +     ++R  RP   + SN   WW +
Sbjct:    1 MLRDLITWVLNTYLGKYLENLNSAQLSVALLSGEVELENIPIRKDALRSFNLPVEVTAGSIRKIKLQIPVRQFRTSPWCISIEGLFCIICPKNLDNWDYEKEKLQDLEYKLAVLDTAEAGWRSEKGKQMESYYFSSYNNWLKYGTNMATNIIDNIELKISDVHFRFEDIVDTGKSKICTGIKIGSLTAQSCDCDWTNGSYKMNNNEMNYKLVELKELSVYWDLLHEDIKCQSYSNQEILEKM------HSTCELRSHNFIIKPICATA----RWKRDKCQQVIRTKDKPRVSCELLVPEVVIDISKVQRLQMLDKLSEIRQVKEVRQYRLKRPTCTVESNPIAWWKY 337          

HSP 2 Score: 58.9214 bits (141), Expect = 1.321e-7
Identity = 111/436 (25.46%), Postives = 197/436 (45.18%), Query Frame = 3
Query: 8553 LRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELS--AVIIK-----SGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVS-GSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLS-FSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVG-LAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVA-DTNIEVF-RIRPPRFI--AKDGIIRSYGLREAEGNNIWIKITEK 9818
            L I  IQIDNQ+ D               +AL T     +E +  AV++K     S    A+ +KY  + ++     L++  +  +  F+  G +   +    +            E +  K  L   K+  F+N  I   ++ LS F+ S++       LH        +++G+ +   +D + +L  +  +     M+     +  HY++Q       ++  +D LGNP G    +++GV  L +E   G+V   +  V+ V +G+ +           + +++  T+   +  + LD D+  + R+++ +   N   G LA G KGL  G + GVT +V    DGA  DG+ GF  G+GKGLVG VT+P+ GV+D AS +   +R  + D++     R R PR +  A  G++  Y  R+++G      I +K
Sbjct: 3411 LNIAYIQIDNQLLDA-----------VSPIALHTQTSNDLEETQNAVVLKLKMLPSPNKNAIIFKYLTLDLKPSTASLEEKLILKVASFLGYGKINRQNLSVQYQ----------FENTDDKPFLQDMKRYYFENLSIGATQVRLSAFTSSKL----PVELHETK-----KALGLTLIKFEDALIELDRYSDKLHFETMDVYRKELKKHYINQVKWHAAAILGSVDFLGNPLGFANDLSEGVSGLIFE---GSV---KSLVKNVTHGISN-----------STAKLTETLSDSLGKVVLD-DHDNETRQRILELQSNTSGGHLAAGLKGLGFGLLGGVTSIVRHTYDGATSDGVPGFLSGLGKGLVGTVTKPIIGVLDLASETASAVRETSRDSHRNAPERKRLPRCVTGAPGGLLPLYSNRQSKGQQYLYLINQK 3798          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Fly
Match: Vps13B (gene:FBgn0039727 transcript:FBtr0085505)

HSP 1 Score: 70.8626 bits (172), Expect = 3.264e-11
Identity = 43/140 (30.71%), Postives = 72/140 (51.43%), Query Frame = 3
Query: 9093 FEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGL 9512
            +E+Q  +    +   S+  HY+S A+     +V  L++LG+P G+ R  + G+ D    PV+G   GP  F+ GV  G  SL  +   G   +V+++ G++ + +  LTLDA++      +   RP+    GL QG  GL
Sbjct: 3353 YERQQILTVPLRFGQSLGLHYLSGAIFGAGWVVGSLEILGSPSGLARSFSTGLRDFVSMPVQGLFRGPWGFLVGVTQGSASLLRNVTAGTVNSVTKLAGSVARNLDRLTLDAEHIELTEARRRARPQGFADGLTQGLTGL 3492          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Zebrafish
Match: vps13a (vacuolar protein sorting 13 homolog A [Source:ZFIN;Acc:ZDB-GENE-030926-1])

HSP 1 Score: 802.742 bits (2072), Expect = 0.000e+0
Identity = 612/2084 (29.37%), Postives = 1046/2084 (50.19%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLK---RNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPET-TNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQ-----AQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSE-RTSMP--GSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQV--LRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRV-IVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTS-----VVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESI-----------TVQFGFKMEFLDVELFKGDANPN-EWASEMPPDKCLTKMKCENLSVEGSMHL--NSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSD--FISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADF------EIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLT--AQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQY-----SFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGE 6128
            MVFES+VV+++N++LGDYV  LD SQL LG+ GG+A L NL+IKENA    D+P KVR GHI +L LKIPWK+LY++ V A LD +Y+LI+P + +KYD EKE   L E++Q+EL RIEE K K   + +PK E +  D+F EKL  Q++KNLQ+ ISNIH+RYED  T P+   + GI+L NLS QT D +    ++ E + + FFK V++D+L  YWN + + +S+ N       +K++++       D  F+ +PIS +A +   M P +  +F+ P+M L + L ++    +R QY  I   L S+D       +RKYRP V + +N   WW +    +LE  V+ R  MWSW +I+ HR   + Y ++++ K++ KK ++S    ++  E  LD+ NIT+ RQQAEM+ SK         ++ +  Q     GW   W G++    +  + + G D L        T  EKAKLY AIGYSE   +P++P  + ++K+N  L +L   I + S ++ +++KL +  + A + QR +A AI ++  +++ +V+G    + S P L+S +         L+NL+   FETNPLD  A+Q++ I ++PLEIIYD+ TVN +  F  PP++LQL E++   L  +E+ ++ T+TGL ++ + +   D+K+++  SY I+PE G Y     + ++DLG   + S+ R  +P   +G + L          D+M   AYD F + LS++Q L  + G DW++ R    S  HIL P   +    + ++  D+ +PK  + G LP L + ISD  ++ VL L+  IP P++   +P P + +        + G  P+L      +  LRA +++  SE             +   F+ + +    +    +         KNM +    F IN   +Q+ +      V       ++ L +  +GT L L+ FDM+   ++  + L   +++D   K  V L  T  +T+ ++LL +  +  +K +PDF  ++ NT   ++  F S+++ LH EALL  +NF+N+L+P +   +E + E    P +EE  ++   E+E   +E+    K  +       D ++L        LK            +  G+K  I EI++        ++K  V I+AN K+  ILD                                  A+YKK + I  D+ +F  ++      T    Y  D+  VD  V + VG I++IFL  F+  I  F+N+FQE+   +A    + +E AA  +  + E   S+R  LD+++KAPV+++P++S S N ++ DLG +T KN F I  S +      V++   + LS+L++ R+   ++   +E  +L P+N+ + + RNLS +  H+IP I I A +  +S+ +SQ D  +    L  N +E  +  P  P S +  K   +  K  +     T    ++           T++  FK + + + L+    +PN E       D+ L   +    ++  S+H+  +S+M+ S++L+N  +LD +    K I   +  ++ D  D   + + + Q ++  ++L   +  +Y+C  +++L+ + D F+KA                G+   P K  K+P ++  +P           E++V V  PEI+ V D+   ++ A+++ T   L          +   ISD + V CPF  E R+ N   ++ P  +     +         L++  L + ++P +I ++  I   L+  A++  E  +            I  + WE+R   + +  F+ +   E E+++T          V +++      + + + + +  I + LE+ V  + VPML+ + S  GD+K+  T I L   +S+ V+Y+N+ + +WEPLLE   +E    +     + +++      SG+ DE D     ++      I   S+D L +T+SK  L +LSNLG AF +A     E  ++    P+VVKN  G  V    ++ F  +P   + + +V    DGE
Sbjct:    1 MVFESVVVDVLNRFLGDYVGNLDSSQLSLGIWGGDAILRNLEIKENALSQLDIPFKVRAGHIGRLELKIPWKNLYTQSVEATLDEVYLLIVPTASIKYDAEKEERQLQESRQRELQRIEETKQKAAEKENPKGEKQ--DTFVEKLVTQVIKNLQVKISNIHVRYEDDVTNPSVPLSFGISLQNLSLQTADQNWNPCLLDEKA-KLFFKLVRLDNLFAYWNVSSELYSNHNPEEALRYLKHSVAIQTAIPQDYHFIFRPISANAKLR--MNPRSDVDFSSPKMDLVVNLPEVAVELSRPQYVSILELLGSVDMMTRNLPYRKYRPYVVVHTNARQWWRYVITGVLEVNVKPRLHMWSWLHIRRHRQHVKKYRELYKNKIISKKPAESLLKELEETERTLDIFNITMARQQAEMEASKAGLRIYRPGVKVEEEQSQGWFGWMWNWSGEASATQTKDVKTGGFDGL-------MTPAEKAKLYAAIGYSETAVNPNLPKNFENMKMNFHLLRLSLSIKE-SREKAEIIKLSVIDLKAMLTQRPAAQAIKISAQLSSFEVSGLPR-EKSAPILLSPRHVDGMKDKSLLNLM---FETNPLDARADQRLRIESQPLEIIYDAMTVNSMSAFFMPPKDLQLDELTNATLMKLEQFRDKTSTGLMYIIETQKVLDLKINLMASYVIVPENGFYDPKHNLAILDLGHFQMSSQSRADLPQLSAGSSTL---------EDIMSR-AYDSFDVQLSSLQFLYSKAGGDWKRARPLRQSAFHILEPVDLKVVFSRAMVVTDSRMPKFKMHGELPLLSLRISDDKVRGVLALLSSIPLPES---RPTPQSRNTQATPKASKRGNTPQLTPRRPAIDDLRA-SIIYGSEEELFFDAPSSPIEDLPFFEASSDSRHASAADKRLSMVLKDPKKNMTEFLLSFEINKLSVQLCR------VSNRQEVSVLHLFIDGLGTELKLRTFDMSSYTFLREICLECSEYLDSEDKK-VHLITTLDNTE-EDLLTLEYVKADKNAPDFKAMYKNTEQLIKVNFSSLDIHLHTEALLNSMNFLNNLLPPMK--KETQEEQPIIPKEEEEEEEEEEEEEEAKVENSAVAKKSSYKKSKFEDVVNLHIRADLNCLKV-----------FIRGEKARISEISIEGLVSEVQMKKKSVEILANLKNIIILDCDKE------------------------------ALYKKAVSIA-DKEVFDFRMVNHVDATEGDAYT-DMHIVDTSVTLTVGCIQVIFLNKFMSSILAFINNFQEAKNALAEVTAQAAEKAATGVLELAER--STRISLDVDIKAPVVFLPQSSVSHNVIVADLGLVTVKNRFEIVSSPTHTKIPPVMDIMAVGLSDLKMYRTTFTDDKFNSEIQLLKPVNMDLSIKRNLSASWYHSIPDIQINAHLKPMSLILSQEDLTVVLKTLSENLSET-SDAPPAPSSSD--KGDTVSNKGSQGSGGNTVVTAAVVEGQKSGKLKNTLKLNFKFDSMTLVLY----SPNSEIQLSDSRDESLKLAEFTLGTISTSVHMFSDSSMKASLKLTNC-LLDDKRQGVKMITSRMMAMRQDREDSVMVDVSYRQSRD-GTRLDTLVQDLYLCASMEFLLTVADVFLKALSD-------------GF-SGPPKSNKQPASTSKDPAAPAPPVVAKTEMNVVVKNPEIVFVADLTRAEAPALVMTTQCELVMKSEPSGQCMTAAISDLKIVACPFLREKRENNVTTVLQPCEVFFQSRQSNTEPQCIELSISALTLKVSPIIINTVITIQTALSPAAETPQELESP-----------IPQDLWERRSLRDLKLWFLEE---EGEEVST---------SVTRLI-----PQGESLKMSIASICLTLEAGVGHRTVPMLLAKASFQGDVKDWSTLINLHCHLSMEVNYYNEMMGLWEPLLEPLDDEDKDGFRPWTLALKMKKKPVVSSGVSDEVDG----AVPDYKTVISFTSKDQLNVTLSKCGLHMLSNLGTAFAEAAKQTAECFQTD-QTPFVVKNRLGLAVSVLHSEVF--RPIGKESKDRVVELPDGE 1940          

HSP 2 Score: 494.582 bits (1272), Expect = 1.223e-139
Identity = 365/933 (39.12%), Postives = 545/933 (58.41%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSS-IVLYCNELVENAGWIKVPPGEA-VPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYE-SHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYIN---EMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKW-NQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVE---EHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSG----SVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNR-TGKTALHSEV-----LNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKK----NVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEI 10076
            K + F +  K  L I++S  SD FS+DTVGS G V CK +   Y VGVKI+ SS  LT++VTFLP+YM++N++  ++  C E  EN  W +  PG+A VPFWP  +  K   +R KVE  +    + F F++  + +L+ L+K   GI V+V +TE + +I    Y +G A   LINH  D+  + + Q +  +   L   Q V Y W +    R   W++     ++   L S+  ED  ++   E K + VSF     R+ LFT++  + K    S  +E   QEI+I L ++G+SLV+N+  QE+A+I ITSS V W  + ++++R K L + ++  LE  + +++         ++   ++ V      VD+    +++P    L R F P + ++Y  S  Q    ++I +IQI NQ+    FP VF P  PP+SV++D+  KPL ++S +   +G +  +R KYF VLIQEM L LD GF+ +IL+  +     +V +  E  +F KD + ++  L   S   T        +++ FHISPIK+HLS SLS     + K    +E+     L+L L+S+G  +TD QDV+FKLG+FE +       Q+   +  HY  QA++QMYVLVLGLDVLGNPFG+IRG+++GVE  FYEP +GA+ GPEEF+EG+A GVK+L G AVGG AGA SRI G M KG+AA+T+D +YQ+KRRE + K+P  L  GL +GGKGL+ GFV G+TG+VTKPI GA+K+G  GFFKG+GKGLVG +TRP  G++D ASS+F+GI+R A+ + +V  +RPPRFI +DG+IR Y  RE  G+ +          I N  +  + Y    K    + + +T + IF + +    G  + +WQ  +++    P I E +  +    KE+ + +F      K I
Sbjct: 2290 KPRNFLQNNKIRLMISESELSDDFSIDTVGSYGDVKCKGRQKDYLVGVKIDASSFSLTRLVTFLPFYMLVNRTKHVIRVCEEGQEN--WTEARPGQAAVPFWPERDSKK---LRVKVEGSQS-SPRAFDFHQPENCLLLHLDKSLGGIIVDVNLTEHSAVILFSDYHDGAAPFLLINHTKDET-LQYHQSSQAEIDELSPGQAVYYTWAEPTGSRILSWKL----GKYKGELKSE--EDQLLDVDKEGKLFLVSFYEGLQRVALFTSEQRIFKKICDSEKIELAQQEISILLQNMGISLVNNNSSQEVAFIGITSSDVVWETKPKKRSRWKVLSVKEAAVLEQHYRDYMENGPVDSTIIDLDNDYQVLFAANGVDMR---IMQPYDAPLRRNFLPALKVEYSVSARQKTYRVQINRIQIQNQLQGAIFPFVFYPIKPPKSVSMDSEPKPLADVSIITRAAGHSDILRIKYFMVLIQEMDLRLDLGFLYAILELFTAEHTSAVTSEQEVELFDKDIEYLKTELNHVSATDT----SPISLYEYFHISPIKLHLSLSLSSGGEDSNKQERETELIPVQSLHLLLKSIGATLTDAQDVLFKLGFFELRYQFRTTQQLQWEVVRHYSKQAIKQMYVLVLGLDVLGNPFGLIRGLSEGVEAFFYEPYQGAIQGPEEFMEGMALGVKALVGGAVGGLAGAASRITGAMAKGVAAMTMDEEYQQKRREAMNKQPSGLREGLTRGGKGLVSGFVSGITGIVTKPIKGAQKEGAAGFFKGMGKGLVGALTRPTGGIIDMASSTFQGIKRAAELSQDVESLRPPRFIHEDGVIRPYREREGLGSQM-------LQSIENGRFAKYRYFAHAKVNESDFLMITKRGIFFVTKG-TFGQLTCEWQYLFDEFTKAPMIVEGRR-LRIEAKERVKSVFHAKEFGKII 3193          

HSP 3 Score: 58.5362 bits (140), Expect = 2.224e-7
Identity = 40/130 (30.77%), Postives = 66/130 (50.77%), Query Frame = 3
Query: 6777 LHNQLPIKISYQSQIF----SHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFK--AKEGYSESF--MDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEH 7142
            L N LP  I+++ +      S  +K G    + TA +           Y +++W     L  + +E+S I F+  A+E  +ES   +D+ +H+  + GQ  + ++SPYWM+NKT   L YKA DD   +H
Sbjct: 2149 LRNLLPYPITFKLKGIGDSPSVSLKEGHSSQIHTAIMDFSVLDLRLLGYLQQDWESQYSLSSEQDEISFIKFRSLAREEETESRPELDIAMHVKKEEGQVVLAVHSPYWMVNKTSRLLQYKA-DDIHRKH 2277          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Zebrafish
Match: vps13c (vacuolar protein sorting 13 homolog C [Source:ZFIN;Acc:ZDB-GENE-070426-4])

HSP 1 Score: 586.26 bits (1510), Expect = 2.093e-167
Identity = 442/1481 (29.84%), Postives = 733/1481 (49.49%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEEN-KLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDK-KLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYT------DIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETA----SLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDAL--FVINTFELQVLQDIKNTLVE--KNGAKE--IVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSI-MGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTS----VVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKIL 4397
            MVFESLV +L+N+++GDYV  LDKSQLK+G+ GG      L +  N   + D+P KV+ G I KLTLKIPWK+LY+E V+A LDGLY+L++P + +KYD  KE  YL E KQKEL RIEE  +L     K + E KD+F EKLA Q++KNLQ+ I++IHIRYED  + P +  A+G+TL+ LS QT D +  + I+ E + +  +K  +++    YWN N   F  ++   +   +K  IS+   +L    ++ +PI  SA M ++   E      P+ +L L+++ I     ++QY  +   L+S+D       +RK+RP+VP+  N   WW +  + ILE  VRR  +MW+W  I+ HR   + Y   ++ KL    K+ +     I+  E+ LD+ NI L RQQ +M+V +      AKK   +          F G       E      S         + S  T EEK+KLY AIGYS  + +  +P  YV++ +N +L        +      +++K+ +  +S  + QR  A AI V   + +  VTG +   G VP+L+++   S   +LL V FE NP D  A+Q + + ++P+EIIYD+ TV  I +F    + + L  I++  L+ +EE+KE T   L H   R I        D+++D+KPSY +LP+ G Y    ++++VD G + + S      G       F      + + + + AY+++ + L ++Q L    G+ W+    +  S  HIL+P  F   L KC++  DA +P+  V G LP L + ISD+ +Q VLEL+  IP P                     Q G +P  + T  +VL     +P S T     +L  T+     E E  +D  E                      +D ++L   +    E+Q   ++K  L E  +  A+E  ++   V ++G    ++ FD++V +Y+  + L   +  D   +    +  + KH  G +LL +  +  +   P F T+  NT   L+ +F S++  LH +ALL  +N++NS IP   +   ++ ET    ++    K  +   ++  + + K      S  + +  DR ++A     +R++           G D+          M Q   T    +LR IV       +LD+                            DP    ++KK + I  +E +FS ++ L+   T   GY  D S+VD  V + +G I+I++L+ F++ +  F+++FQ + + ++    + +E AA+ + +  ++  S R  +DI +KAP+I IP++S S NA +VDLG +T  N F++  +       VLE   I L+ L++SR++L  +    +  IL PIN+ + + RNL+    + IP + +   + S+++ + Q D  +   +L  N  E  ++  +V  +K   K   ++
Sbjct:    1 MVFESLVSDLLNRFIGDYVENLDKSQLKIGIWGGKRIFVKLPV--NISSELDVPFKVKAGQIGKLTLKIPWKNLYNEAVVATLDGLYLLVVPGATIKYDAVKEERYLQEAKQKELQRIEETLQLVARREKPQEEKKDTFAEKLATQVIKNLQVKITSIHIRYEDDVSDPQKPLAMGLTLSELSLQTADENWKTCILNE-AAKIIYKLGRLECFCAYWNVNGPIFYKDSWEGIVEKLKAGISTKNEELQGYQYIFKPIFASARMCINPNAEV-ELKSPKANLHLEVQNIAIEMTKSQYLSMVDLLESIDCMVKNGPYRKFRPDVPVHRNARQWWKYGISSILEVHVRRFNQMWNWTNIKKHRQTLKAYKAAYKVKLTQSAKVREDADKQIQELEKGLDVFNIVLARQQVQMEVVRSGQKLVAKKAATQKQSGGGFFSSFFGKKEGKKEEEDKEPES---------IDSIMTVEEKSKLYTAIGYSGSSHNLALPKHYVAVIVNFKLLSTSVTFREEP-GVPEILKVQMIDLSTSISQRPGAQAIRVEAKLEHWYVTGLQ-QQGEVPSLIASLGDSD-SSLLSVRFEINPEDSPADQLLRVHSQPVEIIYDALTVISITEFFKTGKGVDLEVITSATLSKLEEIKEKTTVLLSHHPHRHILILRKSVLDLRIDLKPSYLLLPKSGFYDGKSELMIVDFGYLQLNS--VDQGGHQQVSASFS-----SLEEIMDRAYERYSLELRSVQILYSRSGEKWKSACHEGLSHQHILQPMDFTLQLAKCMVDKDARMPRFKVSGELPLLHLKISDQKIQGVLELVDSIPLP---------------------QTGSSPPSSPTGKKVLG----MPLSNTRPKVLALDPTVLSYAVESESDEDTSE--------------------KSVDEESLRSTLEELTEVQFQFEVKAVLFELTRQAAQEDVVLAFSVSQLGAEGRIRTFDLSVTSYLKKISLDYCEEKDVQNQPLHLITSSDKH--GSDLLKVEYIKADVNGPSFCTLFNNTEQTLKVEFSSLDFLLHTKALLSTINYMNSAIP-QELTANKERETRRRADRAAAGKTVSKGSKDAGVVNFKLSAVLGSFRVAVCDDRSNIA----DIRVQ-----------GIDAS--------VMVQAKETDVFARLRDIV-------VLDV----------------------------DPK--TIHKKAVSIVGEE-VFSFKMTLYPGATEGDGYT-DTSKVDGKVIMRLGCIQIVYLHKFLMSLLMFVDNFQTAKEALSAATAQAAEKAASSVRDFAQK--SFRLAMDIRLKAPLIIIPQSSTSHNAFVVDLGLITVGNRFSLLAAEGFPLPAVLETMDIKLTQLKLSRTVLKHDADHLDIEILEPINLELLVKRNLAAAWYNKIPGVEVNGVLMSMNMSLGQEDLGVLMRILAENIGEG-SKAAAVEGTKASAKDEAVI 1345          

HSP 2 Score: 524.242 bits (1349), Expect = 1.599e-148
Identity = 351/894 (39.26%), Postives = 535/894 (59.84%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG----WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSN--NLTSDGIEDF-YINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSK--KLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEA---MFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFH-VYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPP 9986
            K   F+K  K  L ++ S WS+ FSLDTVGS G V C  K   Y VGV I +SS  LT+IVT  P+Y ++N+S   L   E+  N G    W  +   E +PFWP S   K  +     E      ++ F F +  S  +    ++ G+ V+V I++ + +I+   Y +G A   ++NH      ++F+Q    +   L   +   +AW D    R+  W  +     HS   +L  D    F Y + ++ +WVSF+    R+L+FT D+ +   AR + +LE   QE+ +SL ++GLSL++N ++QE+AY+ ITSSGV W ++R KNR K         LE A+   +N+       +E       G+EV+  +   LM +P  C++ R F PG+ ++ + SPHQ  +  ++Y +Q+DNQ+    FP VF P P P+S+  D+  KP I++S +   +  +  M++KYF  L+QEM + +DQGF+ +IL   + +  + D +    +  KD   ++A L+E+S   T  SG     F++FHISPIK+HLS SL       +    +  + +NL L+S+G  +TD+ D+IFKL YFE +      ++++ ++  HY  Q L QMYVLVLGLDVLGNPFG+IRG+++GVE  FYEP++GAV GPEEF EG+  GV+SL GH VGGAAG VSRI G++GKG+AA+T+D +YQ+KRRE++ +  ++ G  LA+GGKG + G V GVTG+VTKP++GAKK+G  GFFKG+GKGLVGVV RP  G+VD ASS+F+GI+RVA++  EV ++RP R I +DGIIR Y    +EG +++ +   +   +  E++  H +Y   +K  I +TN+R+  +   +++G ++ +W+  +E    PP
Sbjct: 2752 KKNIFSKN-KLQLCVSTSSWSEGFSLDTVGSYGCVRCPDKSGDYLVGVSIQMSSFNLTRIVTMSPFYTLVNKSLFELEVGEVQNNNGSSNKWHYISSTECLPFWPESSTEKLCVRVVGCESS----SKSFFFNKQDSGTLLRMDQYGGVIVDVNISDHSTVISFTDYYDGAAPALVVNHT-PSATVNFRQRGCEECWALRPGEAQRFAWDDPAGVRKLCWSCQ----DHSGELDLVKDECGQFAYSSLVQIHWVSFLDGRQRVLIFTEDVGIVTKARQAEELEQFQQEVNVSLQNLGLSLINNDIRQEIAYVGITSSGVVW-EMRPKNRWKSFNHKNIGLLEKAYQNHINKSDPGWTMLET------GIEVNFGRVPMLMRQPFSCQIRRNFLPGIHVELKQSPHQRSLRAQLYWLQVDNQLPGAIFPTVFHPVPLPKSIVQDSEPKPFIDVSIITRFNEHSQVMQFKYFMALVQEMAVKIDQGFLGAILALFTPATDSLDSKKKNKLIQKDLDALQAQLMESSLTDT--SG--LSFFEHFHISPIKLHLSLSLGSSGDESEQGDMVAIQSVNLLLKSIGATLTDVDDLIFKLAYFEVKYQFYRRDKLMWAVIRHYTEQFLTQMYVLVLGLDVLGNPFGLIRGLSEGVEAFFYEPIQGAVQGPEEFAEGLVIGVRSLLGHTVGGAAGMVSRITGSVGKGLAAITMDKEYQQKRREEMNRPTKDFGESLAKGGKGFLKGVVGGVTGIVTKPVEGAKKEGAAGFFKGIGKGLVGVVARPTGGIVDMASSTFQGIQRVAESTEEVTKLRPVRLIHEDGIIRPYDHHASEGYDLFQR--SEIKQLDGEIFREHYMYPGHRKTNIMITNRRVMCVKEIDVIGHFNKEWECQFESFQRPP 3622          

HSP 3 Score: 313.153 bits (801), Expect = 1.937e-84
Identity = 345/1498 (23.03%), Postives = 670/1498 (44.73%), Query Frame = 3
Query: 2823 KNGAKE-IVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESI-----------------TVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINE--LIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXX--XXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKE--SDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIY-LRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDF--EDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVY-LKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVS---EREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSD--------KSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLC---KSNTGVMYYYSVALSIEEVQIVNSSETL--RTYKLDINVPLALHNQLPIKISY--QSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAV 7166
            KNG +   + L V ++G    ++++DM    YI ++ +   +F D S   P+C+  +   + G +LL +     ++  P+F +++ NT  K+   F S+++ LH EALL  ++F+++ +          T +  SP           E+E++  ED+K                       T   K+ A+S  SD +  D                +   L    V+V ++K +N+ DI I G+   ++     T +   + D  + +     ++KK I I  DE +FS  ++L  + T   GY  D S+VD  V + VG I++++L+ F + +  F N+FQE+ + ++    + +E AA+ + +  ++  S R  +DI +KAP+I IP++S S NA+  DLG +T  N F++     +    V++   I L+ L++SR  +  ++ +    +L P+N+ + + RNL+ +    +  I +   +  + V +SQ D ++   +L  N  EA            +++S   L +++    ARTA+   I                 +V+F F +E L + L+  D +      E     CL +     + + G M  N  MEVS  L+    LD +    +++    L R  +  S   I + + Q  +  S + V +  +Y+C  V++L+ + DFFV+A P     Q  K   +P++ Y   P K   +P A P +      ++   V  PE++ V +++  D+ A++   +F   +S++ E     +  ++   + + CPF      K    ++ P S+ L    P N  + GS+T+E +I+ I+P ++ ++  I   +  +  +E S +      + DQ   ++ W         + F+               GV++  +V +   DV+  +  + + L +  ++V LES +  + VP+L+ E S     +N  + + +   +++ V+YFN+   VWEPLLE   +   R+++ +++     ++ + D+     +D I +     +I + S+D + +TVSK  L+V +NL KAF ++ +   + H     +P+ ++N  G  V   +    +L+   S    KV+ L  D  + L  +  E+ S  +  ++ +   F          LSI  +    +   P    G    NV    + E  ++++   A  G K + +RS LQ+ N+    +    L+  S+         +E  K   +  E    + + +P+  L     K+Y          S +   W    +       +L C   +SN   +   ++A+  +   I N  E      Y + ++ P+ + N LP  I Y  +     ++++ G    V  + +  +    +   YQ + W G + +   M E   I F    G + + +D+ VH++  +G+  ++++SPYW++NKT   L Y+A +D  V+H +   D +
Sbjct: 1392 KNGDESPFLVLDVSQLGIDTKVRKYDMEATTYIKTISMKCLEFPD-SNGEPLCIISSSAES-GADLLEVKYFKADRNGPNFASLYQNTEQKMNVVFSSLDLMLHTEALLSTMDFLSAAL---------STSSLPSP-----------ERESKKSEDMK-----------------------TTSAKSTALSSPSDGDIID--------------LMVNMQLGAFNVLVCDQK-SNMADIKIQGLDGSLQMKGTQTHMFTRLRDFIVINVDSKTIHKKAISIVGDE-VFSFSMSLTPKATEGAGYT-DTSKVDGKVKLNVGCIQVVYLHKFFMSLLNFSNNFQEAKEALSAATAQAAEKAASSVRDFAQK--SFRLAMDIKLKAPLIIIPQSSTSHNAVEADLGLITVGNRFSLLPVEGRPLPAVIDNMDIQLTQLKLSRISMELDSDQTSSKLLEPVNLVLSVKRNLASSWYQKMAAIEVDGDLKPMKVALSQDDLSVLLRILMENIGEA-----------SDIQSDTALRQENVLVRARTATGSEILEEKLSESKLKETELLESVRFSFNVESLGLTLYNNDPSQPCVHEE---KSCLGEFMLCKMKMSGKMLNNGNMEVSTILTTCT-LDDRRSGIQRVTSRMLGRRDEETSEPMIDVTYSQSVDERSVVAV-LQKLYLCASVEFLLAVADFFVQALPTSPPTQREKTNQLPLK-YVSEP-KIHTEPKAVPAQRT----KLRAVVVDPEVVFVANLMKADAPALV--ASFQCDFSLLSEEAGQTMKANVRSLKVLACPFIRAEGDKAVTTVLRPCSVELETKMPANAPLAGSMTVEEVIVKISPIILNTVITITAAMAPKPKEELSQQ-----KSGDQ---NSLWSLMSVANANYWFL---------------GVDTASEVTESFTDVDSSKDGETFGLTVKVVQVTLESGLGHRTVPLLLAESSFSVTAQNWSSLLSVSADMTLEVNYFNETHAVWEPLLERV-DNGKRRWNLKLDM---KNNPVRDKSPVPGDDFIMLPDPRTAITICSKDTMNITVSKCCLNVFNNLAKAFSESTASTFD-HSLKEKSPFTIRNALG--VALIVQHSANLRVPGSSTLGKVHELAVDKSLDLEYSSFERSSRQSALQRQESCLFN---------LSIVPSGYSEISNIPLGKPGRRLYNVRQPMQEESVSVLLQIDASEGNKVITVRSPLQIKNHFS--VPFAILKYSSELGGMVNVGVAEPEKECHVPLEAYRSQLFLLPVGPL----EKLY--------RASTTCIAWKEKVHVSSEVHAVLQCPATESNFLPLVVNTLAMPDDLSHIANHGEVEWDPAYLIHLHPPVTVKNLLPYSIRYLLEGSADIYELQEGSAADVLNSNVSGEIMELILIKYQGRNWTGRMRISRDMPEFITICFNCDTGEALT-VDVCVHVSRVSGKFILSVHSPYWIINKTSRVLQYRA-EDTFVKHPSDFRDVI 2746          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Zebrafish
Match: vps13c (vacuolar protein sorting 13 homolog C [Source:ZFIN;Acc:ZDB-GENE-070426-4])

HSP 1 Score: 567.77 bits (1462), Expect = 8.066e-162
Identity = 445/1522 (29.24%), Postives = 736/1522 (48.36%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNS-----------EMKYDPEKERSYLFETKQKELNRIEE--------------------NKLKRNDP-----------KKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDK-KLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYT------DIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETA----SLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDAL--FVINTFELQVLQDIKNTLVE--KNGAKEIVKLI--VHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSI-MGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTS----VVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKIL 4397
            MVFESLV +L+N+++GDYV  LDKSQLK+G+ GG      L +  N   + D+P KV+ G I KLTLKIPWK+LY+E V+A LDGLY+L++P +            +KYD  KE  YL E KQKEL RIEE                    + + +N P           K + E KD+F EKLA Q++KNLQ+ I++IHIRYED  + P +  A+G+TL+ LS QT D +  + I+ E + +  +K  +++    YWN N   F  ++   +   +K  IS+   +L    ++ +PI  SA M ++   E      P+ +L L+++ I     ++QY  +   L+S+D       +RK+RP+VP+  N   WW +  + ILE  VRR  +MW+W  I+ HR   + Y   ++ KL    K+ +     I+  E+ LD+ NI L RQQ +M+V +      AKK   +          F G       E      S         + S  T EEK+KLY AIGYS  + +  +P  YV++ +N +L        +      +++K+ +  +S  + QR  A AI V   + +  VTG +   G VP+L+++   S   +LL V FE NP D  A+Q + + ++P+EIIYD+ TV  I +F    + + L  I++  L+ +EE+KE T   L H   R I        D+++D+KPSY +LP+ G Y    ++++VD G + + S      G       F      + + + + AY+++ + L ++Q L    G+ W+    +  S  HIL+P  F   L KC++  DA +P+  V G LP L + ISD+ +Q VLEL+  IP P                     Q G +P  + T  +VL     +P S T     +L  T+     E E  +D  E                      +D ++L   +    E+Q   ++K  L E  +  A+E V L   V ++G    ++ FD++V +Y+  + L   +  D   +    +  + KH  G +LL +  +  +   P F T+  NT   L+ +F S++  LH +ALL  +N++NS IP   +   ++ ET    ++    K  +   ++  + + K      S  + +  DR ++A     +R++           G D+          M Q   T    +LR IV       +LD+                            DP    ++KK + I  +E +FS ++ L+   T   GY  D S+VD  V + +G I+I++L+ F++ +  F+++FQ + + ++    + +E AA+ + +  ++  S R  +DI +KAP+I IP++S S NA +VDLG +T  N F++  +       VLE   I L+ L++SR++L  +    +  IL PIN+ + + RNL+    + IP + +   + S+++ + Q D  +   +L  N  E  ++  +V  +K   K   ++
Sbjct:    1 MVFESLVSDLLNRFIGDYVENLDKSQLKIGIWGGKRIFVKLPV--NISSELDVPFKVKAGQIGKLTLKIPWKNLYNEAVVATLDGLYLLVVPGAIESKLFSSSYNAIKYDAVKEERYLQEAKQKELQRIEETLQLVARRDSQAGEFVFNLESYVYKNPPRGMYRPIAIEEKPQEEKKDTFAEKLATQVIKNLQVKITSIHIRYEDDVSDPQKPLAMGLTLSELSLQTADENWKTCILNE-AAKIIYKLGRLECFCAYWNVNGPIFYKDSWEGIVEKLKAGISTKNEELQGYQYIFKPIFASARMCINPNAEV-ELKSPKANLHLEVQNIAIEMTKSQYLSMVDLLESIDCMVKNGPYRKFRPDVPVHRNARQWWKYGISSILEVHVRRFNQMWNWTNIKKHRQTLKAYKAAYKVKLTQSAKVREDADKQIQELEKGLDVFNIVLARQQVQMEVVRSGQKLVAKKAATQKQSGGGFFSSFFGKKEGKKEEEDKEPES---------IDSIMTVEEKSKLYTAIGYSGSSHNLALPKHYVAVIVNFKLLSTSVTFREEP-GVPEILKVQMIDLSTSISQRPGAQAIRVEAKLEHWYVTGLQ-QQGEVPSLIASLGDSD-SSLLSVRFEINPEDSPADQLLRVHSQPVEIIYDALTVISITEFFKTGKGVDLEVITSATLSKLEEIKEKTTVLLSHHPHRHILILRKSVLDLRIDLKPSYLLLPKSGFYDGKSELMIVDFGYLQLNS--VDQGGHQQVSASFS-----SLEEIMDRAYERYSLELRSVQILYSRSGEKWKSACHEGLSHQHILQPMDFTLQLAKCMVDKDARMPRFKVSGELPLLHLKISDQKIQGVLELVDSIPLP---------------------QTGSSPPSSPTGKKVLG----MPLSNTRPKVLALDPTVLSYAVESESDEDTSE--------------------KSVDEESLRSTLEELTEVQFQFEVKAVLFELTRQAAQEDVVLAFSVSQLGAEGRIRTFDLSVTSYLKKISLDYCEEKDVQNQPLHLITSSDKH--GSDLLKVEYIKADVNGPSFCTLFNNTEQTLKVEFSSLDFLLHTKALLSTINYMNSAIP-QELTANKERETRRRADRAAAGKTVSKGSKDAGVVNFKLSAVLGSFRVAVCDDRSNIA----DIRVQ-----------GIDAS--------VMVQAKETDVFARLRDIV-------VLDV----------------------------DPK--TIHKKAVSIVGEE-VFSFKMTLYPGATEGDGYT-DTSKVDGKVIMRLGCIQIVYLHKFLMSLLMFVDNFQTAKEALSAATAQAAEKAASSVRDFAQK--SFRLAMDIRLKAPLIIIPQSSTSHNAFVVDLGLITVGNRFSLLAAEGFPLPAVLETMDIKLTQLKLSRTVLKHDADHLDIEILEPINLELLVKRNLAAAWYNKIPGVEVNGVLMSMNMSLGQEDLGVLMRILAENIGEG-SKAAAVEGTKASAKDEAVI 1386          

HSP 2 Score: 504.212 bits (1297), Expect = 2.032e-142
Identity = 338/831 (40.67%), Postives = 503/831 (60.53%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG----WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSN--NLTSDGIEDF-YINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSK--KLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEA---MFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIW 9800
            K   F+K  K  L ++ S WS+ FSLDTVGS G V C  K   Y VGV I +SS  LT+IVT  P+Y ++N+S   L   E+  N G    W  +   E +PFWP S   K  +     E      ++ F F +  S  +    ++ G+ V+V I++ + +I+   Y +G A   ++NH      ++F+Q    +   L   +   +AW D    R+  W  +     HS   +L  D    F Y + ++ +WVSF+    R+L+FT D+ +   AR + +LE   QE+ +SL ++GLSL++N ++QE+AY+ ITSSGV W ++R KNR K         LE A+   +N+       +E       G+EV+  +   LM +P  C++ R F PG+ ++ + SPHQ  +  ++Y +Q+DNQ+    FP VF P P P+S+  D+  KP I++S +   +  +  M++KYF  L+QEM + +DQGF+ +IL   + +  + D +    +  KD   ++A L+E+S   T  SG     F++FHISPIK+HLS SL       +    +  + +NL L+S+G  +TD+ D+IFKL YFE +      ++++ ++  HY  Q L QMYVLVLGLDVLGNPFG+IRG+++GVE  FYEP++GAV GPEEF EG+  GV+SL GH VGGAAG VSRI G++GKG+AA+T+D +YQ+KRRE++ +  ++ G  LA+GGKG + G V GVTG+VTKP++GAKK+G  GFFKG+GKGLVGVV RP  G+VD ASS+F+GI+RVA++  EV ++RP R I +DGIIR Y    +EG +++
Sbjct: 2793 KKNIFSKN-KLQLCVSTSSWSEGFSLDTVGSYGCVRCPDKSGDYLVGVSIQMSSFNLTRIVTMSPFYTLVNKSLFELEVGEVQNNNGSSNKWHYISSTECLPFWPESSTEKLCVRVVGCESS----SKSFFFNKQDSGTLLRMDQYGGVIVDVNISDHSTVISFTDYYDGAAPALVVNHT-PSATVNFRQRGCEECWALRPGEAQRFAWDDPAGVRKLCWSCQ----DHSGELDLVKDECGQFAYSSLVQIHWVSFLDGRQRVLIFTEDVGIVTKARQAEELEQFQQEVNVSLQNLGLSLINNDIRQEIAYVGITSSGVVW-EMRPKNRWKSFNHKNIGLLEKAYQNHINKSDPGWTMLET------GIEVNFGRVPMLMRQPFSCQIRRNFLPGIHVELKQSPHQRSLRAQLYWLQVDNQLPGAIFPTVFHPVPLPKSIVQDSEPKPFIDVSIITRFNEHSQVMQFKYFMALVQEMAVKIDQGFLGAILALFTPATDSLDSKKKNKLIQKDLDALQAQLMESSLTDT--SG--LSFFEHFHISPIKLHLSLSLGSSGDESEQGDMVAIQSVNLLLKSIGATLTDVDDLIFKLAYFEVKYQFYRRDKLMWAVIRHYTEQFLTQMYVLVLGLDVLGNPFGLIRGLSEGVEAFFYEPIQGAVQGPEEFAEGLVIGVRSLLGHTVGGAAGMVSRITGSVGKGLAAITMDKEYQQKRREEMNRPTKDFGESLAKGGKGFLKGVVGGVTGIVTKPVEGAKKEGAAGFFKGIGKGLVGVVARPTGGIVDMASSTFQGIQRVAESTEEVTKLRPVRLIHEDGIIRPYDHHASEGYDLF 3602          

HSP 3 Score: 312.768 bits (800), Expect = 2.432e-84
Identity = 345/1498 (23.03%), Postives = 670/1498 (44.73%), Query Frame = 3
Query: 2823 KNGAKE-IVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESI-----------------TVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINE--LIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXX--XXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKE--SDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIY-LRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDF--EDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVY-LKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVS---EREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSD--------KSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLC---KSNTGVMYYYSVALSIEEVQIVNSSETL--RTYKLDINVPLALHNQLPIKISY--QSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAV 7166
            KNG +   + L V ++G    ++++DM    YI ++ +   +F D S   P+C+  +   + G +LL +     ++  P+F +++ NT  K+   F S+++ LH EALL  ++F+++ +          T +  SP           E+E++  ED+K                       T   K+ A+S  SD +  D                +   L    V+V ++K +N+ DI I G+   ++     T +   + D  + +     ++KK I I  DE +FS  ++L  + T   GY  D S+VD  V + VG I++++L+ F + +  F N+FQE+ + ++    + +E AA+ + +  ++  S R  +DI +KAP+I IP++S S NA+  DLG +T  N F++     +    V++   I L+ L++SR  +  ++ +    +L P+N+ + + RNL+ +    +  I +   +  + V +SQ D ++   +L  N  EA            +++S   L +++    ARTA+   I                 +V+F F +E L + L+  D +      E     CL +     + + G M  N  MEVS  L+    LD +    +++    L R  +  S   I + + Q  +  S + V +  +Y+C  V++L+ + DFFV+A P     Q  K   +P++ Y   P K   +P A P +      ++   V  PE++ V +++  D+ A++   +F   +S++ E     +  ++   + + CPF      K    ++ P S+ L    P N  + GS+T+E +I+ I+P ++ ++  I   +  +  +E S +      + DQ   ++ W         + F+               GV++  +V +   DV+  +  + + L +  ++V LES +  + VP+L+ E S     +N  + + +   +++ V+YFN+   VWEPLLE   +   R+++ +++     ++ + D+     +D I +     +I + S+D + +TVSK  L+V +NL KAF ++ +   + H     +P+ ++N  G  V   +    +L+   S    KV+ L  D  + L  +  E+ S  +  ++ +   F          LSI  +    +   P    G    NV    + E  ++++   A  G K + +RS LQ+ N+    +    L+  S+         +E  K   +  E    + + +P+  L     K+Y          S +   W    +       +L C   +SN   +   ++A+  +   I N  E      Y + ++ P+ + N LP  I Y  +     ++++ G    V  + +  +    +   YQ + W G + +   M E   I F    G + + +D+ VH++  +G+  ++++SPYW++NKT   L Y+A +D  V+H +   D +
Sbjct: 1433 KNGDESPFLVLDVSQLGIDTKVRKYDMEATTYIKTISMKCLEFPD-SNGEPLCIISSSAES-GADLLEVKYFKADRNGPNFASLYQNTEQKMNVVFSSLDLMLHTEALLSTMDFLSAAL---------STSSLPSP-----------ERESKKSEDMK-----------------------TTSAKSTALSSPSDGDIID--------------LMVNMQLGAFNVLVCDQK-SNMADIKIQGLDGSLQMKGTQTHMFTRLRDFIVINVDSKTIHKKAISIVGDE-VFSFSMSLTPKATEGAGYT-DTSKVDGKVKLNVGCIQVVYLHKFFMSLLNFSNNFQEAKEALSAATAQAAEKAASSVRDFAQK--SFRLAMDIKLKAPLIIIPQSSTSHNAVEADLGLITVGNRFSLLPVEGRPLPAVIDNMDIQLTQLKLSRISMELDSDQTSSKLLEPVNLVLSVKRNLASSWYQKMAAIEVDGDLKPMKVALSQDDLSVLLRILMENIGEA-----------SDIQSDTALRQENVLVRARTATGSEILEEKLSESKLKETELLESVRFSFNVESLGLTLYNNDPSQPCVHEE---KSCLGEFMLCKMKMSGKMLNNGNMEVSTILTTCT-LDDRRSGIQRVTSRMLGRRDEETSEPMIDVTYSQSVDERSVVAV-LQKLYLCASVEFLLAVADFFVQALPTSPPTQREKTNQLPLK-YVSEP-KIHTEPKAVPAQRT----KLRAVVVDPEVVFVANLMKADAPALV--ASFQCDFSLLSEEAGQTMKANVRSLKVLACPFIRAEGDKAVTTVLRPCSVELETKMPANAPLAGSMTVEEVIVKISPIILNTVITITAAMAPKPKEELSQQ-----KSGDQ---NSLWSLMSVANANYWFL---------------GVDTASEVTESFTDVDSSKDGETFGLTVKVVQVTLESGLGHRTVPLLLAESSFSVTAQNWSSLLSVSADMTLEVNYFNETHAVWEPLLERV-DNGKRRWNLKLDM---KNNPVRDKSPVPGDDFIMLPDPRTAITICSKDTMNITVSKCCLNVFNNLAKAFSESTASTFD-HSLKEKSPFTIRNALG--VALIVQHSANLRVPGSSTLGKVHELAVDKSLDLEYSSFERSSRQSALQRQESCLFN---------LSIVPSGYSEISNIPLGKPGRRLYNVRQPMQEESVSVLLQIDASEGNKVITVRSPLQIKNHFS--VPFAILKYSSELGGMVNVGVAEPEKECHVPLEAYRSQLFLLPVGPL----EKLY--------RASTTCIAWKEKVHVSSEVHAVLQCPATESNFLPLVVNTLAMPDDLSHIANHGEVEWDPAYLIHLHPPVTVKNLLPYSIRYLLEGSADIYELQEGSAADVLNSNVSGEIMELILIKYQGRNWTGRMRISRDMPEFITICFNCDTGEALT-VDVCVHVSRVSGKFILSVHSPYWIINKTSRVLQYRA-EDTFVKHPSDFRDVI 2787          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Zebrafish
Match: vps13c (vacuolar protein sorting 13 homolog C [Source:ZFIN;Acc:ZDB-GENE-070426-4])

HSP 1 Score: 524.628 bits (1350), Expect = 1.359e-148
Identity = 351/894 (39.26%), Postives = 535/894 (59.84%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG----WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSN--NLTSDGIEDF-YINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSK--KLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEA---MFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFH-VYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPP 9986
            K   F+K  K  L ++ S WS+ FSLDTVGS G V C  K   Y VGV I +SS  LT+IVT  P+Y ++N+S   L   E+  N G    W  +   E +PFWP S   K  +     E      ++ F F +  S  +    ++ G+ V+V I++ + +I+   Y +G A   ++NH      ++F+Q    +   L   +   +AW D    R+  W  +     HS   +L  D    F Y + ++ +WVSF+    R+L+FT D+ +   AR + +LE   QE+ +SL ++GLSL++N ++QE+AY+ ITSSGV W ++R KNR K         LE A+   +N+       +E       G+EV+  +   LM +P  C++ R F PG+ ++ + SPHQ  +  ++Y +Q+DNQ+    FP VF P P P+S+  D+  KP I++S +   +  +  M++KYF  L+QEM + +DQGF+ +IL   + +  + D +    +  KD   ++A L+E+S   T  SG     F++FHISPIK+HLS SL       +    +  + +NL L+S+G  +TD+ D+IFKL YFE +      ++++ ++  HY  Q L QMYVLVLGLDVLGNPFG+IRG+++GVE  FYEP++GAV GPEEF EG+  GV+SL GH VGGAAG VSRI G++GKG+AA+T+D +YQ+KRRE++ +  ++ G  LA+GGKG + G V GVTG+VTKP++GAKK+G  GFFKG+GKGLVGVV RP  G+VD ASS+F+GI+RVA++  EV ++RP R I +DGIIR Y    +EG +++ +   +   +  E++  H +Y   +K  I +TN+R+  +   +++G ++ +W+  +E    PP
Sbjct: 2748 KKNIFSKN-KLQLCVSTSSWSEGFSLDTVGSYGCVRCPDKSGDYLVGVSIQMSSFNLTRIVTMSPFYTLVNKSLFELEVGEVQNNNGSSNKWHYISSTECLPFWPESSTEKLCVRVVGCESS----SKSFFFNKQDSGTLLRMDQYGGVIVDVNISDHSTVISFTDYYDGAAPALVVNHT-PSATVNFRQRGCEECWALRPGEAQRFAWDDPAGVRKLCWSCQ----DHSGELDLVKDECGQFAYSSLVQIHWVSFLDGRQRVLIFTEDVGIVTKARQAEELEQFQQEVNVSLQNLGLSLINNDIRQEIAYVGITSSGVVW-EMRPKNRWKSFNHKNIGLLEKAYQNHINKSDPGWTMLET------GIEVNFGRVPMLMRQPFSCQIRRNFLPGIHVELKQSPHQRSLRAQLYWLQVDNQLPGAIFPTVFHPVPLPKSIVQDSEPKPFIDVSIITRFNEHSQVMQFKYFMALVQEMAVKIDQGFLGAILALFTPATDSLDSKKKNKLIQKDLDALQAQLMESSLTDT--SG--LSFFEHFHISPIKLHLSLSLGSSGDESEQGDMVAIQSVNLLLKSIGATLTDVDDLIFKLAYFEVKYQFYRRDKLMWAVIRHYTEQFLTQMYVLVLGLDVLGNPFGLIRGLSEGVEAFFYEPIQGAVQGPEEFAEGLVIGVRSLLGHTVGGAAGMVSRITGSVGKGLAAITMDKEYQQKRREEMNRPTKDFGESLAKGGKGFLKGVVGGVTGIVTKPVEGAKKEGAAGFFKGIGKGLVGVVARPTGGIVDMASSTFQGIQRVAESTEEVTKLRPVRLIHEDGIIRPYDHHASEGYDLFQR--SEIKQLDGEIFREHYMYPGHRKTNIMITNRRVMCVKEIDVIGHFNKEWECQFESFQRPP 3618          

HSP 2 Score: 503.442 bits (1295), Expect = 3.962e-142
Identity = 296/811 (36.50%), Postives = 456/811 (56.23%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEEN-KLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDK-KLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELI 2450
            MVFESLV +L+N+++GDYV  LDKSQLK+G+ GGN  LENL +KENA  + D+P KV+ G I KLTLKIPWK+LY+E V+A LDGLY+L++P + +KYD  KE  YL E KQKEL RIEE  +L     K + E KD+F EKLA Q++KNLQ+ I++IHIRYED  + P +  A+G+TL+ LS QT D +  + I+ E + +  +K  +++    YWN N   F  ++   +   +K  IS+   +L    ++ +PI  SA M ++   E      P+ +L L+++ I     ++QY  +   L+S+D       +RK+RP+VP+  N   WW +  + ILE  VRR  +MW+W  I+ HR   + Y   ++ KL    K+ +  +  I+  E+ LD+ NI L RQQ +M+V +      AKK   +          F G       E      S         + S  T EEK+KLY AIGYS  + +  +P  YV++ +N +L        +      +++K+ +  +S  + QR  A AI V   + +  VTG +   G VP+L+++   S   +LL V FE NP D  A+Q + + ++P+EIIYD+ TV  I +F    + + L  I++  L+ +EE+KE TATGL H+ + R   D+++D+KPSY +LP+ G Y    ++++VD G + + S      G       F      + + + + AY+++ + L ++Q L    G+ W+    +  S  HIL+P  F   L KC++  DA +P+  V G LP L + ISD+ +Q VLEL+
Sbjct:    1 MVFESLVSDLLNRFIGDYVENLDKSQLKIGIWGGNVVLENLKVKENALSELDVPFKVKAGQIGKLTLKIPWKNLYNEAVVATLDGLYLLVVPGATIKYDAVKEERYLQEAKQKELQRIEETLQLVARREKPQEEKKDTFAEKLATQVIKNLQVKITSIHIRYEDDVSDPQKPLAMGLTLSELSLQTADENWKTCILNE-AAKIIYKLGRLECFCAYWNVNGPIFYKDSWEGIVEKLKAGISTKNEELQGYQYIFKPIFASARMCINPNAE-VELKSPKANLHLEVQNIAIEMTKSQYLSMVDLLESIDCMVKNGPYRKFRPDVPVHRNARQWWKYGISSILEVHVRRFNQMWNWTNIKKHRQTLKSYKAAYKVKLTQSAKVREDTEKQIQELEKGLDVFNIVLARQQVQMEVVRSGQKLVAKKAATQKQSGGGFFSSFFGKKEGKKEEEDKEPES---------IDSIMTVEEKSKLYTAIGYSGSSHNLALPKHYVAVIVNFKLLSTSVTFREEP-GVPEILKVQMIDLSTSISQRPGAQAIRVEAKLEHWYVTGLQ-QQGEVPSLIASLGDSN-SSLLSVRFEINPEDSPADQLLRVHSQPVEIIYDALTVISITEFFKTGKGVDLEVITSATLSKLEEIKEKTATGLSHIIETRKVLDLRIDLKPSYLLLPKSGFYDGKSELMIVDFGYLQLNS--VDQGGHQQVSASFS-----SLEEIMDRAYERYSLELRSVQILYSRSGEKWKSACHEGLSHQHILQPMDFTLQLAKCMVDKDARMPRFKVSGELPLLHLKISDQKIQGVLELV 790          

HSP 3 Score: 312.768 bits (800), Expect = 2.512e-84
Identity = 345/1498 (23.03%), Postives = 670/1498 (44.73%), Query Frame = 3
Query: 2823 KNGAKE-IVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESI-----------------TVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINE--LIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXX--XXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKE--SDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIY-LRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDF--EDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVY-LKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVS---EREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSD--------KSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLC---KSNTGVMYYYSVALSIEEVQIVNSSETL--RTYKLDINVPLALHNQLPIKISY--QSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAV 7166
            KNG +   + L V ++G    ++++DM    YI ++ +   +F D S   P+C+  +   + G +LL +     ++  P+F +++ NT  K+   F S+++ LH EALL  ++F+++ +          T +  SP           E+E++  ED+K                       T   K+ A+S  SD +  D                +   L    V+V ++K +N+ DI I G+   ++     T +   + D  + +     ++KK I I  DE +FS  ++L  + T   GY  D S+VD  V + VG I++++L+ F + +  F N+FQE+ + ++    + +E AA+ + +  ++  S R  +DI +KAP+I IP++S S NA+  DLG +T  N F++     +    V++   I L+ L++SR  +  ++ +    +L P+N+ + + RNL+ +    +  I +   +  + V +SQ D ++   +L  N  EA            +++S   L +++    ARTA+   I                 +V+F F +E L + L+  D +      E     CL +     + + G M  N  MEVS  L+    LD +    +++    L R  +  S   I + + Q  +  S + V +  +Y+C  V++L+ + DFFV+A P     Q  K   +P++ Y   P K   +P A P +      ++   V  PE++ V +++  D+ A++   +F   +S++ E     +  ++   + + CPF      K    ++ P S+ L    P N  + GS+T+E +I+ I+P ++ ++  I   +  +  +E S +      + DQ   ++ W         + F+               GV++  +V +   DV+  +  + + L +  ++V LES +  + VP+L+ E S     +N  + + +   +++ V+YFN+   VWEPLLE   +   R+++ +++     ++ + D+     +D I +     +I + S+D + +TVSK  L+V +NL KAF ++ +   + H     +P+ ++N  G  V   +    +L+   S    KV+ L  D  + L  +  E+ S  +  ++ +   F          LSI  +    +   P    G    NV    + E  ++++   A  G K + +RS LQ+ N+    +    L+  S+         +E  K   +  E    + + +P+  L     K+Y          S +   W    +       +L C   +SN   +   ++A+  +   I N  E      Y + ++ P+ + N LP  I Y  +     ++++ G    V  + +  +    +   YQ + W G + +   M E   I F    G + + +D+ VH++  +G+  ++++SPYW++NKT   L Y+A +D  V+H +   D +
Sbjct: 1388 KNGDESPFLVLDVSQLGIDTKVRKYDMEATTYIKTISMKCLEFPD-SNGEPLCIISSSAES-GADLLEVKYFKADRNGPNFASLYQNTEQKMNVVFSSLDLMLHTEALLSTMDFLSAAL---------STSSLPSP-----------ERESKKSEDMK-----------------------TTSAKSTALSSPSDGDIID--------------LMVNMQLGAFNVLVCDQK-SNMADIKIQGLDGSLQMKGTQTHMFTRLRDFIVINVDSKTIHKKAISIVGDE-VFSFSMSLTPKATEGAGYT-DTSKVDGKVKLNVGCIQVVYLHKFFMSLLNFSNNFQEAKEALSAATAQAAEKAASSVRDFAQK--SFRLAMDIKLKAPLIIIPQSSTSHNAVEADLGLITVGNRFSLLPVEGRPLPAVIDNMDIQLTQLKLSRISMELDSDQTSSKLLEPVNLVLSVKRNLASSWYQKMAAIEVDGDLKPMKVALSQDDLSVLLRILMENIGEA-----------SDIQSDTALRQENVLVRARTATGSEILEEKLSESKLKETELLESVRFSFNVESLGLTLYNNDPSQPCVHEE---KSCLGEFMLCKMKMSGKMLNNGNMEVSTILTTCT-LDDRRSGIQRVTSRMLGRRDEETSEPMIDVTYSQSVDERSVVAV-LQKLYLCASVEFLLAVADFFVQALPTSPPTQREKTNQLPLK-YVSEP-KIHTEPKAVPAQRT----KLRAVVVDPEVVFVANLMKADAPALV--ASFQCDFSLLSEEAGQTMKANVRSLKVLACPFIRAEGDKAVTTVLRPCSVELETKMPANAPLAGSMTVEEVIVKISPIILNTVITITAAMAPKPKEELSQQ-----KSGDQ---NSLWSLMSVANANYWFL---------------GVDTASEVTESFTDVDSSKDGETFGLTVKVVQVTLESGLGHRTVPLLLAESSFSVTAQNWSSLLSVSADMTLEVNYFNETHAVWEPLLERV-DNGKRRWNLKLDM---KNNPVRDKSPVPGDDFIMLPDPRTAITICSKDTMNITVSKCCLNVFNNLAKAFSESTASTFD-HSLKEKSPFTIRNALG--VALIVQHSANLRVPGSSTLGKVHELAVDKSLDLEYSSFERSSRQSALQRQESCLFN---------LSIVPSGYSEISNIPLGKPGRRLYNVRQPMQEESVSVLLQIDASEGNKVITVRSPLQIKNHFS--VPFAILKYSSELGGMVNVGVAEPEKECHVPLEAYRSQLFLLPVGPL----EKLY--------RASTTCIAWKEKVHVSSEVHAVLQCPATESNFLPLVVNTLAMPDDLSHIANHGEVEWDPAYLIHLHPPVTVKNLLPYSIRYLLEGSADIYELQEGSAADVLNSNVSGEIMELILIKYQGRNWTGRMRISRDMPEFITICFNCDTGEALT-VDVCVHVSRVSGKFILSVHSPYWIINKTSRVLQYRA-EDTFVKHPSDFRDVI 2742          

HSP 4 Score: 141.354 bits (355), Expect = 1.900e-32
Identity = 135/548 (24.64%), Postives = 258/548 (47.08%), Query Frame = 3
Query: 2781 ELQVLQDIKNTLVE--KNGAKE--IVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSI-MGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTS----VVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKIL 4397
            E+Q   ++K  L E  +  A+E  ++   V ++G    ++ FD++V +Y+  + L   +  D   +    +  + KH  G +LL +  +  +   P F T+  NT   L+ +F S++  LH +ALL  +N++NS IP   +   ++ ET    ++    K  +   ++  + + K      S  + +  DR ++A     +R++           G D+          M Q   T    +LR IV       +LD+                            DP    ++KK + I  +E +FS ++ L+   T   GY  D S+VD  V + +G I+I++L+ F++ +  F+++FQ + + ++    + +E AA+ + +  ++  S R  +DI +KAP+I IP++S S NA +VDLG +T  N F++  +       VLE   I L+ L++SR++L  +    +  IL PIN+ + + RNL+    + IP + +   + S+++ + Q D  +   +L  N  E  ++  +V  +K   K   ++
Sbjct:  862 EVQFQFEVKAVLFELTRQAAQEDVVLAFSVSQLGAEGRIRTFDLSVTSYLKKISLDYCEEKDVQNQPLHLITSSDKH--GSDLLKVEYIKADVNGPSFCTLFNNTEQTLKVEFSSLDFLLHTKALLSTINYMNSAIP-QELTANKERETRRRADRAAAGKTVSKGSKDAGVVNFKLSAVLGSFRVAVCDDRSNIA----DIRVQ-----------GIDAS--------VMVQAKETDVFARLRDIV-------VLDV----------------------------DPK--TIHKKAVSIVGEE-VFSFKMTLYPGATEGDGYT-DTSKVDGKVIMRLGCIQIVYLHKFLMSLLMFVDNFQTAKEALSAATAQAAEKAASSVRDFAQK--SFRLAMDIRLKAPLIIIPQSSTSHNAFVVDLGLITVGNRFSLLAAEGFPLPAVLETMDIKLTQLKLSRTVLKHDADHLDIEILEPINLELLVKRNLAAAWYNKIPGVEVNGVLMSMNMSLGQEDLGVLMRILAENIGEG-SKAAAVEGTKASAKDEAVI 1341          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Zebrafish
Match: vps13d (vacuolar protein sorting 13 homolog D [Source:ZFIN;Acc:ZDB-GENE-050912-1])

HSP 1 Score: 186.808 bits (473), Expect = 2.513e-46
Identity = 118/405 (29.14%), Postives = 209/405 (51.60%), Query Frame = 3
Query:   27 VFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPET-TNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNR-CRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQ 1235
            + E LV  ++N YLG YV  L+  QL + LL G   LENL ++++A   FDLP +V+ G I K+TL+IP+   +S+P +  +  L ++I P    +YD  +ER    E K K+L +  E+K K+ +    + T       +  +IV+N+++ I  +H+R+ED  + P + +A G+ + N+S Q C       +I++       K +++   +VYW++          + ++  M   + S E +     ++ +P+  S ++  +   E   +   PR+   ++LE +    ++ QY  I  FL  +DR   +  FRK+RP + +  N   WW F  N  L E +R++RR  SW +   HR R  +LYT ++ Q+L    LS  E+  ++  E+E  L  + + R+
Sbjct:    1 MLEGLVAWVLNTYLGKYVSNLNTDQLSIALLKGAVELENLPLRKDALRGFDLPFEVKAGVIGKITLQIPFYRPHSDPWVICMSQLNLIIGPALPQEYDEVQEREAEREQK-KQLLKALEDKWKKGESYWYSVTA-----SVVTRIVENIELKIQGVHLRFEDDFSNPEKPYAFGVCIKNVSAQNCSKEPAQKLIRQ-------KELEISEFSVYWDTECTMLGDLPSSEIQERMSKCMQSREHQ-----YIFEPVCASVLVRRNASKEPLRSRNTPRIEGQVQLEPLSLRLSQVQYQQIMAFLKELDRREKEMLFRKWRPKLTISGNCRQWWMFAINANLHE-IRKQRRHGSWDFA-LHRARDAKLYTSLYVQRLKGVTLSPQEESEMERIEDEQTLEELQILRE 385          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Xenopus
Match: git2 (G protein-coupled receptor kinase interacting ArfGAP 2 [Source:Xenbase;Acc:XB-GENE-949238])

HSP 1 Score: 554.288 bits (1427), Expect = 1.781e-157
Identity = 367/924 (39.72%), Postives = 555/924 (60.06%), Query Frame = 3
Query: 7287 AEDLH-DHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG-----WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPF-YESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINE-MKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILD-FVSGSVPTYDEE--AMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLS----RVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTI 10013
            AED+H  H        + +   KN  F+K  K  L I+ S WS  FSLDTVGS G V C    + Y VGV I +SS  L++IVT  P+Y ++N+S + +   E+  +       W  V   E +PFWP +  GK  +     E     +++PF F  + +  L+ LE    GI V+V I + + +I    Y +G A   +INH+    ++ + Q  T  E  L   +  ++AW+D    ++  W+     ++   +L  D    F  N+ ++ +WVSF+    R+LLFT D+ V   AR + ++E  DQE+T+SLHS+GLSLV+N  + E++YI I SSGV W +++RK++ +P    Q   LE A+++++   +     VEE+ V V   +V +  +L   P KC + R F  G++++++ SPHQ  +  ++Y +Q+DN +    FPVVF P  PP+SVALD+  KP I++S +   +  +  M++KYF VL Q M L LDQGF+ +++  F   + P  +++   +  KD   +   L+E+S             F++FHISP+K+HLS SL     + N+  K  +    +NL L+S+G  +TD+ D+IFKL  FE +      NQ+ + +  HY  Q L+Q+YVLVLGLDVLGNPFG+IRG+ +GVE  FYEP +GAV GPEEF EG+  G+KSL GH VGGAAG VSRI GT+GKG+AA+T+D +YQ+KRR+++ ++P++ G  LA+GGKG + G V GVTG++TKP++GAKK+G  GFFKG+GKGLVGVV RP  G+VD ASS+F+GI+RVA++  EV  +RPPR I +DGIIR Y   EA+G  ++  +  K   +  E+Y +    +++K  + +TN+R+  +   EILG   I W   +E+   PP ++ +  T+
Sbjct: 2677 AEDIHVKHPSDYRDVILFSFKKKN-IFSKN-KIQLCISTSSWSTGFSLDTVGSYGCVKCPAVKMEYLVGVNIKMSSFNLSRIVTLTPFYTLVNKSKLEIEVGEMATDVSPTDIKWNYVSSSECIPFWPENISGKLCVRVIGCEG----ISKPFFFNKQDNGTLLSLESMNTGIIVDVSIADHSTVITFSDYYKGAAPALIINHM-PHAKLTYNQSGTEIEKELGPGEARLFAWEDPTGTKKLNWKCASTTRE--VDLLKDESGQFAYNQNVQIHWVSFLDGRQRVLLFTEDVAVVTKARQAEEMEQSDQEVTVSLHSLGLSLVNNDSRHEISYIGIISSGVIW-EMKRKHKWQPFNQKQIFQLEGAYEKYLTNEEQGWVSVEENFV-VCFSKVPMEMRL---PIKCSIRRNFMSGIYMEFKQSPHQRSLRAQLYWLQVDNHLPGSMFPVVFHPVIPPKSVALDSEPKPFIDVSIITRFNEFSKVMQFKYFMVLTQCMALKLDQGFLAAVIGLFTPETDPNAEKQRTQLIQKDLDSLNTELMESSLTDISFPS----FFEHFHISPLKLHLSLSLGAGGEQSNKEEKEIIAIASVNLLLKSIGATLTDVDDLIFKLACFELKYQFYKQNQLRNLVVRHYTEQFLKQVYVLVLGLDVLGNPFGLIRGLTEGVEAFFYEPFQGAVQGPEEFAEGLVIGMKSLLGHTVGGAAGMVSRITGTVGKGLAAITMDKEYQQKRRQEMGRQPKDFGESLAKGGKGFLRGVVGGVTGIITKPVEGAKKEGAAGFFKGIGKGLVGVVARPTGGIVDMASSTFQGIQRVAESTEEVSPLRPPRLIHEDGIIRPYNESEAQGFKLFQNLNVK--KLDGEMYRYSCCLQNRKANLMVTNRRLICMKEVEILGHRMIDWTYTFEEFVHPPIVDGNTLTL 3580          

HSP 2 Score: 511.916 bits (1317), Expect = 1.184e-144
Identity = 400/1405 (28.47%), Postives = 682/1405 (48.54%), Query Frame = 3
Query:  189 KVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRND---PKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDEL--QKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXXXXXXFKDALE---IMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQ---DIKNTLVEKNGAKE-----IVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPS--TKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEA 4337
            K+   +I KLTLKIPWK+LY + V+A L+GL++L++P + +KYD +KE   + ETKQ+EL RIEE   K  D   PK     KD+F EKL  Q++KNLQI I++IHIRYED   C +            S QTC+ S    I+ E +T+  +K V++DS + YWN   K +  + R  +   +K  I S  RK  D  ++ +P++ SA ++++   E      P++   ++++ +     + QY      L+S+D       +RKYRP + ++ +   WW +  N ILE  ++RR  MWSW  I  HR   ++Y + ++ KL   KL +     ++ CE+ LD+ NI L RQQA+ ++ +      AKK      +K                    +   D  DE+   +K+    T EEKAKL+ AIGYS+ + +  +P  YV+  LN +L +    I ++ +   + +++ I  +S  V QR  A A+ +   + +  VTG       VP+LV T   ++  +LL + FETNP    A+Q + + ++P+EIIYD+ T+N + +F    + + L ++++  L  +EE+KE TATG+          ++ ++I                   +L+ + S+    E T+                L+ + + E AYDKF + +  +Q L   +G+DW+K R + SS  HIL+P   E  L+K ++  D+ +P+  + G LP L + ISD+ +Q V +L+  IP PQ       PT                      +N+ + AI +LP      L   I++    +++  D+ E    +D+N     K      +I    ++    V N  EL  L    ++K   +E    +E     I+   V ++GT   +K + +   +Y+  + L    + D     K P+ L  +      + LL +  +  +   P F T   NT   L+  F ++++ LH EALL  ++F+   IP L        E   +P ++                                       +K ++  KA  +S++ D   +    K+F            A+L    V V +EK N+I +I I GM          TEV   + D+ + D +P  ++KK + I  +E +FS ++ L+ + T    Y+ D+S+VD  +++ VG I+I+FL+ F++ +  FLN+FQ + + V+    + ++ AA  + ++ E   S R  +D+++KAP+I +P++S S NA++ DLG L   N F +    DQ     ++   I L+  ++SR++L + + + +  ILHPINI + + RNL+    H IP + +   + +++VG+SQ D ++   VL  N  EA
Sbjct:   10 KMNTFYIYKLTLKIPWKNLYGDAVVATLEGLFLLVVPGASIKYDAQKEEKSIQETKQRELLRIEEALQKAADKDIPKDAK--KDTFMEKLLTQVIKNLQIKITDIHIRYEDD--CHDICTVYSHIFHLYSTQTCNESWKPCILNE-ATKIIYKLVRLDSFSTYWNVKSKLYYRKPREDILTALKEGILSEARKPKDYQYIFKPVNASAKLYINPLAEM-ELKTPKIDWIMEVQNVAIEVTKPQYLSFMDLLESVDYMVRNAPYRKYRPQLSLQEDTKQWWLYAINSILEVHIKRRTHMWSWNNIAKHRQNLKMYKNAYKTKLTQAKLPEETVKQLQACEKLLDVFNIVLARQQAQAEIIRSGQKLMAKKSSAGGEKKGGGWFGSFWSK-------KEATKKDDVDEIFASEKIDDFMTPEEKAKLFTAIGYSDSSHNLALPKAYVAHILNFKLLRTSITIRED-IHTPETLQIQIIDLSTKVFQRPGAQAVKIEAKLEHWYVTGL-SQQNIVPSLV-TSIGNRESSLLRIVFETNPQHIKADQVLILESQPVEIIYDAVTINALAEFFQTQKGMDLEQLTSATLMKLEEIKEKTATGI----------NLVLEI----------------IDFILLQIISVDQAEETTN----------------LSLEDLMEKAYDKFDVRIKNVQILFGTKGEDWKKAREKGSSSLHILQPLDIELKLEKAMVERDSRMPRFKILGELPLLHIKISDKKIQGVFQLVNSIPLPQKT---STPT---------------------NANKKIPAIAILPRRFEKLLKKEIEQSLFLEDDQSDSNEEFFDVDDNFPAIVKTKQIHKQISVNAEMSNTEVTNVEELTDLNLKFEVKEVKIEFTKQQEKLQETILVFNVLQLGTESCIKTYSLTSVSYLKKISL---DYYDTKGFRKQPLHLISSSDKNASE-LLKVEYVKADTKGPQFQTTFDNTEQTLKVFFSAMDLLLHSEALLSTISFLTESIPNL-------PENVRAPKQQ---------------------------------------DKESLVKKAAKISKEKDIFAF----KLF------------ANLDAFNVNVWDEK-NHIAEIKIQGMACHFFIQSNQTEVFARLKDIIVNDVNPQTIHKKAVSI-MEEEVFSFRLMLYPEATQGDAYK-DVSKVDGKLDLRVGCIQIVFLHKFLMTLLKFLNNFQAAKERVSMATAQAAQRAATSVKDLAER--SFRLLMDVHLKAPLIVVPQSSVSCNAIVADLGLLKINNRFTLVSSEDQQLPPFVDHMTINLTEFKLSRTMLQDGSFQPDVEILHPININLSINRNLAATWYHKIPVLEVKGHLNTMNVGLSQEDVSVLLNVLVENLGEA 1261          

HSP 3 Score: 337.421 bits (864), Expect = 1.338e-91
Identity = 363/1493 (24.31%), Postives = 658/1493 (44.07%), Query Frame = 3
Query: 2856 VHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFA----IDQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNE------AINQVPSVPESKEEVKSRKILPKD----DKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQD----KNSNSKLIVDI-AGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVE---PRLADFEIDVKVARPEILLVEDMLNPDSNAIMV--QTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIY-LRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLE-VYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEP-SAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFY--INKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYR--------TEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKC---YNVPIPT-----LLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSI--EEVQIVNSS---ETLRTYKLDINVPLALHNQLPIKISY--QSQIFSHDIKPG-CLELVRTACLKVQSNIKVTY--HYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESF-MDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAV 7166
            V ++G    +    M    Y+  + +A   F+ PS   P+ L  +        LL +  +  ++  P+F T+H NT         S++  LH +ALL ++NF++S +P  NI+EE +        KE   K++ L+                SI+                     A  E  ++N  DS               ++A L  L + V +E   NI DI I GM A V      TEV   + D  I D     ++KK ++I  DE +F+ +++++ + T    Y  D+S VD  + + VG I II+L+ F++ +  FL+ FQ + + ++    + +E AA+ +    ++  S R  +DI++KAPVI IP++S S NA++ DLG +  +N F+    +D     V+++  I L+ L++SR++L+  + K E  IL P+N+ + + RNL+ +    IP + +   +  + + +SQ D ++   VL  N  E       +    S+ + K+EV+ +    KD    + S     A   S+T+ + FK E L + L++ D +             L +++   L+  G+M+ + +M+ SV L    + D +    K  + +I     D  D +  + + D    + +   LI  I   +Y+C  +++LM + DFF++A P      K     VR      R  + KP A   E   P      + V +  PEI+ V +++  D+ A+ V  Q NF L    +  S  +   + +F+ + CPF  E R  N   ++ P S+ +             L++E +II ++P ++ ++  I++ L  +  +E          N  +L+  N W+ R  D     F+               GV+   ++ +     E +   + + L +  +++ LE  +  + VP+L+ E +    +KN  + I +    ++ V Y+N++  VWEPL+E V          FE++     D  LF  +DF  ++  EP SAI+I   S+D + +T+SK  L V  NL KAF +  +   + + S   AP  +KN  G  ++     N   ++   +S              Q +D VDE QSL  E    +++K G   ++ R+  S+          TE+  +  +       +  N  +    +++V   A  G K + +RS LQ+ N+     T+Y          +AK   LLE +   +    ++VP+ +      L   G +    K+     S S   W    +        L C ++        V  S   +E+  ++ +   E    Y + +   L + N +P  I +  +    +H++  G  L+++++   ++   I   +   YQ + W G + +   + E   + F A    SE   +DL VH+     +  +++YSPYW++NKT   L YKA +D  V+H +   D +
Sbjct: 1338 VSQVGAEARVGSQLMTASVYLKKISMACNDFMGPSG-GPLLLINSSDDDNAP-LLKMEYVKADQNGPNFKTIHDNTEQSFNISVSSLDFILHTQALLSLMNFLSSAVPSHNILEENRP-------KESKAKESRLK----------------SII---------------------ARPESYNFNTEDS-----------FSLKVSAKLNALNIFVCDEI-CNIADIRIQGMDASVAVQTKQTEVCARLEDFVIFDVDSKTIHKKAVFIMGDE-VFNFKMSMYPEATEGISYS-DMSAVDGKICLRVGCIHIIYLHRFLMSLLNFLDKFQAAKEALSTATSQAAEKAASSMKEFAQK--SFRLSMDIDLKAPVIIIPQSSVSANAIVADLGFIRIQNKFSLVPVVDCPLPPVVDQMNIQLTELQLSRTVLMSGSDKPELEILQPVNLLVSVQRNLASSWYSEIPALQLVGDLKHMQIALSQEDLSILMSVLFENLAEKPSLPRVVETTKSIEQVKKEVECQSYQQKDTMKTEDSVEQDVAEALSVTLNYKFKFESLSIVLYQSDCSKETALWLHNESLRLGELRLHLLTSSGNMYSDGSMDASVYLKTCTLDDLREGITKATSRMI-----DQKDGVCERNMVDITYKQGAQDCLITTILEKLYVCASMEFLMTVADFFIQAMPQSPSGEKSMQKHVR------RSTQTKPRAESGESHPPSQKKVNVKVLIMDPEIVFVANLMKADAPALSVSFQGNFTLDS--LSGSQKVAAIVKEFKVLACPFLRELRGSNITTVMQPCSLQIEGTIDAAGAKNLILSLEEVIIKVSPIILNTVQTIIDALKPKPKEEEVNE------NLTELV--NIWDVRSIDSCSNWFL---------------GVDMAQEITETFQSSEHKEKQESFELEVKSVQITLECGLGHRTVPLLLMESTFSTKVKNWTSFINITADTTLEVHYYNENYAVWEPLIERVNCGSRRWSLKFEMKNNPVMDKSLFPGDDF--ILIPEPRSAINI--YSKDTMNITISKCTLTVFGNLAKAFSEGTASTYD-YDSKDRAPLTIKNALGIPIIVQHGSNMRRNIPSPHS--------------QTHD-VDEGQSLELEFCAVELLKRGQHSALHRQDSSLLTVGIVPHGYTEMANIPVTKTARRLYNVRNPQQENFVSVLVQIDATEGNKVITIRSPLQIKNHFSIPFTVYKF------VASAK---LLEPIGVARQDEEFHVPLDSYRCQLFLRPAGALEEQFKE-----STSYITWKEMVHRSSEVRCTLQCPASEISFLPLMVNCSAVPDEINFISRNGEKEWDPAYIIHLYPTLTVRNLVPYSIRFLLEGAAETHELAEGSSLDVLQS---RISGEIMELFLIKYQGRNWNGHIRVHENLSEFFPVLFTADS--SELLTVDLSVHVRHIGNRMVLSVYSPYWIINKTSRILQYKA-EDIHVKHPSDYRDVI 2692          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Xenopus
Match: git2 (G protein-coupled receptor kinase interacting ArfGAP 2 [Source:Xenbase;Acc:XB-GENE-949238])

HSP 1 Score: 548.51 bits (1412), Expect = 6.942e-156
Identity = 365/930 (39.25%), Postives = 551/930 (59.25%), Query Frame = 3
Query: 7287 AEDLH-DHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG-----WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPF-YESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINE-MKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILD-FVSGSVPTYDEE--AMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLS----RVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCK------SKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTI 10013
            AED+H  H        + +   KN  F+K  K  L I+ S WS  FSLDTVGS G V C    + Y VGV I +SS  L++IVT  P+Y ++N+S + +   E+  +       W  V   E +PFWP +  GK  +     E     +++PF F  + +  L+ LE    GI V+V I + + +I    Y +G A   +INH+    ++ + Q  T  E  L   +  ++AW+D    ++  W+     ++   +L  D    F  N+ ++ +WVSF+    R+LLFT D+ V   AR + ++E  DQE+T+SLHS+GLSLV+N  + E++YI I SSGV W +++RK++ +P    Q   LE A+++++   +     VEE+ V    + ++     M  P KC + R F  G++++++ SPHQ  +  ++Y +Q+DN +    FPVVF P  PP+SVALD+  KP I++S +   +  +  M++KYF VL Q M L LDQGF+ +++  F   + P  +++   +  KD   +   L+E+S             F++FHISP+K+HLS SL     + N+  K  +    +NL L+S+G  +TD+ D+IFKL  FE +      NQ+ + +  HY  Q L+Q+YVLVLGLDVLGNPFG+IRG+ +GVE  FYEP +GAV GPEEF EG+  G+KSL GH VGGAAG VSRI GT+GKG+AA+T+D +YQ+KRR+++ ++P++ G  LA+GGKG + G V GVTG++TKP++GAKK+G  GFFKG+GKGLVGVV RP  G+VD ASS+F+GI+RVA++  EV  +RPPR I +DGIIR Y   EA+G  ++            ++ V   YC+      ++K  + +TN+R+  +   EILG   I W   +E+   PP ++ +  T+
Sbjct: 2290 AEDIHVKHPSDYRDVILFSFKKKN-IFSKN-KIQLCISTSSWSTGFSLDTVGSYGCVKCPAVKMEYLVGVNIKMSSFNLSRIVTLTPFYTLVNKSKLEIEVGEMATDVSPTDIKWNYVSSSECIPFWPENISGKLCVRVIGCEG----ISKPFFFNKQDNGTLLSLESMNTGIIVDVSIADHSTVITFSDYYKGAAPALIINHM-PHAKLTYNQSGTEIEKELGPGEARLFAWEDPTGTKKLNWKCASTTRE--VDLLKDESGQFAYNQNVQIHWVSFLDGRQRVLLFTEDVAVVTKARQAEEMEQSDQEVTVSLHSLGLSLVNNDSRHEISYIGIISSGVIW-EMKRKHKWQPFNQKQIFQLEGAYEKYLTNEEQGWVSVEENFVCFSKVPME-----MRLPIKCSIRRNFMSGIYMEFKQSPHQRSLRAQLYWLQVDNHLPGSMFPVVFHPVIPPKSVALDSEPKPFIDVSIITRFNEFSKVMQFKYFMVLTQCMALKLDQGFLAAVIGLFTPETDPNAEKQRTQLIQKDLDSLNTELMESSLTDISFPS----FFEHFHISPLKLHLSLSLGAGGEQSNKEEKEIIAIASVNLLLKSIGATLTDVDDLIFKLACFELKYQFYKQNQLRNLVVRHYTEQFLKQVYVLVLGLDVLGNPFGLIRGLTEGVEAFFYEPFQGAVQGPEEFAEGLVIGMKSLLGHTVGGAAGMVSRITGTVGKGLAAITMDKEYQQKRRQEMGRQPKDFGESLAKGGKGFLRGVVGGVTGIITKPVEGAKKEGAAGFFKGIGKGLVGVVARPTGGIVDMASSTFQGIQRVAESTEEVSPLRPPRLIHEDGIIRPYNESEAQGFKLF------------QVSVHRTYCRLYCCLQNRKANLMVTNRRLICMKEVEILGHRMIDWTYTFEEFVHPPIVDGNTLTL 3188          

HSP 2 Score: 346.665 bits (888), Expect = 2.104e-94
Identity = 257/826 (31.11%), Postives = 418/826 (50.61%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRND---PKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDEL--QKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQ-TAPP 2483
            ++ ES+V +L+N++LGDYV  LD+SQLKLG+ GG   +   D+      + ++P KV+ G I KLTLKIPWK+LY + V+A L+GL++L++P + +KYD +KE   + ETKQ+EL RIEE   K  D   PK     KD+F EKL  Q++KNLQI I++IHIRYED   C +            S QTC+ S    I+ E +T+  +K V + +L+V                   ++ N I              +P++ SA ++++   E      P++   ++++ +     + QY      L+S+D       +RKYRP + ++ +   WW +  N ILE  ++RR  MWSW  I  HR   ++Y + ++ KL   KL +     ++ CE+ LD+ NI L RQQA+ ++ +      AKK      +K                    +   D  DE+   +K+    T EEKAKL+ AIGYS+ + +  +P  YV+  LN +L +    I ++ +   + +++ I  +S  V QR  A A+ +   + +  VTG       VP+LV T   ++  +LL + FETNP    A+Q + + ++P+EIIYD+     + +F    + + L ++++  L  +EE+KE TATG+ +L     + D         FIL          +++ VD       +E T+                L+ + + E AYDKF + +  +Q L +         + + SS  HIL+P   E  L+K ++  D+ +P+  + G LP L + ISD+ +Q V +L+  IP PQ T+ P
Sbjct:    1 IMLESVVADLLNRFLGDYVENLDRSQLKLGIWGGK-IISLFDVL--TLFELNVPFKVKAGQIDKLTLKIPWKNLYGDAVVATLEGLFLLVVPGASIKYDAQKEEKSIQETKQRELLRIEEALQKAADKDIPKD--AKKDTFMEKLLTQVIKNLQIKITDIHIRYED--DCHDICTVYSHIFHLYSTQTCNESWKPCILNE-ATKIIYK-VSIYNLSVI-----------------NMLHNCI-------------FKPVNASAKLYINPLAE-MELKTPKIDWIMEVQNVAIEVTKPQYLSFMDLLESVDYMVRNAPYRKYRPQLSLQEDTKQWWLYAINSILEVHIKRRTHMWSWNNIAKHRQNLKMYKNAYKTKLTQAKLPEETVKQLQACEKLLDVFNIVLARQQAQAEIIRSGQKLMAKKSSAGGEKKGGGWFGSFW-------SKKEATKKDDVDEIFASEKIDDFMTPEEKAKLFTAIGYSDSSHNLALPKAYVAHILNFKLLRTSITIRED-IHTPETLQIQIIDLSTKVFQRPGAQAVKIEAKLEHWYVTGL-SQQNIVPSLV-TSIGNRESSLLRIVFETNPQHIKADQVLILESQPVEIIYDA-----VTEFFQTQKGMDLEQLTSATLMKLEEIKEKTATGI-NLVLEMPFID---------FIL---------LQIISVDQ------AEETT---------------NLSLEDLMEKAYDKFDVRIKNVQILSV--------CKEKGSSSLHILQPLDIELKLEKAMVERDSRMPRFKILGELPLLHIKISDKKIQGVFQLVNSIPLPQKTSTP 723          

HSP 3 Score: 269.24 bits (687), Expect = 5.875e-71
Identity = 294/1242 (23.67%), Postives = 545/1242 (43.88%), Query Frame = 3
Query: 3549 MRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFA----IDQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDI-AGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMV--QTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIY-LRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLE-VYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEP-SAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFY--INKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRG--------NVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPT-----LLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSI--EEVQIVNSS---ETLRTYKLDINVPLALHNQLPIKISY--QSQIFSHDIKPG-CLELVRTACLKVQSNIKVTY--HYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESF-MDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAV 7166
            M A V      TEV   + D  I D     ++KK ++I  DE +F+ +++++ + T    Y  D+S VD  + + VG I II+L+ F++ +  FL+ FQ + + ++    + +E AA+ +    ++  S R  +DI++KAPVI IP++S S NA++ DLG +  +N F+    +D     V+++  I L+ L++SR++L+  + K E  IL P+N+ + + RNL+ +    IP + +   +  + + +SQ D ++   VL  N  E     PS+P   E  KS +         +A    +ES+                                  L +++   L+  G+M+ + +M+ SV L    + D +    + I +      N   +   +     + +   LI  I   +Y+C  +++LM + DFF++A           M      EKN      K  + PVE ++    + V +  PEI+ V +++  D+ A+ V  Q NF L    +  S  +   + +F+ + CPF  E R  N   ++ P S+ +             L++E +II ++P ++ ++  I++ L  +  +E          N  +L+  N W+ R  D     F+               GV+   ++ +     E +   + + L +  +++ LE  +  + VP+L+ E +    +KN  + I +    ++ V Y+N++  VWEPL+E V          FE++     D  LF  +DF  ++  EP SAI+I   S+D + +T+SK  L V  NL KAF +  +   + + S   AP  +KN  G  ++     N   ++   +S              Q +D VDE QSL  E    +++K G   ++ R+  S+    +    ++   N   ++         N  +    +++V   A  G K + +RS LQ+ N+     T+Y     +   E        EE      ++VP+ +      L   G +    K+     S S   W    +        L C ++        V  S   +E+  ++ +   E    Y + +   L + N +P  I +  +    +H++  G  L+++++   ++   I   +   YQ + W G + +   + E   + F A    SE   +DL VH+     +  +++YSPYW++NKT   L YKA +D  V+H +   D +
Sbjct: 1192 MDASVAVQTKQTEVCARLEDFVIFDVDSKTIHKKAVFIMGDE-VFNFKMSMYPEATEGISYS-DMSAVDGKICLRVGCIHIIYLHRFLMSLLNFLDKFQAAKEALSTATSQAAEKAASSMKEFAQK--SFRLSMDIDLKAPVIIIPQSSVSANAIVADLGFIRIQNKFSLVPVVDCPLPPVVDQMNIQLTELQLSRTVLMSGSDKPELEILQPVNLLVSVQRNLASSWYSEIPALQLVGDLKHMQIALSQEDLSILMSVLFENLAEK----PSLPRVVETTKSIE-------QETALWLHNESLR---------------------------------LGELRLHLLTSSGNMYSDGSMDASVYLKTCTLDDLR----EGITKATSRYANGVCERNMVDITYKQGAQDCLITTILEKLYVCASMEFLMTVADFFIQA-----------MPQSPSGEKNGLFIWYKYQSRPVEEKV---NVKVLIMDPEIVFVANLMKADAPALSVSFQGNFTLDS--LSGSQKVAAIVKEFKVLACPFLRELRGSNITTVMQPCSLQIEGTIDAAGAKNLILSLEEVIIKVSPIILNTVQTIIDALKPKPKEEEVNE------NLTELV--NIWDVRSIDSCSNWFL---------------GVDMAQEITETFQSSEHKEKQESFELEVKSVQITLECGLGHRTVPLLLMESTFSTKVKNWTSFINITADTTLEVHYYNENYAVWEPLIERVNCGSRRWSLKFEMKNNPVMDKSLFPGDDF--ILIPEPRSAINI--YSKDTMNITISKCTLTVFGNLAKAFSEGTASTYD-YDSKDRAPLTIKNALGIPIIVQHGSNMRRNIPSPHS--------------QTHD-VDEGQSLELEFCAVELLKRGQHSALHRQDSSLLTVGIVPHGYTEMANIPVTKTARRLYNVRNPQQENFVSVLVQIDATEGNKVITIRSPLQIKNHFSIPFTVYKFVASAKLLEPIGVARQDEE------FHVPLDSYRCQLFLRPAGALEEQFKE-----STSYITWKEMVHRSSEVRCTLQCPASEISFLPLMVNCSAVPDEINFISRNGEKEWDPAYIIHLYPTLTVRNLVPYSIRFLLEGAAETHELAEGSSLDVLQS---RISGEIMELFLIKYQGRNWNGHIRVHENLSEFFPVLFTADS--SELLTVDLSVHVRHIGNRMVLSVYSPYWIINKTSRILQYKA-EDIHVKHPSDYRDVI 2305          

HSP 4 Score: 135.576 bits (340), Expect = 1.508e-30
Identity = 83/274 (30.29%), Postives = 154/274 (56.20%), Query Frame = 3
Query: 3546 GMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPS 4355
            GM          TEV   + D+ + D +P  ++KK + I  +E +FS ++ L+ + T    Y+ D+S+VD  +++ VG I+I+FL+ F++ +  FLN+FQ + + V+    + ++ AA  + ++ E   S R  +D+++KAP+I +P++S S NA++ DLG L   N F +    DQ     ++   I L+  ++SR++L + + + +  ILHPINI + + RNL+    H IP + +   + ++++ +S  D+ +    L S  N   + VPS
Sbjct:  870 GMACHFFIQSNQTEVFARLKDIIVNDVNPQTIHKKAVSI-MEEEVFSFRLMLYPEATQGDAYK-DVSKVDGKLDLRVGCIQIVFLHKFLMTLLKFLNNFQAAKERVSMATAQAAQRAATSVKDLAER--SFRLLMDVHLKAPLIVVPQSSVSCNAIVADLGLLKINNRFTLVSSEDQQLPPFVDHMTINLTEFKLSRTMLQDGSFQPDVEILHPININLSINRNLAATWYHKIPVLEVKGHLNTMNISVSSLDFILHTQALLSLMNFLSSAVPS 1139          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Xenopus
Match: VPS13A (vacuolar protein sorting 13 homolog A [Source:NCBI gene;Acc:100488998])

HSP 1 Score: 546.199 bits (1406), Expect = 3.045e-155
Identity = 376/926 (40.60%), Postives = 534/926 (57.67%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEG-----LEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVS--GSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTG------KTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITE----KCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEI 10076
            K + F +  K  L I DS  SD FSLDTVGS G V CK K + Y+VGV I  SS  LT+IVTF P++M+ N+S+  L   E   +   I V   + VPFWP +   K ++   +VE  +    + +   + +S L+ L  +F GI V+V + + + +I    Y  G A   +IN +  +    F+     ++  LP  + V+YAW+D   +R+  W     K Q   + T D +E   + +   Y VSF+    RILLFT +  V      +   E  +QEI ISL +IG+SLV+N  +QE++YI IT+S V W + ++K+R KPL + Q+E LE AF E+     T  +  +  IV ++      L  D S    I+P    + R F P + L+Y  S HQ  + L++Y+IQI NQ     FP VF P  PP+SV LD+  KPL ++S V+  +G +   R KYF+VLIQEM L +D GF+ ++ D  S  G VP      +F KD +  +  L   S+  T        V++ FHISPIK+HLSFSLS     G      K  +  + LNL L+S+G  +TD+QDV+FKL YFE QN      ++   +  HY  QA++QMYVLVLGLDVLGNPFG  R +++GVE  FYEP +GA+ GPEEFVEG+A GVK+L G AVGG AGA SRI G M KG+AA+T+D +YQ+KRRE + K+P  +  G+ +GGKGL+ GFV G+TG+VTKPI GA+K+G  GFFKGVGKGLVG VTRP  G++D ASS+F+GI++  D++ +V  +RPPRFI +DG+IR Y +RE  G+ +  KI      KC       Y  H    S  +++ +    +  + R    G  + +WQ ++++    P I   +  +    KE+ + +F      K I
Sbjct: 2202 KPKNFLQNNKVQLMITDSELSDPFSLDTVGSHGAVKCKSKKLDYQVGVTIYASSFNLTRIVTFTPFFMVANRSNYTLSVAE-EGSEKCITVSTEQCVPFWPENSNNKLIV---QVEGSKAAPKKIYFNKQDNSTLLYLGDQFGGILVDVTLRDHSTVITFSDYHAGAAPFLIINDMKSETVTFFQSSVNEEKDCLPPGKAVLYAWKDPTSERKLTWICR--KSQGEVSQTEDRVEYLRLEDTSVYLVSFLEGLQRILLFTENESVFNVTFDNQKAELAEQEIIISLSNIGISLVNNYTKQEVSYIGITNSDVVW-ETKKKSRWKPLSIKQTEKLEQAFKEY-----TESSPTDTKIVALDTNCQVCLTPDFSGMKFIQPTTDPIRRSFLPALKLEYSASAHQTSIRLQVYRIQIQNQNPAAIFPFVFYPVKPPKSVTLDSEPKPLTDVSIVMRTAGHSEISRIKYFKVLIQEMDLRIDLGFLYALADLFSQSGDVPKDQAIELFKKDVESFQTELSAVSSTDT----SSISVYEYFHISPIKLHLSFSLSTGGDDGNKEQRDKELIPVQSLNLLLKSIGATLTDVQDVVFKLAYFELQNQFYTTQELQWEVIRHYSKQAIKQMYVLVLGLDVLGNPFGFFRDLSEGVEAFFYEPYQGAIQGPEEFVEGMALGVKALVGGAVGGLAGAASRITGAMAKGVAAITMDEEYQQKRREAMNKQPSGIREGITRGGKGLVSGFVSGITGIVTKPIKGAQKEGAAGFFKGVGKGLVGAVTRPTGGIIDMASSTFQGIKKATDSSDDVESLRPPRFIHEDGVIRPYRMREGAGSQMLQKIENGRFAKCK------YFAHAMVNS-SDLLMVMKSGVLFVTRG-TFGQLTCEWQYSFDEFTKEPFIVSGRR-LRIEAKERVKSVFHAKEFGKII 3102          

HSP 2 Score: 465.692 bits (1197), Expect = 1.035e-130
Identity = 296/813 (36.41%), Postives = 456/813 (56.09%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETK-DSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPET-TNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQ-SKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSE-RTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELI 2450
            MVFESLVV+++N++LGDYVV LD SQLKLG+ GG                F  P          L LKIPWK+LY++PV A LDG+Y+LI+P + +KYD EKE     E KQ+EL RIEE K K  D +K  E K D+F EKL  Q++KNLQ+ ISNIHIRYED  T P    + G++L NLS QT D +    +  ++S + F+K V++D+L  YWN     F   +  T    +          ++ + +L +PIS  A +   M P +  +F+ P++ LD+ L+ I   FN+ QY  +   L+S+D       +RK+RP+V + +N  IWW +    ILE  ++ R  MWSWK I+ HR + + Y +++  K+  KK S+      +  E+ LD+ NITL RQQAEM+  K          + +        GW  GW        S   A    D     +    + EEK +LY AIGYSE   DP +P  Y +++L ++L  +   + ++  K  +L+   I  +S  ++QR  A AI     +   +VTGT   + SVP ++S++      ++LL + FETNPLD+ A+QK+ + ++PLEIIYD+ T+N++V F  PP+++ L ++++  +  +EE ++ T+TGL ++ + +   D+K+++  SY I+PE G Y +   +LL+DLGS+ +VS+ R+ +P          K G+ + + +   AYD F + LS +Q L  +  +DW+K R+ + S  HIL P   +    + ++  DA +PK  + G LP L + ISD+ L+ VLELI
Sbjct:    1 MVFESLVVDVLNRFLGDYVVNLDSSQLKLGIWGGE------------LSTFSSP----------LDLKIPWKNLYTQPVEAVLDGVYLLIVPTASIKYDAEKEEKQSLEAKQRELQRIEEAKQKVADQEKPKEEKQDTFVEKLITQVIKNLQVKISNIHIRYEDDITNPKCPLSFGVSLQNLSLQTSDKNWNPCL-HDESAKLFYKLVRLDNLFAYWNVKSDMFYHRSYDTALVSL----------VSLICYLFRPISGRAKLR--MNPRSDVDFSSPKIDLDVNLQDIAIDFNKPQYHSVMELLESIDLMSRNLPYRKFRPDVCVATNAPIWWKYAITSILEVNIKPRLHMWSWKRIRKHRLQVKKYKELYRMKITSKKPSEEVLSKTEEYEKALDIFNITLARQQAEMEACKAGLKIYRPGSKDEDCNSKGWFGWMWGW--------SGETAEKKEDFKSGSLEGLMSPEEKVRLYAAIGYSETAVDPTLPKTYEAMRLCVKLLSMSIQLREDKGKT-ELINFAITDLSTVLKQRPGAQAIKFEAQIGTFEVTGTPQ-EKSVPCVLSSRNLIENNISLLSLMFETNPLDERADQKLQVESQPLEIIYDAKTINNLVDFFRPPQDVHLEQLASATMTKLEEFRDRTSTGLLYVIETQKVLDLKINLMASYIIVPENGFYEQSSNLLLLDLGSLKMVSKSRSHLPQL--------KIGQSSIEDIMSRAYDSFDVQLSKMQLLYRKNNEDWKKARNLKRSSLHILEPMDLKVEFSRAMVVTDARMPKCKLSGELPILSIQISDQKLKGVLELI 760          

HSP 3 Score: 322.013 bits (824), Expect = 4.803e-87
Identity = 365/1511 (24.16%), Postives = 663/1511 (43.88%), Query Frame = 3
Query: 2808 NTLVEKNGAKEIVKLIVH----EIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITM----TQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI-----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGS------------ARTASDESI--TVQFGFKMEFLDVELFKG-----DANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIK--NDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQG-SLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYIS-----------CDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYL--------GMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQ--IVNSSETLRTYKLDINVPL----ALHNQLPIKISYQSQIFSHD---IKPGCLELVRTACLKVQSNIKVT-YHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDA 7148
            ++L +KN +K++ K ++H     +GT L ++ FDM+  A++  + L  PQ+ D   K PV +  T  +T   +LL +  +  +   P+F T + N    ++  F S+++ LH EALL  ++F+ SL+P     + E+ E       +  +     ++E +    +K+ K D        D ++L              +E S    +  G+K  I EI++    +Q  IT   +K   ++A  K+  ILD                                P A +KK + I+  E  FS ++  +   T    Y  D+S VD  + + VG I++IF+  FV  I  F+N+FQ + Q +A      +E AA+ +  + +   S R  LDI+VKAPV+ +P++SKS   L+ DLG +T  N F+I       +   V++   I LS L++ R++    ++++E  +L P+N+ + + RNL+ +  H +P I I   +  +++ + Q D  +    L  N  E     P+  ES +E      L   D S S              T S   I  T++  F+ + L + L+ G       + +E  S +     L + K   +S+   M  +  +  +V+L+N  +LD +  S +K    +  +K   + +  + + + Q +   + L V +  +Y+C  +++L+ + D F+KA     +            EK+ ++       S    +++  E++V V  PEI+ V D+   D+ A++V T   L      E   +   + D     CPF S+ R      I+ P  +  + +   N+G Q   L+++ L++ ++P +I ++  I + +++         +   ++     +  + W+K+   + +  F  +    + K    ++ V +G               + + + +  I V LE+ V  + +PML+ + S  G++ N  T I L   + + V  FN+   VWEPL+E  P E ++  SF    +            C+  G  +EE+++    I     +I + S+D L +T+SK  +  L NL  AF DA S   +  K I  AP+VVKN  G  ++  ++     KP NS    K     DGE    D V  K         ++  +F    S+S ++  I   ++  L  S  D    ++   S   +  L+     Y+        G K + +RS LQ+ N+    I +Y            +  + L        +N+P+ +  + +   +  V++   E+S   +  ++ KN    D  +L  K  +      S+ L+I  V+  +++S  T   + L   V L     L N LP +I +  Q    D   +  GC   +  A L   + +K+   +Y  + W     +  K +++  INF+      +S +D+ VH+    GQ  + ++SPYWM+NKTG  L YKA DD   +H A
Sbjct:  840 DSLRKKNLSKDVEKTVLHLEIMGLGTELNVRTFDMSANAFLREISLKCPQYTD-DEKRPVYIITTLDNTT-DDLLTLEYIKADINGPEFKTTYKNVEQLIKVNFSSLDIHLHTEALLSTMSFLTSLVP-----QSERKEM-----DQPVQDSEEEKREEQKKTTIKKSKYD--------DVVNL-----------HVCAELSCLRVFIRGQKCRISEISIEGLDSQVVIT---KKATEVLAKLKNIAILDC------------------------------DPEANFKKAVCIKGKE-FFSFKMVSYVGATEGDAYR-DMSVVDSHITLNVGCIQVIFVNKFVSAILAFINNFQATKQALAEATVHAAEKAASGVKELAQH--SFRLALDIHVKAPVVIVPQSSKSSQVLVADLGLITVNNKFSIVIPKSHSNLPPVIDSMMINLSELKMYRTVYENGSLQSELQLLQPVNLDITIERNLAADWYHDVPDIKIIGHLKPMNLILGQEDLTLILQTLNENLGETSELFPA--ESDDET-----LVSGDNSSSHSAGTTVVTAAVVETYSPVKIKTTLKLDFQFDSLTLNLYSGKTFVLQGSVHERDSSLK----LAEFKLGLISLAVKMSSDGTVNAAVKLTNC-LLDDKRQSVQKATPRMLEMKVGTEKNVMVDVSYKQGRE-GTILDVTVRDVYLCASMEFLLTVADIFLKASQQSSKA-----------EKSIKQTSAPVKESAPTQQVSKMEMNVVVKNPEIVFVADLSRADAPALVVTTQCELCIKTSPEMQNMTAAVKDLHMKACPFLSDQRAGKITTILQPCDL-FFQSIQSNSGPQMIELSIKSLMLKVSPVIINTVITITSAISS---------NKEAVSEVTSPVSPDLWKKKNLKDLKMWFFEESKESENKPEESSNMVLTG---------------ETLKMSIESIIVTLEAGVGHRTLPMLLAKSSFSGNVTNWSTLINLYCQLELEVHCFNEMFGVWEPLVE--PLEVDKTDSFRPWNLGVKMKKKAREQICEPDG--EEENYK----IPEYITAISIFSKDHLNITLSKCGMATLGNLANAFTDAASKKCDACK-IDQAPFVVKNYLG--LLVSVSPSDSFKPLNSAAGSKKIDLHDGECLDMDYVQSK---------SQTDQFSAMTSLSSKHFYI---QLTPLDHSHTDKIPLTKVGRSLYCVRHLVSGIERYIVCQVDSVEGTKCITIRSPLQIRNHFSIPIGIY------------EEGVCLGTASPEDEFNIPLAS-YSRSVLCFKPVQEKKYEMSEGVSFEDVIKN----DGLLLNMKCQSATSKKDSLKLNIVPVKDIVMSSDHTNEGWHLPYVVHLWPTVVLRNLLPYQIKFSLQGVDVDATLVDDGCSTQIHNAALD-NTKLKLQLLNYTDQGWTAEYHIQSKQQDIHFINFRCVAELDKSELDIAVHVTYTTGQTIIALHSPYWMVNKTGRMLQYKA-DDIHRKHPA 2191          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Xenopus
Match: VPS13A (vacuolar protein sorting 13 homolog A [Source:NCBI gene;Acc:100488998])

HSP 1 Score: 545.428 bits (1404), Expect = 3.850e-155
Identity = 376/926 (40.60%), Postives = 534/926 (57.67%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEG-----LEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVS--GSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTG------KTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITE----KCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEI 10076
            K + F +  K  L I DS  SD FSLDTVGS G V CK K + Y+VGV I  SS  LT+IVTF P++M+ N+S+  L   E   +   I V   + VPFWP +   K ++   +VE  +    + +   + +S L+ L  +F GI V+V + + + +I    Y  G A   +IN +  +    F+     ++  LP  + V+YAW+D   +R+  W     K Q   + T D +E   + +   Y VSF+    RILLFT +  V      +   E  +QEI ISL +IG+SLV+N  +QE++YI IT+S V W + ++K+R KPL + Q+E LE AF E+     T  +  +  IV ++      L  D S    I+P    + R F P + L+Y  S HQ  + L++Y+IQI NQ     FP VF P  PP+SV LD+  KPL ++S V+  +G +   R KYF+VLIQEM L +D GF+ ++ D  S  G VP      +F KD +  +  L   S+  T        V++ FHISPIK+HLSFSLS     G      K  +  + LNL L+S+G  +TD+QDV+FKL YFE QN      ++   +  HY  QA++QMYVLVLGLDVLGNPFG  R +++GVE  FYEP +GA+ GPEEFVEG+A GVK+L G AVGG AGA SRI G M KG+AA+T+D +YQ+KRRE + K+P  +  G+ +GGKGL+ GFV G+TG+VTKPI GA+K+G  GFFKGVGKGLVG VTRP  G++D ASS+F+GI++  D++ +V  +RPPRFI +DG+IR Y +RE  G+ +  KI      KC       Y  H    S  +++ +    +  + R    G  + +WQ ++++    P I   +  +    KE+ + +F      K I
Sbjct: 2027 KPKNFLQNNKVQLMITDSELSDPFSLDTVGSHGAVKCKSKKLDYQVGVTIYASSFNLTRIVTFTPFFMVANRSNYTLSVAE-EGSEKCITVSTEQCVPFWPENSNNKLIV---QVEGSKAAPKKIYFNKQDNSTLLYLGDQFGGILVDVTLRDHSTVITFSDYHAGAAPFLIINDMKSETVTFFQSSVNEEKDCLPPGKAVLYAWKDPTSERKLTWICR--KSQGEVSQTEDRVEYLRLEDTSVYLVSFLEGLQRILLFTENESVFNVTFDNQKAELAEQEIIISLSNIGISLVNNYTKQEVSYIGITNSDVVW-ETKKKSRWKPLSIKQTEKLEQAFKEY-----TESSPTDTKIVALDTNCQVCLTPDFSGMKFIQPTTDPIRRSFLPALKLEYSASAHQTSIRLQVYRIQIQNQNPAAIFPFVFYPVKPPKSVTLDSEPKPLTDVSIVMRTAGHSEISRIKYFKVLIQEMDLRIDLGFLYALADLFSQSGDVPKDQAIELFKKDVESFQTELSAVSSTDT----SSISVYEYFHISPIKLHLSFSLSTGGDDGNKEQRDKELIPVQSLNLLLKSIGATLTDVQDVVFKLAYFELQNQFYTTQELQWEVIRHYSKQAIKQMYVLVLGLDVLGNPFGFFRDLSEGVEAFFYEPYQGAIQGPEEFVEGMALGVKALVGGAVGGLAGAASRITGAMAKGVAAITMDEEYQQKRREAMNKQPSGIREGITRGGKGLVSGFVSGITGIVTKPIKGAQKEGAAGFFKGVGKGLVGAVTRPTGGIIDMASSTFQGIKKATDSSDDVESLRPPRFIHEDGVIRPYRMREGAGSQMLQKIENGRFAKCK------YFAHAMVNS-SDLLMVMKSGVLFVTRG-TFGQLTCEWQYSFDEFTKEPFIVSGRR-LRIEAKERVKSVFHAKEFGKII 2927          

HSP 2 Score: 445.277 bits (1144), Expect = 1.792e-124
Identity = 281/787 (35.71%), Postives = 439/787 (55.78%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPET-TNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQ-SKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSE-RTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKI 2375
            MVFESLVV+++N++LGDYVV LD SQLKLG+ GG                             KL LKIPWK+LY++PV A LDG+Y+LI+P + +KYD EKE     E KQ+EL RIEE K K  D   + E +D+F EKL  Q++KNLQ+ ISNIHIRYED  T P    + G++L NLS QT D +     + ++S + F+K V++D+L  YWN     F   +  T   I+K  I++         F+ +PIS  A +   M P +  +F+ P++ LD+ L+ I   FN+ QY  +   L+S+D       +RK+RP+V + +N  IWW +    ILE  ++ R  MWSWK I+ HR + + Y +++  K+  KK S+      +  E+ LD+ NITL RQQAEM+  K          + +        GW  GW        S   A    D     +    + EEK +LY AIGYSE   DP +P  Y +++L ++L  +   + ++  K  +L+   I  +S  ++QR  A AI     +   +VTGT   + SVP ++S++      ++LL + FETNPLD+ A+QK+ + ++PLEIIYD+ T+N++V F  PP+++ L ++++  +  +EE ++ T+TGL ++ + +   D+K+++  SY I+PE G Y +   +LL+DLGS+ +VS+ R+ +P          K G+ + + +   AYD F + LS +Q L   + ++W+K R+ + S  HIL P   +    + ++  DA +P +
Sbjct:    1 MVFESLVVDVLNRFLGDYVVNLDSSQLKLGIWGG-----------------------------KLDLKIPWKNLYTQPVEAVLDGVYLLIVPTASIKYDAEKEEKQSLEAKQRELQRIEEAKQKVAD---QEEKQDTFVEKLITQVIKNLQVKISNIHIRYEDDITNPKCPLSFGVSLQNLSLQTSDKNWNP-CLHDESAKLFYKLVRLDNLFAYWNVKSDMFYHRSYDTALEILKYGIAARNTIPEGYDFVFRPISGRAKL--RMNPRSDVDFSSPKIDLDVNLQDIAIDFNKPQYHSVMELLESIDLMSRNLPYRKFRPDVCVATNAPIWWKYAITSILEVNIKPRLHMWSWKRIRKHRLQVKKYKELYRMKITSKKPSEEVLSKTEEYEKALDIFNITLARQQAEMEACKAGLKIYRPGSKDEDCNSKGWFGWMWGW--------SGETAEKKEDFKSGSLEGLMSPEEKVRLYAAIGYSETAVDPTLPKTYEAMRLCVKLLSMSIQLREDKGKT-ELINFAITDLSTVLKQRPGAQAIKFEAQIGTFEVTGTP-QEKSVPCVLSSRNLIENNISLLSLMFETNPLDERADQKLQVESQPLEIIYDAKTINNLVDFFRPPQDVHLEQLASATMTKLEEFRDRTSTGLLYVIETQKVLDLKINLMASYIIVPENGFYEQSSNLLLLDLGSLKMVSKSRSHLPQL--------KIGQSSIEDIMSRAYDSFDVQLSKMQLLY--RKNNWKKARNLKRSSLHILEPMDLKVEFSRAMVVTDARMPNL 732          

HSP 3 Score: 313.153 bits (801), Expect = 2.810e-84
Identity = 351/1494 (23.49%), Postives = 651/1494 (43.57%), Query Frame = 3
Query: 2790 VLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI-----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGD--ANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIK--NDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRK-KPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQG-SLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYIS-----------CDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYL--------GMKQLELRSVLQVFNNTDDVITLY----YLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQ--IVNSSETLRTYKLDINVPL----ALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVT-YHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDA 7148
            V+ D +   + K+  K ++ L +  +GT L ++ FDM+  A++  + L  PQ+   + K+ VC      HT G       L   +   P+F T + N    ++  F S+++ LH EALL  ++F+ SL+P     + E+ E       +  +     ++E +    +K+ K D        D ++L              +E S    +  G+K  I EI++                              G+ + V  +   TEV   + ++ I D  P A +KK + I+  E  FS ++  +   T    Y  D+S VD  + + VG I++IF+  FV  I  F+N+FQ + Q +A      +E AA+ +  + +   S R  LDI+VKAPV+ +P++SKS   L+ DLG +T  N F+I       +   V++   I LS L++  ++    ++++E  +L P+N+ + + RNL+ +  H +P I I   +  ++  ++         VL S F        +V E+   VK +                    T++  F+ + L + L+ G    + +E  S +     L + K   +S+   M  +  +  +V+L+N  +LD +  S +K    +  +K   + +  + + + Q +   + L V +  +Y+C  +++L+ + D F                 ++  +++ +  +  K  ++PV+  ++  E++V V  PEI+ V D+   D+ A++V T   L      E   +   + D     CPF S+ R      I+ P  +  + +   N+G Q   L+++ L++ ++P +I ++  I + +++         +   ++     +  + W+K+   + +  F  +    + K    ++ V +G               + + + +  I V LE+ V  + +PML+ + S  G++ N  T I L   + + V  FN+   VWEPL+E  P E ++  SF    +            C+  G  +EE+++    I     +I + S+D L +T+SK  +  L NL  AF DA S   +  K I  AP+VVKN  G  ++  ++     KP NS    K     DGE    D V  K         ++  +F    S+S ++  I   ++  L  S  D    ++   S   +  L+     Y+        G K + +RS LQ+ N+    I +Y     L   S + E                +N+P+ +  + +   +  V++   E+S   +  ++ KN    D  +L  K  +      S+ L+I  V+  +++S  T   + L   V L     L N LP +I +  Q+   ++  GC   +  A L   + +K+   +Y  + W     +  K +++  INF+      +S +D+ VH+    GQ  + ++SPYWM+NKTG  L YKA DD   +H A
Sbjct:  723 VVTDARMPNLSKDVEKTVLHLEIMGLGTELNVRTFDMSANAFLREISLKCPQY---TGKNSVCTLSV--HTDG-------LYTADINGPEFKTTYKNVEQLIKVNFSSLDIHLHTEALLSTMSFLTSLVP-----QSERKEM-----DQPVQDSEEEKREEQKKTTIKKSKYD--------DVVNL-----------HVCAELSCLRVFIRGQKCRISEISI-----------------------------EGLDSQVVITKKATEVLAKLKNIAILDCDPEANFKKAVCIKGKE-FFSFKMVSYVGATEGDAYR-DMSVVDSHITLNVGCIQVIFVNKFVSAILAFINNFQATKQALAEATVHAAEKAASGVKELAQH--SFRLALDIHVKAPVVIVPQSSKSSQVLVADLGLITVNNKFSIVIPKSHSNLPPVIDSMMINLSELKM--TVYENGSLQSELQLLQPVNLDITIERNLAADWYHDVPDIKIIGHLKPMNKKINS--------VLLSFFKGTTVVTAAVVETYSPVKIK-------------------TTLKLDFQFDSLTLNLYSGKTFGSVHERDSSLK----LAEFKLGLISLAVKMSSDGTVNAAVKLTNC-LLDDKRQSVQKATPRMLEMKVGTEKNVMVDVSYKQGRE-GTILDVTVRDVYLCASMEFLLTVADIF-----------------LKASQQSSKAEKSIKQTSAPVKESVSKMEMNVVVKNPEIVFVADLSRADAPALVVTTQCELCIKTSPEMQNMTAAVKDLHMKACPFLSDQRAGKITTILQPCDL-FFQSIQSNSGPQMIELSIKSLMLKVSPVIINTVITITSAISS---------NKEAVSEVTSPVSPDLWKKKNLKDLKMWFFEESKESENKPEESSNMVLTG---------------ETLKMSIESIIVTLEAGVGHRTLPMLLAKSSFSGNVTNWSTLINLYCQLELEVHCFNEMFGVWEPLVE--PLEVDKTDSFRPWNLGVKMKKKAREQICEPDG--EEENYK----IPEYITAISIFSKDHLNITLSKCGMATLGNLANAFTDAASKKCDACK-IDQAPFVVKNYLG--LLVSVSPSDSFKPLNSAAGSKKIDLHDGECLDMDYVQSK---------SQTDQFSAMTSLSSKHFYI---QLTPLDHSHTDKIPLTKVGRSLYCVRHLVSGIERYIVCQVDSVEGTKCITIRSPLQIRNHFSIPIGIYEEGVCLGTASPEDE----------------FNIPLAS-YSRSVLCFKPVQEKKYEMSEGVSFEDVIKN----DGLLLNMKCQSATSKKDSLKLNIVPVKDIVMSSDHTNEGWHLPYVVHLWPTVVLRNLLPYQIKFSLQV---NLDDGCSTQIHNAALD-NTKLKLQLLNYTDQGWTAEYHIQSKQQDIHFINFRCVAELDKSELDIAVHVTYTTGQTIIALHSPYWMVNKTGRMLQYKA-DDIHRKHPA 2016          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Xenopus
Match: git2 (G protein-coupled receptor kinase interacting ArfGAP 2 [Source:Xenbase;Acc:XB-GENE-949238])

HSP 1 Score: 541.962 bits (1395), Expect = 8.513e-154
Identity = 367/931 (39.42%), Postives = 552/931 (59.29%), Query Frame = 3
Query: 7287 AEDLH-DHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG-----WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPF-YESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINE-MKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILD-FVSGSVPTYDEE--AMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLS----RVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEG------NNIWI-KITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTI 10013
            AED+H  H        + +   KN  F+K  K  L I+ S WS  FSLDTVGS G V C    + Y VGV I +SS  L++IVT  P+Y ++N+S + +   E+  +       W  V   E +PFWP +  GK  +     E     +++PF F  + +  L+ LE    GI V+V I + + +I    Y +G A   +INH+    ++ + Q  T  E  L   +  ++AW+D    ++  W+     ++   +L  D    F  N+ ++ +WVSF+    R+LLFT D+ V   AR + ++E  DQE+T+SLHS+GLSLV+N  + E++YI I SSGV W +++RK++ +P    Q   LE A+++++   +     VEE+ V V   +V +  +L   P KC + R F  G++++++ SPHQ  +  ++Y +Q+DN +    FPVVF P  PP+SVALD+  KP I++S +   +  +  M++KYF VL Q M L LDQGF+ +++  F   + P  +++   +  KD   +   L+E+S             F++FHISP+K+HLS SL     + N+  K  +    +NL L+S+G  +TD+ D+IFKL  FE +      NQ+ + +  HY  Q L+Q+YVLVLGLDVLGNPFG+IRG+ +GVE  FYEP +GAV GPEEF EG+  G+KSL GH VGGAAG VSRI GT+GKG+AA+T+D +YQ+KRR+++ ++P++ G  LA+GGKG + G V GVTG++TKP++GAKK+G  GFFKG+GKGLVGVV RP  G+VD ASS+F+GI+RVA++  EV  +RPPR I +DGIIR Y   EA+G      N+ W+ +  E+      + Y++ +  K    V     +R+  +   EILG   I W   +E+   PP ++ +  T+
Sbjct: 2494 AEDIHVKHPSDYRDVILFSFKKKN-IFSKN-KIQLCISTSSWSTGFSLDTVGSYGCVKCPAVKMEYLVGVNIKMSSFNLSRIVTLTPFYTLVNKSKLEIEVGEMATDVSPTDIKWNYVSSSECIPFWPENISGKLCVRVIGCEG----ISKPFFFNKQDNGTLLSLESMNTGIIVDVSIADHSTVITFSDYYKGAAPALIINHM-PHAKLTYNQSGTEIEKELGPGEARLFAWEDPTGTKKLNWKCASTTRE--VDLLKDESGQFAYNQNVQIHWVSFLDGRQRVLLFTEDVAVVTKARQAEEMEQSDQEVTVSLHSLGLSLVNNDSRHEISYIGIISSGVIW-EMKRKHKWQPFNQKQIFQLEGAYEKYLTNEEQGWVSVEENFV-VCFSKVPMEMRL---PIKCSIRRNFMSGIYMEFKQSPHQRSLRAQLYWLQVDNHLPGSMFPVVFHPVIPPKSVALDSEPKPFIDVSIITRFNEFSKVMQFKYFMVLTQCMALKLDQGFLAAVIGLFTPETDPNAEKQRTQLIQKDLDSLNTELMESSLTDISFPS----FFEHFHISPLKLHLSLSLGAGGEQSNKEEKEIIAIASVNLLLKSIGATLTDVDDLIFKLACFELKYQFYKQNQLRNLVVRHYTEQFLKQVYVLVLGLDVLGNPFGLIRGLTEGVEAFFYEPFQGAVQGPEEFAEGLVIGMKSLLGHTVGGAAGMVSRITGTVGKGLAAITMDKEYQQKRRQEMGRQPKDFGESLAKGGKGFLRGVVGGVTGIITKPVEGAKKEGAAGFFKGIGKGLVGVVARPTGGIVDMASSTFQGIQRVAESTEEVSPLRPPRLIHEDGIIRPYNESEAQGFKLFQLNDQWLPRFKER------QRYLYKILTK----VSLFITRRLICMKEVEILGHRMIDWTYTFEEFVHPPIVDGNTLTL 3396          

HSP 2 Score: 346.28 bits (887), Expect = 2.782e-94
Identity = 266/829 (32.09%), Postives = 418/829 (50.42%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRND---PKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAI-MKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFN-RNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNI-SIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDEL--QKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQ-TAPP 2483
            ++ ES+V +L+N++LGDYV  LD+SQLKLG+ GGN  LENL IKENA   + + V        KLTLKIPWK+LY + V+A L+GL++L++P + +KYD +KE   + ETKQ+EL RIEE   K  D   PK     KD+F EKL  Q++KNLQI I++IHIRYED   C +            S QTC+ S    I+ E +T+  +K V + +L+V    +      + R  L    M  N               +P++ SA ++++          P   ++LK  +I +    +N   ++T                  +P V    N  +  W +  N ILE  ++RR  MWSW  I  HR   ++Y + ++ KL   KL +     ++ CE+ LD+ NI L RQQA+ ++ +      AKK      +K                    +   D  DE+   +K+    T EEKAKL+ AIGYS+ + +  +P  YV+  LN +L +    I ++ +   + +++ I  +S  V QR  A A+ +   + +  VTG       VP+LV T   ++  +LL + FETNP    A+Q + + ++P+EIIYD+ T+N + +F    + + L ++++  L  +EE+KE TATG+             +D     FIL          +++ VD       +E T+                L+ + + E AYDKF + +  +Q L   +G+DW+K R + SS  HIL+P   E  L+K ++  D+ +P+  + G LP L + ISD+ +Q V +L+  IP PQ T+ P
Sbjct:    1 IMLESVVADLLNRFLGDYVENLDRSQLKLGIWGGNVALENLRIKENALVKYIVFVLS-----DKLTLKIPWKNLYGDAVVATLEGLFLLVVPGASIKYDAQKEEKSIQETKQRELLRIEEALQKAADKDIPKD--AKKDTFMEKLLTQVIKNLQIKITDIHIRYED--DCHDICTVYSHIFHLYSTQTCNESWKPCILNE-ATKIIYK-VSIYNLSVINMLHNCSCQCKTRMQLYIFDMPQNRE-----------FFKPVNASAKLYIN----------PLAEMELKTPKIDWIMEVQNVAIEVT------------------KPQVSYILNCNTTQWLYAINSILEVHIKRRTHMWSWNNIAKHRQNLKMYKNAYKTKLTQAKLPEETVKQLQACEKLLDVFNIVLARQQAQAEIIRSGQKLMAKKSSAGGEKKGGGWFGSFW-------SKKEATKKDDVDEIFASEKIDDFMTPEEKAKLFTAIGYSDSSHNLALPKAYVAHILNFKLLRTSITIRED-IHTPETLQIQIIDLSTKVFQRPGAQAVKIEAKLEHWYVTGL-SQQNIVPSLV-TSIGNRESSLLRIVFETNPQHIKADQVLILESQPVEIIYDAVTINALAEFFQTQKGMDLEQLTSATLMKLEEIKEKTATGI-------------ID-----FIL---------LQIISVDQ------AEETT---------------NLSLEDLMEKAYDKFDVRIKNVQILFGTKGEDWKKAREKGSSSLHILQPLDIELKLEKAMVERDSRMPRFKILGELPLLHIKISDKKIQGVFQLVNSIPLPQKTSTP 721          

HSP 3 Score: 308.145 bits (788), Expect = 1.014e-82
Identity = 347/1469 (23.62%), Postives = 633/1469 (43.09%), Query Frame = 3
Query: 2871 TTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAE-AVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFA----IDQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDI-AGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMV--QTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIY-LRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLE-VYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEP-SAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFY--INKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRG--------NVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPT-----LLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSI--EEVQIVNSS---ETLRTYKLDINVPLALHNQLPIKISY--QSQIFSHDIKPG-CLELVRTACLKVQSNIKVTY--HYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESF-MDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAV 7166
             ++ LK+  MA   ++G  I AV                   HT+    L++     ++  P+F T+H NT         S++  LH +ALL ++NF++S +P  NI+EE +                   KE++A E                            RLK+  A  E  ++N  DS               ++A L  L + V +E   NI DI I GM A V      TEV   + D  I D     ++KK ++I  DE +F+ +++++ + T    Y  D+S VD  + + VG I II+L+ F++ +  FL+ FQ + + ++    + +E AA+ +    ++  S R  +DI++KAPVI IP++S S NA++ DLG +  +N F+    +D     V+++  I L+ L++SR++L+  + K E  IL P+N+ + + RNL+ +    IP + +   +  + + +SQ D ++   VL  N  E     PS+P   E  KS        +  +A    +ES+                                  L +++   L+  G+M+ + +M+ SV L    + D +    K  + +I   K+   +   +     + +   LI  I   +Y+C  +++LM + DFF+           +AM      EK+ +K+ ++  + P  P      + V +  PEI+ V +++  D+ A+ V  Q NF L    +  S  +   + +F+ + CPF  E R  N   ++ P S+ +             L++E +II ++P ++ ++  I++ L  +  +E          N  +L+  N W+ R  D     F+               GV+   ++ +     E +   + + L +  +++ LE  +  + VP+L+ E +    +KN  + I +    ++ V Y+N++  VWEPL+E V          FE++     D  LF  +DF  ++  EP SAI+I   S+D + +T+SK  L V  NL KAF +  +   + + S   AP  +KN  G  ++     N   ++   +S              Q +D VDE QSL  E    +++K G   ++ R+  S+    +    ++   N   ++         N  +    +++V   A  G K + +RS LQ+ N+     T+Y     +   E        EE      ++VP+ +      L   G +    K+     S S   W    +        L C ++        V  S   +E+  ++ +   E    Y + +   L + N +P  I +  +    +H++  G  L+++++   ++   I   +   YQ + W G + +   + E   + F A    SE   +DL VH+     +  +++YSPYW++NKT   L YKA +D  V+H +   D +
Sbjct: 1245 ASVYLKKISMACNDFMGEEIPAVI------------------HTRKCFFLYLQ---ADQNGPNFKTIHDNTEQSFNISVSSLDFILHTQALLSLMNFLSSAVPSHNILEENRP------------------KESKAKES---------------------------RLKSIIARPESYNFNTEDS-----------FSLKVSAKLNALNIFVCDEI-CNIADIRIQGMDASVAVQTKQTEVCARLEDFVIFDVDSKTIHKKAVFIMGDE-VFNFKMSMYPEATEGISYS-DMSAVDGKICLRVGCIHIIYLHRFLMSLLNFLDKFQAAKEALSTATSQAAEKAASSMKEFAQK--SFRLSMDIDLKAPVIIIPQSSVSANAIVADLGFIRIQNKFSLVPVVDCPLPPVVDQMNIQLTELQLSRTVLMSGSDKPELEILQPVNLLVSVQRNLASSWYSEIPALQLVGDLKHMQIALSQEDLSILMSVLFENLAEK----PSLPRVVETTKSI-------EQETALWLHNESLR---------------------------------LGELRLHLLTSSGNMYSDGSMDASVYLKTCTLDDLREGITKATSRMIDQ-KDGVCERNMVDITYKQGAQDCLITTILEKLYVCASMEFLMTVADFFI-----------QAMPQSPSGEKSMQKHVRQ--SHP--PSQKKVNVKVLIMDPEIVFVANLMKADAPALSVSFQGNFTLDS--LSGSQKVAAIVKEFKVLACPFLRELRGSNITTVMQPCSLQIEGTIDAAGAKNLILSLEEVIIKVSPIILNTVQTIIDALKPKPKEEEVNE------NLTELV--NIWDVRSIDSCSNWFL---------------GVDMAQEITETFQSSEHKEKQESFELEVKSVQITLECGLGHRTVPLLLMESTFSTKVKNWTSFINITADTTLEVHYYNENYAVWEPLIERVNCGSRRWSLKFEMKNNPVMDKSLFPGDDF--ILIPEPRSAINI--YSKDTMNITISKCTLTVFGNLAKAFSEGTASTYD-YDSKDRAPLTIKNALGIPIIVQHGSNMRRNIPSPHS--------------QTHD-VDEGQSLELEFCAVELLKRGQHSALHRQDSSLLTVGIVPHGYTEMANIPVTKTARRLYNVRNPQQENFVSVLVQIDATEGNKVITIRSPLQIKNHFSIPFTVYKFVASAKLLEPIGVARQDEE------FHVPLDSYRCQLFLRPAGALEEQFKE-----STSYITWKEMVHRSSEVRCTLQCPASEISFLPLMVNCSAVPDEINFISRNGEKEWDPAYIIHLYPTLTVRNLVPYSIRFLLEGAAETHELAEGSSLDVLQS---RISGEIMELFLIKYQGRNWNGHIRVHENLSEFFPVLFTADS--SELLTVDLSVHVRHIGNRMVLSVYSPYWIINKTSRILQYKA-EDIHVKHPSDYRDVI 2509          

HSP 4 Score: 153.295 bits (386), Expect = 7.806e-36
Identity = 95/292 (32.53%), Postives = 168/292 (57.53%), Query Frame = 3
Query: 3474 ASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEA 4337
            A+L    V V +EK N+I +I I GM          TEV   + D+ + D +P  ++KK + I  +E +FS ++ L+ + T    Y+ D+S+VD  +++ VG I+I+FL+ F++ +  FLN+FQ + + V+    + ++ AA  + ++ E   S R  +D+++KAP+I +P++S S NA++ DLG L   N F +    DQ     ++   I L+  ++SR++L + + + +  ILHPINI + + RNL+    H IP + +   + +++VG+SQ D ++   VL  N  EA
Sbjct:  900 ANLDAFNVNVWDEK-NHIAEIKIQGMACHFFIQSNQTEVFARLKDIIVNDVNPQTIHKKAVSI-MEEEVFSFRLMLYPEATQGDAYK-DVSKVDGKLDLRVGCIQIVFLHKFLMTLLKFLNNFQAAKERVSMATAQAAQRAATSVKDLAER--SFRLLMDVHLKAPLIVVPQSSVSCNAIVADLGLLKINNRFTLVSSEDQQLPPFVDHMTINLTEFKLSRTMLQDGSFQPDVEILHPININLSINRNLAATWYHKIPVLEVKGHLNTMNVGLSQEDVSVLLNVLVENLGEA 1186          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Mouse
Match: Vps13a (vacuolar protein sorting 13A [Source:MGI Symbol;Acc:MGI:2444304])

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 576/2040 (28.24%), Postives = 999/2040 (48.97%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETK-DSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFF-KSVKMDSLAVYWNSNPKPFS-SENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQV--LRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIG--TTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTSV----VLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSN--FNEAINQVPSVPESKEEVKSRKILPKDDKSGSART---------ASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIR-NIKNDSSDFISIKFIQDKNSNSKLIVD--IAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTL--TAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPL---LEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIF---GAPYVVKNTCGKDV 6044
            MVFES+VVE++N++LGDYVV LD+SQL LG+  G   L+NL IKENA  + D+P KV+ GHI  L LKIPWK+LY++PV A L+ +++LI+P+S ++YDP KE   L ETKQ+EL RIE+ K K  D +K  E K D+F EKL  QI++NLQ+ IS+IHIRYED  T  ++  + GI+L N+S QT D      +   D+T +   K +++D+L  YWN N + F  ++   +LKA +KN I +         F+ +PIS SA + ++ + +  +F+ P+++L + L  I   FN+ QY  +   L+S+D       +RK++P+VP+  +   WW +  + ILE  V    RMWSW++I+ HR + + Y + +++KL  KK S     +++  E+ LD+ NIT+ RQQAE++  K       + ++   +     G  ++          S S A+   D     +    T EEK+ LY+AIGYSE   DP +P  + +LK  + L+ +  ++ +N  K  +L+ +V+  +S  V QR  A AI     +++  +TG    D   P L+S+   +   +LL + FE NPL+++  Q+  I AEPLEIIYD+ TVN IV+F  PP+++ L ++++  L  +EE +  TATGL ++ + +   D+++++K SY I+P+ G ++    +LL+DLG + + S+R S+       L   +  + + + +   AYD F I L++IQ L    GD+W++ R    S  HIL P      L K ++  D  +PK  + G LP + + ISD+ LQ ++EL+  IP      P+PV    +  R +   Q    P  +++   +  L       DSE     +            ++  ++   +    +KK  K   + N+I L   F +    +Q    +        G  E+  L +  +G  T    + FD+   A++  L L  P+++D   K PV L  T  +T  ++LL +  + VEK +P+  + + N    ++  F S+++ LH EALL  +N++N+++P L     EK+ + S+   E+                    K D  I+  +  ++    +  T++L AE            S  +IFI                       ++  NI +I I G+ +++      TE++  + ++ + D   +A+YKK ++I   E +FS ++  +   T+   Y  D+S VD  V++ VG I+++F+  F+  I  F+++FQ     +A    + +E AA+ +  +  +  SSR  LD+N+KAPV+ IP++  S N  + D G +T KN F     T      V++   I LS +R+ RS    +T +    +L P+N+ + + RNLSW     +P  +I A++  +   +SQ D       L  N  + + ++   S  +  E + S    P D    +  T         AS     +   F+ ++L + L+    +   +     P   L + K EN+     ++ + +   S  + N  + D +    K    +I   +  D  D + IK+ + K   + ++ D  +  +Y+C  V++LM +   F  A                      R  R+ P        L  +E+++ +  PEI+ V DM   D+ A+++ T   +       S+ +   I D Q   CPF    RK     ++ P  +     +   +     ++++ L + ++P +I +I  I + L  T ++  E +T +           + + W+K++    +  F+ +   E EK+   N+ +  G               + + LR+  I ++LE+ +  + VPML+ +    G+ KN L+ I L   + + V Y+N+   VWEPL   LE+   +  R ++  I+        + + +   +   +     +I   SRD L +T+SK  L +L+NL +AF +A +       S+F    AP+++ N+ G  V
Sbjct:    1 MVFESVVVEVLNRFLGDYVVNLDESQLSLGIWKGAVALKNLVIKENALHELDVPFKVKVGHIGSLKLKIPWKNLYTQPVEAVLEEIFLLIVPSSRIQYDPIKEEKQLMETKQQELKRIEKAKQKVFDKEKPREEKQDTFTEKLVTQIIQNLQVQISSIHIRYEDDITNGDKPLSFGISLQNISLQTTDQYWIPCL--HDNTEKLVRKLIRLDNLFAYWNVNSEMFYLNDYDESLKA-LKNGIVNENIVPEGYDFVFRPISASAKLQMNRRSD-FDFSDPKINLAVDLHTIAIEFNKPQYFSLMELLESIDMMTQNQPYRKFKPSVPLHLHAKEWWAYAIHSILEVNVCPSLRMWSWEHIRNHRYKMKRYREFYKKKLTSKKPSPEILMSLEELEKTLDVFNITIARQQAEVEAKKAGYKIYKEGVKDPEDNAGWFGWLWTW---------SESNANQQQDVKPGILEEMLTPEEKSLLYEAIGYSETAVDPTLPKTFEALKFFVHLKSMSIVLRENHQKP-ELLNVVVEGLSTSVVQRPGAQAIKFETKIDSFHITGLPD-DFKKPHLLSSLDDT---SLLQITFEINPLNETVAQRCTIEAEPLEIIYDARTVNSIVEFFRPPKDVHLAQLTSVTLTKLEEFRAKTATGLLYVIETQKVLDLRINVKASYVIVPQYGNFSPTSNLLLLDLGHLKVSSKRRSL-------LPDVRPSEASLEDIMHRAYDSFDIQLTSIQLLYSRVGDNWKEARKLNVSTQHILIPMHVNVELSKAMVFMDIKMPKFKISGKLPLVSLRISDKKLQGIMELLGSIP-----KPEPVTDVSAPARSFQ-IQASALPVSHISQKLIPLLEQPVTEDDSEEEFFDAPC-------SPLEECPQVSCRDKCTRQKKLQKKDCVMNLIQLRMRFEVAEVSIQFYHLV--------GDCELPVLEMGALGLGTEAEFRTFDLKGSAFLKELWLKCPEYLD-ENKKPVYLITTLDNTM-EDLLTLEFMKVEKNAPNLNSTYNNVLQLIKVNFSSLDIHLHTEALLNTMNYLNNILPEL----REKSASVSAAEPED--------------------KGD--IIKKLALKLPTNEDIITLQLLAEL-----------SCLQIFI----------------------QDQKQNISEIKIEGLDSEMIMKPLVTEINAKLRNIIVLDSDKMAIYKKALYITGKE-VFSFKMISYMDATAGYAYT-DMSVVDIRVHLTVGCIEVVFITKFLYSILAFIDNFQAVKDALAEATVQAAEMAADGVKELARK--SSRFALDVNIKAPVVLIPQSPVSQNVFVADFGLITMKNIFVTVTETQSNIPPVIDLITIKLSKMRLYRSQFRNDTYQEVLDLLLPLNLEVIVERNLSWEWYKEVPCFNIKAQLKPMEFILSQEDLTTVFQTLHGNIWYGQDLSAPSSANKDPETMTSGVTSPPDHSPATVVTAAVVEVHPQASQAHTMLNVSFQTDYLTMALYSPGPDEASFTDVRDPSLELAEFKLENIISSLKIYTDDSTVFSFSVKNCILDDKRSHVMKATPRMIGLTVGFDKKDMVDIKYRKIK---TFVVTDAVVQEMYVCASVEFLMTVAHIFFDAYMTSTALETSVQT---------RTTREAPAQ-----ELGKWEMNILIKNPEIVFVADMTRNDAPALVITTQCEICCKGEPTSNTVTAAIKDLQVRACPFLPVKRKGKVTTVLQPCDLFYQATQLGRDPQMIDISVKSLTLKVSPVIINTIITITSALYTTKETVPEENTSN-----------IAHLWDKKDTKNLKMWFLEES-NESEKVVPTNEVMPGG---------------ETLNLRIDSIFIVLEAGIGHRTVPMLLAKACFSGESKNWLSLINLHCHLELEVHYYNEMFGVWEPLLEPLEIDQTDDFRPWNLGIKMKKKAKEAIVESDSEAENYKVPEYKTAISFYSRDQLNITLSKCGLVMLNNLVEAFTEAAT----GSSSVFLRDLAPFMIFNSLGLTV 1881          

HSP 2 Score: 538.495 bits (1386), Expect = 5.738e-153
Identity = 404/1141 (35.41%), Postives = 599/1141 (52.50%), Query Frame = 3
Query: 6747 YKLDINVPLALHNQLPIKISY----------------QSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG--WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQ-ELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWN-QIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKK----LMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVS-GSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--------LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITK 10070
            Y L +  P+ + N LP K++Y                 SQI++ ++    L L                 Y   +W     +    ++++ INF       +S +D+ +H+    GQ  V  +SPYWM+NKT   L YKA D    +H    T  VL                           +S Q                        N+  N N       K  L + DS  SD+FS+DTVGS G + CK   + Y+VGV INLSS  +T+IVTF+P+YMI N+S    Y   + E     W+ +   +++PFWP +    S ++  +VE  E    + +   + + IL++L  +  GI  EV + E + +I    Y +G A   LINH   D  + + Q +  + E  LP  + V Y W D    R+  W       + ++    D +    + +   Y VSF     RI+LFT D  V K    S   E  + E+ ++L  +G+SLV+N  +QE+AYI ITSS V W  + ++K R KP+ +  +E LE  F E+     T  + +E+ +V+++ + V L+       +++P    + R + P + ++Y TS HQ    ++IY+IQI NQ+    FP VF P  PPRSV +D+  KP  ++S V+  +G +   R KYF+VLIQEM L LD GFV ++ D V+   V    E   F KD +         S++       +  +F+ FHISPIK+HLS SLS      K +        +HS  LNL L+S+G  +TD+QDV+FKL +FE        +++ S +  HY  QA++QMYVL+LGLDVLGNPFG+IR  ++GVE  FYEP +GA+ GPEEFVEG+A G+K+L G AVGG AGA S+I   M KG+AA+T+D DYQ+KRRE + K+P  L  G+ +GGKGL+ GFV G+TG+VTKPI GA+K+G  GFFKGVGKGLVG VTRP  G++D ASS+F+GI+R  +T+ EV  +RPPRF  +DG+IR Y LR+  GN + +++ E         Y  HV   +K ++  +T + +  + +    G  + +WQ  +++    P I   +  +    KE+ + +F      K
Sbjct: 2096 YVLHLWPPILIRNLLPYKVAYYIEGIENTVVTLSEGHSSQIYNVEMDQAKLHLK-------------LLDYLNHDWKSEFYIRSSQQDINFINFTCLTEMEKSDLDIAIHMTYNTGQTVVAFHSPYWMVNKTNRMLQYKA-DGIHRKHPPNYTKPVL---------------------------FSFQP-----------------------NHFFNNN-------KVQLMVTDSELSDQFSIDTVGSHGAIRCKGLKMEYQVGVTINLSSFNITRIVTFIPFYMIKNKSK---YHISVAEEGSDKWLSLDLEQSIPFWPEN---ASNILLIQVERSEDPPKRIYFNKQDNCILLRLNNELGGIIAEVNLAEHSTVITFSDYHDGAATFLLINHTKSD-PVQYNQSSLGEIEDSLPPGKAVYYTWADPVGSRKLKWSCGQSYGEVTHK--DDMMTPISVGKKTIYLVSFFEGLQRIILFTEDPRVFKVTYESEKAELAELEVVLALQDVGISLVNNYTKQEVAYIGITSSDVVWEAKPKKKARWKPMSVKHTEKLEKEFREY-----TEASPLEDKVVELDNIPVRLTPSGNDMKILQPHVIPVRRNYLPALKVEYNTSAHQSSFRIQIYRIQIQNQIHGAIFPFVFYPIKPPRSVTMDSAPKPFTDVSIVMRSAGHSQISRIKYFKVLIQEMDLSLDLGFVYALADLVTKAEVTEKTEVEHFHKDVEAFEQEYEVVSSVDQ----SQVNLFEYFHISPIKLHLSVSLSSGRDEAKDSEQHGGLIPVHS--LNLLLKSIGATLTDVQDVVFKLAFFELNYQFHTTSELQSEVIRHYSKQAIKQMYVLILGLDVLGNPFGLIREFSEGVEAFFYEPYQGAIQGPEEFVEGMALGLKALVGGAVGGLAGAASKITSAMAKGVAAMTMDEDYQQKRREAMNKQPAGLREGITRGGKGLVSGFVSGITGIVTKPIKGAQKEGAAGFFKGVGKGLVGAVTRPTGGIIDMASSTFQGIKRATETS-EVESLRPPRFFNEDGVIRPYRLRDGSGNQM-LQVMENGR-FAKYKYFTHVMI-NKTDMFMITRRGVLFVTKG-TFGQLTCEWQYTFDEFTKEPFIVHGRR-LRIEAKERVKSVFHAKEFGK 3139          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Mouse
Match: Vps13a (vacuolar protein sorting 13A [Source:MGI Symbol;Acc:MGI:2444304])

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 575/2040 (28.19%), Postives = 998/2040 (48.92%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETK-DSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFF-KSVKMDSLAVYWNSNPKPFS-SENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQV--LRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIG--TTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTSV----VLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSN--FNEAINQVPSVPESKEEVKSRKILPKDDKSGSART---------ASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIR-NIKNDSSDFISIKFIQDKNSNSKLIVD--IAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTL--TAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPL---LEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIF---GAPYVVKNTCGKDV 6044
            MVFES+VVE++N++LGDYVV LD+SQL LG+  G   L+NL IKENA  + D+P KV+ GHI  L LKIPWK+LY++PV A L+ +++LI+P+S ++YDP KE   L ETKQ+EL RIE+ K K  D +K  E K D+F EKL  QI++NLQ+ IS+IHIRYED  T  ++  + GI+L N+S QT D      +   D+T +   K +++D+L  YWN N + F  ++   +LKA +KN I +         F+ +PIS SA + ++ + +  +F+ P+++L + L  I   FN+ QY  +   L+S+D       +RK++P+VP+  +   WW +  + ILE  V    RMWSW++I+ HR + + Y + +++KL  KK S     +++  E+ LD+ NIT+ RQQAE++  K       + ++   +     G  ++          S S A+   D     +    T EEK+ LY+AIGYSE   DP +P  + +LK  + L+ +  ++ +N  K  +L+ +V+  +S  V QR  A AI     +++  +TG    D   P L+S+   + L+    + FE NPL+++  Q+  I AEPLEIIYD+ TVN IV+F  PP+++ L ++++  L  +EE +  TATGL ++ + +   D+++++K SY I+P+ G ++    +LL+DLG + + S+R S+       L   +  + + + +   AYD F I L++IQ L    GD+W++ R    S  HIL P      L K ++  D  +PK  + G LP + + ISD+ LQ ++EL+  IP      P+PV    +  R +   Q    P  +++   +  L       DSE     +            ++  ++   +    +KK  K   + N+I L   F +    +Q    +        G  E+  L +  +G  T    + FD+   A++  L L  P+++D   K PV L  T  +T  ++LL +  + VEK +P+  + + N    ++  F S+++ LH EALL  +N++N+++P L     EK+ + S+   E+                    K D  I+  +  ++    +  T++L AE            S  +IFI                       ++  NI +I I G+ +++      TE++  + ++ + D   +A+YKK ++I   E +FS ++  +   T+   Y  D+S VD  V++ VG I+++F+  F+  I  F+++FQ     +A    + +E AA+ +  +  +  SSR  LD+N+KAPV+ IP++  S N  + D G +T KN F     T      V++   I LS +R+ RS    +T +    +L P+N+ + + RNLSW     +P  +I A++  +   +SQ D       L  N  + + ++   S  +  E + S    P D    +  T         AS     +   F+ ++L + L+    +   +     P   L + K EN+     ++ + +   S  + N  + D +    K    +I   +  D  D + IK+ + K   + ++ D  +  +Y+C  V++LM +   F  A                      R  R+ P        L  +E+++ +  PEI+ V DM   D+ A+++ T   +       S+ +   I D Q   CPF    RK     ++ P  +     +   +     ++++ L + ++P +I +I  I + L  T ++  E +T +           + + W+K++    +  F+ +   E EK+   N+ +  G               + + LR+  I ++LE+ +  + VPML+ +    G+ KN L+ I L   + + V Y+N+   VWEPL   LE+   +  R ++  I+        + + +   +   +     +I   SRD L +T+SK  L +L+NL +AF +A +       S+F    AP+++ N+ G  V
Sbjct:    1 MVFESVVVEVLNRFLGDYVVNLDESQLSLGIWKGAVALKNLVIKENALHELDVPFKVKVGHIGSLKLKIPWKNLYTQPVEAVLEEIFLLIVPSSRIQYDPIKEEKQLMETKQQELKRIEKAKQKVFDKEKPREEKQDTFTEKLVTQIIQNLQVQISSIHIRYEDDITNGDKPLSFGISLQNISLQTTDQYWIPCL--HDNTEKLVRKLIRLDNLFAYWNVNSEMFYLNDYDESLKA-LKNGIVNENIVPEGYDFVFRPISASAKLQMNRRSD-FDFSDPKINLAVDLHTIAIEFNKPQYFSLMELLESIDMMTQNQPYRKFKPSVPLHLHAKEWWAYAIHSILEVNVCPSLRMWSWEHIRNHRYKMKRYREFYKKKLTSKKPSPEILMSLEELEKTLDVFNITIARQQAEVEAKKAGYKIYKEGVKDPEDNAGWFGWLWTW---------SESNANQQQDVKPGILEEMLTPEEKSLLYEAIGYSETAVDPTLPKTFEALKFFVHLKSMSIVLRENHQKP-ELLNVVVEGLSTSVVQRPGAQAIKFETKIDSFHITGLPD-DFKKPHLLSSLDDTSLLQ---ITFEINPLNETVAQRCTIEAEPLEIIYDARTVNSIVEFFRPPKDVHLAQLTSVTLTKLEEFRAKTATGLLYVIETQKVLDLRINVKASYVIVPQYGNFSPTSNLLLLDLGHLKVSSKRRSL-------LPDVRPSEASLEDIMHRAYDSFDIQLTSIQLLYSRVGDNWKEARKLNVSTQHILIPMHVNVELSKAMVFMDIKMPKFKISGKLPLVSLRISDKKLQGIMELLGSIP-----KPEPVTDVSAPARSFQ-IQASALPVSHISQKLIPLLEQPVTEDDSEEEFFDAPC-------SPLEECPQVSCRDKCTRQKKLQKKDCVMNLIQLRMRFEVAEVSIQFYHLV--------GDCELPVLEMGALGLGTEAEFRTFDLKGSAFLKELWLKCPEYLD-ENKKPVYLITTLDNTM-EDLLTLEFMKVEKNAPNLNSTYNNVLQLIKVNFSSLDIHLHTEALLNTMNYLNNILPEL----REKSASVSAAEPED--------------------KGD--IIKKLALKLPTNEDIITLQLLAEL-----------SCLQIFI----------------------QDQKQNISEIKIEGLDSEMIMKPLVTEINAKLRNIIVLDSDKMAIYKKALYITGKE-VFSFKMISYMDATAGYAYT-DMSVVDIRVHLTVGCIEVVFITKFLYSILAFIDNFQAVKDALAEATVQAAEMAADGVKELARK--SSRFALDVNIKAPVVLIPQSPVSQNVFVADFGLITMKNIFVTVTETQSNIPPVIDLITIKLSKMRLYRSQFRNDTYQEVLDLLLPLNLEVIVERNLSWEWYKEVPCFNIKAQLKPMEFILSQEDLTTVFQTLHGNIWYGQDLSAPSSANKDPETMTSGVTSPPDHSPATVVTAAVVEVHPQASQAHTMLNVSFQTDYLTMALYSPGPDEASFTDVRDPSLELAEFKLENIISSLKIYTDDSTVFSFSVKNCILDDKRSHVMKATPRMIGLTVGFDKKDMVDIKYRKIK---TFVVTDAVVQEMYVCASVEFLMTVAHIFFDAYMTSTALETSVQT---------RTTREAPAQ-----ELGKWEMNILIKNPEIVFVADMTRNDAPALVITTQCEICCKGEPTSNTVTAAIKDLQVRACPFLPVKRKGKVTTVLQPCDLFYQATQLGRDPQMIDISVKSLTLKVSPVIINTIITITSALYTTKETVPEENTSN-----------IAHLWDKKDTKNLKMWFLEES-NESEKVVPTNEVMPGG---------------ETLNLRIDSIFIVLEAGIGHRTVPMLLAKACFSGESKNWLSLINLHCHLELEVHYYNEMFGVWEPLLEPLEIDQTDDFRPWNLGIKMKKKAKEAIVESDSEAENYKVPEYKTAISFYSRDQLNITLSKCGLVMLNNLVEAFTEAAT----GSSSVFLRDLAPFMIFNSLGLTV 1881          

HSP 2 Score: 103.605 bits (257), Expect = 5.697e-21
Identity = 82/290 (28.28%), Postives = 118/290 (40.69%), Query Frame = 3
Query: 6747 YKLDINVPLALHNQLPIKISY----------------QSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQS 7568
            Y L +  P+ + N LP K++Y                 SQI++ ++    L L                 Y   +W     +    ++++ INF       +S +D+ +H+    GQ  V  +SPYWM+NKT   L YKA D    +H    T  VL                           +S Q                        N+  N N       K  L + DS  SD+FS+DTVGS G + CK   + Y+VGV INLSS  +T+IVTF+P+YMI N+S
Sbjct: 2096 YVLHLWPPILIRNLLPYKVAYYIEGIENTVVTLSEGHSSQIYNVEMDQAKLHLK-------------LLDYLNHDWKSEFYIRSSQQDINFINFTCLTEMEKSDLDIAIHMTYNTGQTVVAFHSPYWMVNKTNRMLQYKA-DGIHRKHPPNYTKPVL---------------------------FSFQP-----------------------NHFFNNN-------KVQLMVTDSELSDQFSIDTVGSHGAIRCKGLKMEYQVGVTINLSSFNITRIVTFIPFYMIKNKS 2314          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Mouse
Match: Vps13c (vacuolar protein sorting 13C [Source:MGI Symbol;Acc:MGI:2444207])

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 485/1681 (28.85%), Postives = 818/1681 (48.66%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEE--------------------------------------------NKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQ-TAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSE--TASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQV----PSVPESKEEVKSRKI-LPKDDKSGSARTASD-------ESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIK-NDSSDFISIKFIQDK-------------NSNSKLIVDIAGIYMCICVDYLMMLTDFF 4835
            MV ES+V +L+N++LGDYV  L+KSQLKLG+ GGN  L+NL IKENA  + D+P KV+ G I KLTLKIPWK+LY E V+A L+GLY+L++P + +KYD EKE   L + KQKEL RIEE                                              L R+  K +   KD+F EKLA Q++KN+Q+ I++IHI+YED  T P R  + G+TL   S  T +   T  I+ E + +  +K VK+DSL+ YWN         +R  +   +K  I +S     D  ++ QPIS SA ++++   E+     P++  +++++ I     + QY  +  FL+S+D       +RKY+P +P+ +N   WW +  + +LE  +RR  + WSW  I+ HR   + Y   ++ KL   K+S+  Q  I+  E+ LD+ NI L RQQA+++V       + K       +   SG W      K D E+S     +  D+L        T EEK KL+ AIGYSE   +  +P +YV+  L L+L     II +N     +++++ I  +   V QR  A A+ +   + +  VTG +  D  VP+LV++   +   +LL ++FETNP +  A+Q + ++++P+E+IYD+ T+N +V+F    + L L +I++  L  +EE+KE TATGL H+ + R   D+++++KPSY I+P+ G + +   +L++D G+  + S+      + +  L          + + + AYDKF + + ++Q L  +  ++W+K R Q  S  HIL+P      L K ++  D  + K  V G LP + V ISD+ ++  L LI  IP PQ ++ P P     SI        L    K  L ++ +L  +    D E   A    +      +  E K A E+ +                  ++ L   F I    L++ +  K         + I+   V ++GT  T++ FD+   +Y+  + L     +  S K P+ L  +     G +LL +  + V++  P F T    T   ++  F S+ + L  +ALL  LN++ ++IP                      + T + KE +A+ + ++      +M                       S  SD  G+    ++F            A L    V V +EK +NI +I I G+ + +        +   + ++ + D  P  ++KK + I  +E +F   + L+   T    Y  D+S VD +V + VG I+I++L+ F++ + +FLN+FQ + + ++    + +E AA  + ++ +   S R  +DI++KAPVI IP++S S NA++VDLG +   N F++    D +   V+++ ++ L+ L++SR+ +   T   +  +LHPIN+   ++RNL+ N  H +P + I  R+ S++V ++Q D N+   +L  N  EA   +    P + E  E    R++  P+D  +     A+        + I V   F+++ + V L K          E         +K  +L +E  +  +  M  +  L NI++       +K   E +R +  +D SD I +K +  K             N+  KL V  + + + + ++ L+ L DF 
Sbjct:    1 MVLESVVADLLNRFLGDYVENLNKSQLKLGIWGGNVALDNLQIKENALSELDVPFKVKAGQIDKLTLKIPWKNLYGEAVVATLEGLYLLVVPGASIKYDAEKEEKSLQDIKQKELCRIEEALQKAAEKGAHSGEFMYGLENLLYKDVKPGRKRKKHKKHFKKRFKGLDRSKDKPKEAKKDTFLEKLATQVIKNVQVKITDIHIKYEDDITDPERPLSFGVTLREFSLLTTNEHWTPCILNE-AEKIIYKLVKLDSLSAYWNVGCCMSYRGSREHILEQLKREILTSTNIPPDHQYIFQPISASAKLYMNPGAES-ELKTPKLDGNVEVQNIAIELTKPQYLSMIDFLESLDYMVRNAPYRKYKPCLPLHTNCRQWWKYAIDSVLEVHIRRYTQPWSWSNIKNHRQLLKSYKMAYKTKLTQAKVSEEIQKQIQDLEKSLDVFNIILVRQQAQVEVIHSGQKLRKKSAEAGEKRGWFSGFWGKKESKKRDEESS---VPETIDDL-------MTPEEKDKLFTAIGYSENAYNLALPKQYVAHILTLKLVSTSIIIRENR-NVPEILRVQIIGLGTQVSQRPGAQALKIEAKLEHWYVTGLRQQD-IVPSLVASIGDTT-SSLLKIEFETNPENSPADQTLIVQSQPVEVIYDAKTINAVVEFFQSNKGLDLEQITSATLMKLEEIKERTATGLTHIIETRKVLDLRINLKPSYLIIPQTGFHHEKSNLLILDFGTFQLNSKDQGAQKTANASL----------EEIIDKAYDKFDVEIRSVQLLFAKAEENWKKCRFQHPSTMHILQPMDIHVELAKAMVEKDVRMAKFKVSGGLPLMHVRISDQKIKDALCLINSIPLPQKSSTPSPERQVASI------PVLSGGTKALLGTSLLLDGVESESDEEFFDAEDGDSQAARTVKASELKKAAEVPNE----------------ELVSLLLKFEIKEVVLELTKQQKE-------EETILVFNVTQLGTEATMRTFDLTAVSYLRKISLDYHD-IKGSRKKPIHLISSSDRP-GLDLLKVEYIKVDRNGPSFQTTFEKTEQTVKVAFSSLNLLLQTQALLSSLNYLTTVIP-------------------SDSQNTGVAKEVQAMPEKQKNSPLQKVM---------------------VPSRDSDVIGF----RLF------------AKLNAFCVTVCDEK-SNIAEIKIQGLDSSLSLQSKKQSLFARLENIIVTDVDPKTIHKKAVSIVGNE-VFRFNLDLYPDATEGDSYT-DMSTVDGVVALHVGCIQIVYLHKFLMSLLSFLNNFQVAKEALSAATAQAAEKAATSVKDLAQR--SFRVSVDIDLKAPVIVIPQSSLSTNAVVVDLGLIRVHNRFSLVSGEDTANPPVIDKMEVQLTKLKLSRTAIQPGTSHPDIQLLHPINLEFFVSRNLAANWYHKVPVVEIKGRLDSMNVSLNQEDLNLLFRILAENLGEATEDLDKGKPRIQERGETKACREVSTPQDVHTTQGVPAARVEETRPVDIINVLLNFEIKEVVVTLMKKAERKGSPFHE---------LKILHLGMEAKVKAHD-MTAAAYLRNISMRCFHFPDSK--GEPLRIVNTSDVSDGILLKLLFIKADSDGPDFKTIHDNTKQKLKVSFSSLDLVLHLEALLSLMDFL 1552          

HSP 2 Score: 558.14 bits (1437), Expect = 8.443e-159
Identity = 390/950 (41.05%), Postives = 574/950 (60.42%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG-----WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFY--ESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDF-YINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEG-LEVDLSKKLMIK--PEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEA------MFVKDCQMIRASLIETS-TIKTILSGGKKCVFDNFHISPIKIHLSFSL------SRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCK-SKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINES------KHTIVFTLKEKQ-----RKLFSKDNITKEIEADLI 10091
            K   F+K  K  LKI+ S WS+ FSLDTVGS G V C    + Y VGV I +SS  L+++VT  P+  + N+SS+ L   E+  +       W  V   E +PFWP +  GK  +     E      ++PF FY  + +  L+ LE    GI V++   E + +I    Y EG A   ++NH   DV + +KQ  + +EL+L   +T ++AW D    R+  W    +  +H  +L  D    F Y   ++ +WVSF+    R+LLFT+D+ +   A  + ++E  D E+ +SLHS+GLSLV+N  +QE++Y+ ITSSGV W +++ K + KP    Q  +LE A+ +   RL    A  +   VK++   EV+  K  M    P +C + R F  G+ ++++ SPHQ  +  R+Y +Q+DNQ+    FPVVF P  PP+S+ALD+  KP I++S +   +  +  +++KYF VLIQEM L +DQGF+ +++   +   PT D EA      +  +D   +   L+E+S T  +ILS      F++FHISP+K+HLS SL      S   +    A+HS  +NL L+S+G  +TD+ D+IFKL Y+E +      +Q++ S+  HY  Q L+QMYVLVLGLDVLGNPFG+IRG+++GVE LFYEP +GAV GPEEF EG+  GV+SL GH VGGAAG VSRI G++GKG+AA+T+D +YQ+KRRE++ ++P++ G  LA+GGKG + G V GVTG++TKP++GAKK+G  GFFKG+GKGLVG V RP  G++D ASS+F+GI+RVA++  EV  +RPPR I +DGIIR Y  +E+EG+++     +K +    E Y FH     +K+ V+ +TN+R   +   EILG  S+ WQ  +E    PP ++E+      K   +F  K+       RK++ KD IT +   D I
Sbjct: 2802 KKNIFSKN-KVQLKISTSAWSNGFSLDTVGSYGCVKCPATNMEYLVGVSIKMSSFNLSRVVTLTPFCTVANKSSLDLEVGEIASDGSIPTNKWHYVASSECIPFWPENLSGKLCVRVVGYEGS----SKPF-FYNRQDNGTLLSLEDLNGGILVDINTAEHSTVITFSDYHEGSAPALIMNHTQWDV-LTYKQSGSQEELVLLPGETRLFAWADPTGIRKLTWNYAANFGEH--DLLKDECGQFPYDANIQIHWVSFLDGRQRVLLFTDDVALVSKALQAEEMEQADHEVALSLHSLGLSLVNNENKQEVSYVGITSSGVVW-EMKPKQKWKPFSQKQIMSLEQAYSK---RL----ASQDRGWVKLDSNFEVNFDKVPMEMRLPIRCPIKRDFLSGIQVEFKQSPHQRSLRARLYWLQVDNQLPGTMFPVVFHPVAPPKSIALDSEPKPFIDVSVITRFNEYSKVLQFKYFMVLIQEMALKVDQGFLGAVISLFT---PTTDPEAERKRTKLIQQDIDALNTELMESSMTDMSILS-----FFEHFHISPVKLHLSLSLGSGGEESDKEKQEMIAIHS--VNLLLKSIGATLTDVDDLIFKLAYYEIRYQFYKRDQLMWSVVRHYSEQFLKQMYVLVLGLDVLGNPFGLIRGLSEGVEALFYEPFQGAVQGPEEFAEGLVIGVRSLVGHTVGGAAGVVSRITGSVGKGLAAITMDKEYQQKRREEMGRQPKDFGDSLARGGKGFLRGVVGGVTGIITKPVEGAKKEGAAGFFKGIGKGLVGAVARPTGGIIDMASSTFQGIQRVAESTEEVSSLRPPRLIHEDGIIRPYDRQESEGSDLLENHIKKLE---GEAYQFHCAVPGNKRAVLMITNRRALFIKEVEILGHMSVDWQCLFEDFVCPPEVSENLLKISVKEQGLFHKKDSANIGHLRKIYLKDPITAKRAFDAI 3721          

HSP 3 Score: 346.28 bits (887), Expect = 1.983e-94
Identity = 351/1480 (23.72%), Postives = 664/1480 (44.86%), Query Frame = 3
Query: 2853 IVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTS--PDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTSVVL----EESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSG----------SARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELI--RNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXM-VPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQ-IYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFE--IEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDA------YSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADS--ISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKC---YNVPIPTLLTSNGKIYIS-VKQLNTEISNSGAL--WNIGKNAQPSDTQILLCKS---NTGVMYYYSVALSIEEVQIVNSSETLR-TYKLDINVPLALHNQLPIKISY--QSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAV 7166
            I+H +G    +K  DM   AY+ ++ +    F D S   P+ +  T   + G   + + LL ++  S  PDF T+H NT+ KL+  F S+++ LH EALL +++F++S                       +   ++ EKE E    LK                 L  E R++ ++A   S + D   +D                ITA L    + + ++K +NI +I IHGM A +      T+V   + ++ + +   L+++KK + I  DE +F  Q++L+   T    Y  D+S+VD  ++++VG I+I++++ F + + +FLN+FQ + + ++    + +E AA+ + ++ ++  S R  +DI++KAPVI IP++S S N ++ DLG +  +N F++     + L    +E  I L+ L+++R++L  ++ +++  IL P+N+ + + RNLS      IP + I   +  + V +SQ D  +   +L  N  EA +Q PS  +  +E    K   +D +SG            +   D+++T+QF F  + L + L+  D++     S       L ++    ++  G M  + +M VS++L    + D +    +  + +I  +N ++++S  I I + QDKN  S++   +  +Y+C  V++LM + DFF+KA P   +   K + +P R       K  K     P      +  +   +  PE++ V  +   D+ A+       L  S  K   ++   + D + + CPF  E R K+   ++ P S+ +      +     ++ ++  +I I+P ++ ++  IM  ++ +      T++  + +   +   DN W  +   +    F+               GV+   +V +   D E    ++   + +  ++V LE  +  + VP+L+ E    G++KN  + +     +++ V Y+N+   VWEPL+E    E N+ +S +  ++     D  L   +DF     I     ++ + S   + +T+SKS L+V SNL K F +       YSL          AP+ VKN  G  V   +    +LK   S E+  +Y    G+    D    + S     +Q K+      +S   +  ++    TEV ++  +       +  N S    ++++V   A  G K + LRS LQ+ N+      +Y            KN  LLE +   +    ++VP+ +      ++Y+     L  + ++S     W    +       +L C +   +   +   +VAL  E   I    E     Y + +  PL L N LP  + Y  +    +H++  G    V  + +  +    V   Y  K W G   +   + E  ++ F +      + +DL VH+     +  ++++SPYW++NKT   L Y++ ++  V+H A   D +
Sbjct: 1452 ILH-LGMEAKVKAHDMTAAAYLRNISMRCFHFPD-SKGEPLRIVNTSDVSDG---ILLKLLFIKADSDGPDFKTIHDNTKQKLKVSFSSLDLVLHLEALLSLMDFLSS--------------------AIPSSDSSSSEKEPE----LK----------------PLVGESRSLAIRAVPSSYEGD--AFD--------------LKITAELNAFNIFICDQK-SNIAEIKIHGMDASISVKPKQTDVFARLKNIIVMNVDSLSIHKKAVSILGDE-VFRFQMSLYPDATEGENYG-DMSKVDGRLSLKVGCIQIVYVHKFFMSLLSFLNNFQAAKEALSTATVQAAERAASSVKDLAQK--SFRLLMDIDLKAPVITIPQSSVSPNVVIADLGLIRVENKFSLVSVEQLALPPVADEMSIQLTQLKLARTVLQADSPQHDVEILKPVNMLLCIQRNLSAAWYTQIPGMEIKGELKPMQVALSQDDLTVLMKILLENLGEASSQ-PSPTQYAQEAARVK---RDTRSGPDYLKEQELADPKPPGDQTVTLQFDFHFDSLSIILYNSDSSQEPRLSFHNDSFRLGELTLHLMASAGKMFKDGSMNVSLKLKTCTLDDLREGIERATSRMIDKKNDQDNNSSMIDISYSQDKN-GSQVDAVLDKLYVCASVEFLMTVADFFIKAMPQSPENIAKEIQIPSRQTAAGRVKMEKDDSVRP------NMTLKAMITDPEVVFVASLTKADAPALTASFQCNLSLSTSKLEQMMEASVRDLKVLACPFLRERRGKSITTVLQPCSLFMEKCTWASGKQNINIVVKEFVIKISPIILNTVMTIMAAMSPK------TKEDEWKDTPKE--TDNLWAVKSITDYNSWFL---------------GVDMATEVTENFRDSEHPSIEENCVVAVESVQVTLECGLGHRTVPLLLAESKFSGNIKNWTSLMAAAADMTLEVHYYNETHAVWEPLIERV--EGNKPWSLKLNVKKNPIQDKSLMPGDDF-----IPEPQTAVHISSGATMNITISKSCLNVFSNLAKGFSEGAASTFDYSLKDR-------APFTVKNALG--VPMKVQPNRNLKVMGSPEKSDIYDVGAGQHLELDYASLEPS-----RQGKLSILSRQESSLFTLTFVPYGYTEVASVPVARPGRRLYNVRNPSASHSDSVLVQIDATEGNKVVTLRSPLQIKNHFSIAFIIYKF---------VKNVKLLERIGIARPEEEFHVPLDSY---RCQLYVQPAGGLEQQYTHSSTYISWKEELHRSREVRCMLQCPAVEVSFLPLIVNTVALPDELSYIGAHGEDWDPAYVIHLYPPLTLRNLLPYSLRYLLEGTAETHELAEGSSADVLHSRISGEIIELVLVKYLGKNWNGHFRICDTLPEFFLVCFSSDTAEVMT-VDLSVHVRRIGCRMELSVFSPYWLINKTSRVLQYRS-EEIHVKHPADFRDII 2796          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Mouse
Match: Vps13a (vacuolar protein sorting 13A [Source:MGI Symbol;Acc:MGI:2444304])

HSP 1 Score: 504.597 bits (1298), Expect = 2.896e-154
Identity = 364/925 (39.35%), Postives = 518/925 (56.00%), Query Frame = 3
Query: 7068 SPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQ-ELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWN-QIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKK----LMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVS-GSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--------LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNI 9797
            SPYWM+NKT   L YKA D    +H    T  VL                           +S Q                        N+  N N       K  L + DS  SD+FS+DTVGS G + CK   + Y+VGV INLSS  +T+IVTF+P+YMI N+S   +   E   +  W+ +   +++PFWP +    S ++  +VE  E    + +   + + IL++L  +  GI  EV + E + +I    Y +G A   LINH   D  + + Q +  + E  LP  + V Y W D    R+  W       + ++    D +    + +   Y VSF     RI+LFT D  V K    S   E  + E+ ++L  +G+SLV+N  +QE+AYI ITSS V W  + ++K R KP+ +  +E LE  F E+     T  + +E+ +V+++ + V L+       +++P    + R + P + ++Y TS HQ    ++IY+IQI NQ+    FP VF P  PPRSV +D+  KP  ++S V+  +G +   R KYF+VLIQEM L LD GFV ++ D V+   V    E   F KD +         S++       +  +F+ FHISPIK+HLS SLS      K +        +HS  LNL L+S+G  +TD+QDV+FKL +FE        +++ S +  HY  QA++QMYVL+LGLDVLGNPFG+IR  ++GVE  FYEP +GA+ GPEEFVEG+A G+K+L G AVGG AGA S+I   M KG+AA+T+D DYQ+KRRE + K+P  L  G+ +GGKGL+ GFV G+TG+VTKPI GA+K+G  GFFKGVGKGLVG VTRP  G++D ASS+F+GI+R  +T+ EV  +RPPRF  +DG+IR Y LR+  GN +
Sbjct:    2 SPYWMVNKTNRMLQYKA-DGIHRKHPPNYTKPVL---------------------------FSFQP-----------------------NHFFNNN-------KVQLMVTDSELSDQFSIDTVGSHGAIRCKGLKMEYQVGVTINLSSFNITRIVTFIPFYMIKNKSKYHISVAEEGSDK-WLSLDLEQSIPFWPEN---ASNILLIQVERSEDPPKRIYFNKQDNCILLRLNNELGGIIAEVNLAEHSTVITFSDYHDGAATFLLINHTKSD-PVQYNQSSLGEIEDSLPPGKAVYYTWADPVGSRKLKWSCGQSYGEVTHK--DDMMTPISVGKKTIYLVSFFEGLQRIILFTEDPRVFKVTYESEKAELAELEVVLALQDVGISLVNNYTKQEVAYIGITSSDVVWEAKPKKKARWKPMSVKHTEKLEKEFREY-----TEASPLEDKVVELDNIPVRLTPSGNDMKILQPHVIPVRRNYLPALKVEYNTSAHQSSFRIQIYRIQIQNQIHGAIFPFVFYPIKPPRSVTMDSAPKPFTDVSIVMRSAGHSQISRIKYFKVLIQEMDLSLDLGFVYALADLVTKAEVTEKTEVEHFHKDVEAFEQEYEVVSSVDQ----SQVNLFEYFHISPIKLHLSVSLSSGRDEAKDSEQHGGLIPVHS--LNLLLKSIGATLTDVQDVVFKLAFFELNYQFHTTSELQSEVIRHYSKQAIKQMYVLILGLDVLGNPFGLIREFSEGVEAFFYEPYQGAIQGPEEFVEGMALGLKALVGGAVGGLAGAASKITSAMAKGVAAMTMDEDYQQKRREAMNKQPAGLREGITRGGKGLVSGFVSGITGIVTKPIKGAQKEGAAGFFKGVGKGLVGAVTRPTGGIIDMASSTFQGIKRATETS-EVESLRPPRFFNEDGVIRPYRLRDGSGNQM 849          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Mouse
Match: Vps13c (vacuolar protein sorting 13C [Source:MGI Symbol;Acc:MGI:2444207])

HSP 1 Score: 461.455 bits (1186), Expect = 1.219e-140
Identity = 326/772 (42.23%), Postives = 483/772 (62.56%), Query Frame = 3
Query: 7554 ILNQSSIVLYCNELVENAG-----WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFY--ESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDF-YINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEG-LEVDLSKKLMIK--PEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEA------MFVKDCQMIRASLIETS-TIKTILSGGKKCVFDNFHISPIKIHLSFSL------SRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNI 9797
            + N+SS+ L   E+  +       W  V   E +PFWP +  GK  +     E      ++PF FY  + +  L+ LE    GI V++   E + +I    Y EG A   ++NH   DV + +KQ  + +EL+L   +T ++AW D    R+  W    +  +H  +L  D    F Y   ++ +WVSF+    R+LLFT+D+ +   A  + ++E  D E+ +SLHS+GLSLV+N  +QE++Y+ ITSSGV W +++ K + KP    Q  +LE A+ +   RL    A  +   VK++   EV+  K  M    P +C + R F  G+ ++++ SPHQ  +  R+Y +Q+DNQ+    FPVVF P  PP+S+ALD+  KP I++S +   +  +  +++KYF VLIQEM L +DQGF+ +++   +   PT D EA      +  +D   +   L+E+S T  +ILS      F++FHISP+K+HLS SL      S   +    A+HS  +NL L+S+G  +TD+ D+IFKL Y+E +      +Q++ S+  HY  Q L+QMYVLVLGLDVLGNPFG+IRG+++GVE LFYEP +GAV GPEEF EG+  GV+SL GH VGGAAG VSRI G++GKG+AA+T+D +YQ+KRRE++ ++P++ G  LA+GGKG + G V GVTG++TKP++GAKK+G  GFFKG+GKGLVG V RP  G++D ASS+F+GI+RVA++  EV  +RPPR I +DGIIR Y  +E+EG+++
Sbjct:    3 VANKSSLDLEVGEIASDGSIPTNKWHYVASSECIPFWPENLSGKLCVRVVGYEGS----SKPF-FYNRQDNGTLLSLEDLNGGILVDINTAEHSTVITFSDYHEGSAPALIMNHTQWDV-LTYKQSGSQEELVLLPGETRLFAWADPTGIRKLTWNYAANFGEH--DLLKDECGQFPYDANIQIHWVSFLDGRQRVLLFTDDVALVSKALQAEEMEQADHEVALSLHSLGLSLVNNENKQEVSYVGITSSGVVW-EMKPKQKWKPFSQKQIMSLEQAYSK---RL----ASQDRGWVKLDSNFEVNFDKVPMEMRLPIRCPIKRDFLSGIQVEFKQSPHQRSLRARLYWLQVDNQLPGTMFPVVFHPVAPPKSIALDSEPKPFIDVSVITRFNEYSKVLQFKYFMVLIQEMALKVDQGFLGAVISLFT---PTTDPEAERKRTKLIQQDIDALNTELMESSMTDMSILS-----FFEHFHISPVKLHLSLSLGSGGEESDKEKQEMIAIHS--VNLLLKSIGATLTDVDDLIFKLAYYEIRYQFYKRDQLMWSVVRHYSEQFLKQMYVLVLGLDVLGNPFGLIRGLSEGVEALFYEPFQGAVQGPEEFAEGLVIGVRSLVGHTVGGAAGVVSRITGSVGKGLAAITMDKEYQQKRREEMGRQPKDFGDSLARGGKGFLRGVVGGVTGIITKPVEGAKKEGAAGFFKGIGKGLVGAVARPTGGIIDMASSTFQGIQRVAESTEEVSSLRPPRLIHEDGIIRPYDRQESEGSDL 748          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. UniProt/SwissProt
Match: sp|Q96RL7|VP13A_HUMAN (Vacuolar protein sorting-associated protein 13A OS=Homo sapiens OX=9606 GN=VPS13A PE=1 SV=2)

HSP 1 Score: 1219.91 bits (3155), Expect = 0.000e+0
Identity = 1025/3433 (29.86%), Postives = 1663/3433 (48.44%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKE-TETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFF-KSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSS-------SLASDGSDELQKKVRSE-----FTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGS-VPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSE-RTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQ-----TAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSN--FNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDE-----------SITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELI--RNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLE---VYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFS--PKDNEGPSRGNVSEREIN---TLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPT-----LLTSNGKIYISVKQLNTE--ISNSGALWNIG-KNAQPSDTQILLC----KSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISY-----QSQIFSHDIKPGCLELVRTACL-KVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFY---ESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQ-ELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSN-NLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKW-NQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVE-GLEVDLSKK----LMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEA-MFVKDCQMIR-----ASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--------LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLF 10049
            MVFES+VV+++N++LGDYVV LD SQL LG+  G   L+NL IKENA    D+P KV+ GHI  L L IPWK+LY++PV A L+ +Y+LI+P+S +KYDP KE   L E KQ+EL RIEE K K  D ++   E +D+F EKL  QI+KNLQ+ IS+IHIRYED  T  ++  + GI+L NLS QT D      +   D T +   K +++D+L  YWN   + F   +       +KN I +         F+ +PIS +A + ++ + +  +F+ P+++L+++L  I   FN+ QY  I   L+S+D       +RK++P+VP+  +   WW +  + +LE  V  R  MWSWK+I+ HR + + Y +++++KL  KK       +++  E+ LD+ NIT+ RQ AE++                        G+     G  D E +        S +   ++E Q  V+ E      T EEKA LY+AIGYSE   DP +   + +LK  + L+ +  ++ +N  K  +L+ +VI   S  + QR  A AI     +++  +TG   PD S  P L+S+   +  M+L  + FE NPLD++ +Q+  I AEPLEIIYD+ TVN IV+F  PP+E+ L +++   L  +EE +  TATGL ++ + +   D+K+++K SY I+P+ G ++    +LL+DLG + + S+ R+ +P          K G+ N   + + AYD F I L+++Q L    GD+WR+ R    S  HIL P  F   L K ++  D  +PK  + G LP + + ISD+ LQ ++ELI  IP P+     +AP K      S     S     I P L L S     +     D+  + L   +             L+  D +V              NM      F +    ++    + +  +       +V+++V  +G  + ++ +D+   A++    L  P+++D   K PV L  T  +T  ++LL +  +  EK  PD  + + N    ++  F S+++ LH EALL  +N++++++P      EEK+   S+         T  E + + I+ L                + L+T +  + L+                              I A L  L++ + ++K  NI +I I G+ +++      TE++  + ++ + D    A+YKK ++I   E +FS ++  +   T+   Y  D++ VD  VN+ VG I+++F+  F+  I  F+++FQ + Q +A    + +  AA  +  + +   SSR  LDIN+KAPV+ IP++  S N  + D G +T  N F +      S   V++   I LS +R+ RS  + +  +    +L P+N+ + + RNL W     +P  ++ A++  +   +SQ D       L  N  + +  +  P+V + +    S         SG A   +               T+   FK + L + L+        +     P   L + K EN+     M+ + +   S  L N  +LD +    KK    +    +  D  D + IK+ + ++      V    +Y+C  V++L  + + F++A                  E + + +  K      E     +EI+V +  PEI+ V DM   D+ A+++ T   + Y    E+  +   I D Q   CPF    RK     ++ P  +     +   +     ++++ L + ++P +I ++  I + L   +T ET       I  +      + WEK++    +  F+ +   E EKI    + V  G               + I + +  I ++LE+ +  + VPML+ +    G+ KN  + I L   + + V Y+N+   VWEPLLE   +   E  R ++  I+        + + +  E+   +      I   S+D L +T+SK  L +L+NL KAF +A +           AP+++ N+ G  +    +  F +         K Y+  +GE    D +  K +            F    S+S +   I  T V        P    G     V  RE     +++       G K++ +RS +Q+ N+    +++Y            +   LL        +N+P+ +      L    + Y   + ++ E  I N GAL     ++  PS    L+     K N   +  YS                   Y + +  P+ L N LP KI+Y     ++ +F+  +  G    + TA L K + ++K+   Y   +W     + P  +++S ++F       ++ +D+ VH+    GQ  V  +SPYWM+N        K G   Q + D                           I +K    Y    L + +                  N+  N N       K  L + DS  S++FS+DTVGS G V CK   + Y+VGV I+LSS  +T+IVTF P+YMI N+S   +   E   N  W+ +   + +PFWP     K ++   + ED       P   Y   + + IL++L+ +  GI  EV + E + +I    Y +G A   LINH  +++ + + Q +  + E  LP  + V Y W D    R   WR    +K H       D +    + E   Y VSF     RI+LFT D  V K    S   E  +QEI ++L  +G+SLV+N  +QE+AYI ITSS V W  + ++K R KP+ +  +E LE  F E+     T  +  E+ +++++  + V L+       +++P    L R + P + ++Y TS HQ    ++IY+IQI NQ+    FP VF P  PP+SV +D+  KP  ++S V+  +G +   R KYF+VLIQEM L LD GF+ ++ D ++ +  T + E  +F KD +  +     ASL++ S +          +++ FHISPIK+HLS SLS      K +        +HS  LNL L+S+G  +TD+QDV+FKL +FE        + + S +  HY  QA++QMYVL+LGLDVLGNPFG+IR  ++GVE  FYEP +GA+ GPEEFVEG+A G+K+L G AVGG AGA S+I G M KG+AA+T+D DYQ+KRRE + K+P     G+ +GGKGL+ GFV G+TG+VTKPI GA+K G  GFFKGVGKGLVG V RP  G++D ASS+F+GI+R  +T+ EV  +RPPRF  +DG+IR Y LR+  GN + +++ E         Y  HV   +K +++ +T + +  + +    G  + +WQ ++++    P I   +  +    KE+ + +F
Sbjct:    1 MVFESVVVDVLNRFLGDYVVDLDTSQLSLGIWKGAVALKNLQIKENALSQLDVPFKVKVGHIGNLKLIIPWKNLYTQPVEAVLEEIYLLIVPSSRIKYDPLKEEKQLMEAKQQELKRIEEAKQKVVDQEQHLPEKQDTFAEKLVTQIIKNLQVKISSIHIRYEDDITNRDKPLSFGISLQNLSMQTTDQYWVPCL--HDETEKLVRKLIRLDNLFAYWNVKSQMFYLSDYDNSLDDLKNGIVNENIVPEGYDFVFRPISANAKLVMNRRSDF-DFSAPKINLEIELHNIAIEFNKPQYFSIMELLESVDMMAQNLPYRKFKPDVPLHHHAREWWAYAIHGVLEVNVCPRLWMWSWKHIRKHRQKVKQYKELYKKKLTSKKPPGELLVSLEELEKTLDVFNITIARQTAEVE--------------------VKKAGYKIYKEGVKDPEDNKGWFSWLWSWSEQNTNEQQPDVQPETLEEMLTPEEKALLYEAIGYSETAVDPTLLKTFEALKFFVHLKSMSIVLRENHQKP-ELVDIVIEEFSTLIVQRPGAQAIKFETKIDSFHITGL--PDNSEKPRLLSSLDDA--MSLFQITFEINPLDETVSQRCIIEAEPLEIIYDARTVNSIVEFFRPPKEVHLAQLTAATLTKLEEFRSKTATGLLYIIETQKVLDLKINLKASYIIVPQDGIFSPTSNLLLLDLGHLKVTSKSRSELPDV--------KQGEANLKEIMDRAYDSFDIQLTSVQLLYSRVGDNWREARKLSVSTQHILVPMHFNLELSKAMVFMDVRMPKFKIYGKLPLISLRISDKKLQGIMELIESIPKPEPVTEVSAPVKSFQIQTSTSLGTSQISQKIIPLLELPSVSEDDSEEEFFDAPCSPLEEPLQFPTGVKSIRTRKLQKQDCSV--------------NMTTFKIRFEVPKVLIEFYHLVGDCELS------VVEILVLGLGAEIEIRTYDLKANAFLKEFCLKCPEYLD-ENKKPVYLVTTLDNTM-EDLLTLEYVKAEKNVPDLKSTYNNVLQLIKVNFSSLDIHLHTEALLNTINYLHNILPQ----SEEKSAPVST---------TETEDKGDVIKKLA---------------LKLSTNEDIITLQ------------------------------ILAELSCLQIFIQDQK-CNISEIKIEGLDSEMIMRPSETEINAKLRNIIVLDSDITAIYKKAVYITGKE-VFSFKMVSYMDATAGSAYT-DMNVVDIQVNLIVGCIEVVFVTKFLYSILAFIDNFQAAKQALAEATVQAAGMAATGVKELAQR--SSRMALDINIKAPVVVIPQSPVSENVFVADFGLITMTNTFHMITESQSSPPPVIDLITIKLSEMRLYRSRFINDAYQEVLDLLLPLNLEVVVERNLCWEWYQEVPCFNVNAQLKPMEFILSQEDITTIFKTLHGNIWYEKDGSASPAVTKDQYSATSGVTTNASHHSGGATVVTAAVVEVHSRALLVKTTLNISFKTDDLTMVLYSPGPKQASFTDVRDPSLKLAEFKLENIISTLKMYTDGSTFSSFSLKNC-ILDDKRPHVKKATPRMIGLTVGFDKKDMMDIKYRKVRDGCVTDAV-FQEMYICASVEFLQTVANVFLEAYTTGT-----------AVETSVQTWTAKEEVPTQES--VKWEINVIIKNPEIVFVADMTKNDAPALVITTQCEICYKGNLENSTMTAAIKDLQVRACPFLPVKRKGKITTVLQPCDLFYQTTQKGTDPQVIDMSVKSLTLKVSPVIINTMITITSAL--YTTKET-------IPEETASSTAHLWEKKDTKTLKMWFLEES-NETEKIAPTTELVPKG---------------EMIKMNIDSIFIVLEAGIGHRTVPMLLAKSRFSGEGKNWSSLINLHCQLELEVHYYNEMFGVWEPLLEPLEIDQTEDFRPWNLGIKMKKKAKMAIVESDPEEENYKVPEYKTVISFHSKDQLNITLSKCGLVMLNNLVKAFTEAATGSSADFVKDL-APFMILNSLGLTISVSPSDSFSVLNIPMA---KSYVLKNGESLSMDYIRTKDN----------DHFNAMTSLSSKLFFILLTPVNHSTADKIPLTKVGRRLYTVRHRESGVERSIVCQIDTVEGSKKVTIRSPVQIRNHFSVPLSVY------------EGDTLLGTASPENEFNIPLGSYRSFIFLKPEDENYQMCEGIDFEEIIKNDGALLKKKCRSKNPSKESFLINIVPEKDNLTSLSVYS------------EDGWDLPYIMHLWPPILLRNLLPYKIAYYIEGIENSVFT--LSEGHSAQICTAQLGKARLHLKL-LDYLNHDWKSEYHIKPNQQDISFVSFTCVTEMEKTDLDIAVHMTYNTGQTVVAFHSPYWMVN--------KTGRMLQYKADG--------------------------IHRKHPPNYKKPVLFSFQP-----------------NHFFNNN-------KVQLMVTDSELSNQFSIDTVGSHGAVKCKGLKMDYQVGVTIDLSSFNITRIVTFTPFYMIKNKSKYHISVAE-EGNDKWLSLDLEQCIPFWPEYASSKLLIQVERSED------PPKRIYFNKQENCILLRLDNELGGIIAEVNLAEHSTVITFLDYHDGAATFLLINHTKNEL-VQYNQSSLSEIEDSLPPGKAVFYTWADPVGSRRLKWRC---RKSHGEVTQKDDMMMPIDLGEKTIYLVSFFEGLQRIILFTEDPRVFKVTYESEKAELAEQEIAVALQDVGISLVNNYTKQEVAYIGITSSDVVWETKPKKKARWKPMSVKHTEKLEREFKEY-----TESSPSEDKVIQLDTNVPVRLTPTGHNMKILQPHVIALRRNYLPALKVEYNTSAHQSSFRIQIYRIQIQNQIHGAVFPFVFYPVKPPKSVTMDSAPKPFTDVSIVMRSAGHSQISRIKYFKVLIQEMDLRLDLGFIYALTDLMTEAEVTENTEVELFHKDIEAFKEEYKTASLVDQSQV---------SLYEYFHISPIKLHLSVSLSSGREEAKDSKQNGGLIPVHS--LNLLLKSIGATLTDVQDVVFKLAFFELNYQFHTTSDLQSEVIRHYSKQAIKQMYVLILGLDVLGNPFGLIREFSEGVEAFFYEPYQGAIQGPEEFVEGMALGLKALVGGAVGGLAGAASKITGAMAKGVAAMTMDEDYQQKRREAMNKQPAGFREGITRGGKGLVSGFVSGITGIVTKPIKGAQKGGAAGFFKGVGKGLVGAVARPTGGIIDMASSTFQGIKRATETS-EVESLRPPRFFNEDGVIRPYRLRDGTGNQM-LQVMENGR-FAKYKYFTHVMI-NKTDMLMITRRGVLFVTKG-TFGQLTCEWQYSFDEFTKEPFIVHGRR-LRIEAKERVKSVF 3140          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. UniProt/SwissProt
Match: sp|Q5H8C4|VP13A_MOUSE (Vacuolar protein sorting-associated protein 13A OS=Mus musculus OX=10090 GN=Vps13a PE=1 SV=1)

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 576/2040 (28.24%), Postives = 999/2040 (48.97%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETK-DSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFF-KSVKMDSLAVYWNSNPKPFS-SENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQV--LRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIG--TTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTSV----VLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSN--FNEAINQVPSVPESKEEVKSRKILPKDDKSGSART---------ASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIR-NIKNDSSDFISIKFIQDKNSNSKLIVD--IAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTL--TAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPL---LEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIF---GAPYVVKNTCGKDV 6044
            MVFES+VVE++N++LGDYVV LD+SQL LG+  G   L+NL IKENA  + D+P KV+ GHI  L LKIPWK+LY++PV A L+ +++LI+P+S ++YDP KE   L ETKQ+EL RIE+ K K  D +K  E K D+F EKL  QI++NLQ+ IS+IHIRYED  T  ++  + GI+L N+S QT D      +   D+T +   K +++D+L  YWN N + F  ++   +LKA +KN I +         F+ +PIS SA + ++ + +  +F+ P+++L + L  I   FN+ QY  +   L+S+D       +RK++P+VP+  +   WW +  + ILE  V    RMWSW++I+ HR + + Y + +++KL  KK S     +++  E+ LD+ NIT+ RQQAE++  K       + ++   +     G  ++          S S A+   D     +    T EEK+ LY+AIGYSE   DP +P  + +LK  + L+ +  ++ +N  K  +L+ +V+  +S  V QR  A AI     +++  +TG    D   P L+S+   +   +LL + FE NPL+++  Q+  I AEPLEIIYD+ TVN IV+F  PP+++ L ++++  L  +EE +  TATGL ++ + +   D+++++K SY I+P+ G ++    +LL+DLG + + S+R S+       L   +  + + + +   AYD F I L++IQ L    GD+W++ R    S  HIL P      L K ++  D  +PK  + G LP + + ISD+ LQ ++EL+  IP      P+PV    +  R +   Q    P  +++   +  L       DSE     +            ++  ++   +    +KK  K   + N+I L   F +    +Q    +        G  E+  L +  +G  T    + FD+   A++  L L  P+++D   K PV L  T  +T  ++LL +  + VEK +P+  + + N    ++  F S+++ LH EALL  +N++N+++P L     EK+ + S+   E+                    K D  I+  +  ++    +  T++L AE            S  +IFI                       ++  NI +I I G+ +++      TE++  + ++ + D   +A+YKK ++I   E +FS ++  +   T+   Y  D+S VD  V++ VG I+++F+  F+  I  F+++FQ     +A    + +E AA+ +  +  +  SSR  LD+N+KAPV+ IP++  S N  + D G +T KN F     T      V++   I LS +R+ RS    +T +    +L P+N+ + + RNLSW     +P  +I A++  +   +SQ D       L  N  + + ++   S  +  E + S    P D    +  T         AS     +   F+ ++L + L+    +   +     P   L + K EN+     ++ + +   S  + N  + D +    K    +I   +  D  D + IK+ + K   + ++ D  +  +Y+C  V++LM +   F  A                      R  R+ P        L  +E+++ +  PEI+ V DM   D+ A+++ T   +       S+ +   I D Q   CPF    RK     ++ P  +     +   +     ++++ L + ++P +I +I  I + L  T ++  E +T +           + + W+K++    +  F+ +   E EK+   N+ +  G               + + LR+  I ++LE+ +  + VPML+ +    G+ KN L+ I L   + + V Y+N+   VWEPL   LE+   +  R ++  I+        + + +   +   +     +I   SRD L +T+SK  L +L+NL +AF +A +       S+F    AP+++ N+ G  V
Sbjct:    1 MVFESVVVEVLNRFLGDYVVNLDESQLSLGIWKGAVALKNLVIKENALHELDVPFKVKVGHIGSLKLKIPWKNLYTQPVEAVLEEIFLLIVPSSRIQYDPIKEEKQLMETKQQELKRIEKAKQKVFDKEKPREEKQDTFTEKLVTQIIQNLQVQISSIHIRYEDDITNGDKPLSFGISLQNISLQTTDQYWIPCL--HDNTEKLVRKLIRLDNLFAYWNVNSEMFYLNDYDESLKA-LKNGIVNENIVPEGYDFVFRPISASAKLQMNRRSD-FDFSDPKINLAVDLHTIAIEFNKPQYFSLMELLESIDMMTQNQPYRKFKPSVPLHLHAKEWWAYAIHSILEVNVCPSLRMWSWEHIRNHRYKMKRYREFYKKKLTSKKPSPEILMSLEELEKTLDVFNITIARQQAEVEAKKAGYKIYKEGVKDPEDNAGWFGWLWTW---------SESNANQQQDVKPGILEEMLTPEEKSLLYEAIGYSETAVDPTLPKTFEALKFFVHLKSMSIVLRENHQKP-ELLNVVVEGLSTSVVQRPGAQAIKFETKIDSFHITGLPD-DFKKPHLLSSLDDT---SLLQITFEINPLNETVAQRCTIEAEPLEIIYDARTVNSIVEFFRPPKDVHLAQLTSVTLTKLEEFRAKTATGLLYVIETQKVLDLRINVKASYVIVPQYGNFSPTSNLLLLDLGHLKVSSKRRSL-------LPDVRPSEASLEDIMHRAYDSFDIQLTSIQLLYSRVGDNWKEARKLNVSTQHILIPMHVNVELSKAMVFMDIKMPKFKISGKLPLVSLRISDKKLQGIMELLGSIP-----KPEPVTDVSAPARSFQ-IQASALPVSHISQKLIPLLEQPVTEDDSEEEFFDAPC-------SPLEECPQVSCRDKCTRQKKLQKKDCVMNLIQLRMRFEVAEVSIQFYHLV--------GDCELPVLEMGALGLGTEAEFRTFDLKGSAFLKELWLKCPEYLD-ENKKPVYLITTLDNTM-EDLLTLEFMKVEKNAPNLNSTYNNVLQLIKVNFSSLDIHLHTEALLNTMNYLNNILPEL----REKSASVSAAEPED--------------------KGD--IIKKLALKLPTNEDIITLQLLAEL-----------SCLQIFI----------------------QDQKQNISEIKIEGLDSEMIMKPLVTEINAKLRNIIVLDSDKMAIYKKALYITGKE-VFSFKMISYMDATAGYAYT-DMSVVDIRVHLTVGCIEVVFITKFLYSILAFIDNFQAVKDALAEATVQAAEMAADGVKELARK--SSRFALDVNIKAPVVLIPQSPVSQNVFVADFGLITMKNIFVTVTETQSNIPPVIDLITIKLSKMRLYRSQFRNDTYQEVLDLLLPLNLEVIVERNLSWEWYKEVPCFNIKAQLKPMEFILSQEDLTTVFQTLHGNIWYGQDLSAPSSANKDPETMTSGVTSPPDHSPATVVTAAVVEVHPQASQAHTMLNVSFQTDYLTMALYSPGPDEASFTDVRDPSLELAEFKLENIISSLKIYTDDSTVFSFSVKNCILDDKRSHVMKATPRMIGLTVGFDKKDMVDIKYRKIK---TFVVTDAVVQEMYVCASVEFLMTVAHIFFDAYMTSTALETSVQT---------RTTREAPAQ-----ELGKWEMNILIKNPEIVFVADMTRNDAPALVITTQCEICCKGEPTSNTVTAAIKDLQVRACPFLPVKRKGKVTTVLQPCDLFYQATQLGRDPQMIDISVKSLTLKVSPVIINTIITITSALYTTKETVPEENTSN-----------IAHLWDKKDTKNLKMWFLEES-NESEKVVPTNEVMPGG---------------ETLNLRIDSIFIVLEAGIGHRTVPMLLAKACFSGESKNWLSLINLHCHLELEVHYYNEMFGVWEPLLEPLEIDQTDDFRPWNLGIKMKKKAKEAIVESDSEAENYKVPEYKTAISFYSRDQLNITLSKCGLVMLNNLVEAFTEAAT----GSSSVFLRDLAPFMIFNSLGLTV 1881          

HSP 2 Score: 538.495 bits (1386), Expect = 4.013e-152
Identity = 404/1141 (35.41%), Postives = 599/1141 (52.50%), Query Frame = 3
Query: 6747 YKLDINVPLALHNQLPIKISY----------------QSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG--WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQ-ELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWN-QIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKK----LMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVS-GSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--------LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITK 10070
            Y L +  P+ + N LP K++Y                 SQI++ ++    L L                 Y   +W     +    ++++ INF       +S +D+ +H+    GQ  V  +SPYWM+NKT   L YKA D    +H    T  VL                           +S Q                        N+  N N       K  L + DS  SD+FS+DTVGS G + CK   + Y+VGV INLSS  +T+IVTF+P+YMI N+S    Y   + E     W+ +   +++PFWP +    S ++  +VE  E    + +   + + IL++L  +  GI  EV + E + +I    Y +G A   LINH   D  + + Q +  + E  LP  + V Y W D    R+  W       + ++    D +    + +   Y VSF     RI+LFT D  V K    S   E  + E+ ++L  +G+SLV+N  +QE+AYI ITSS V W  + ++K R KP+ +  +E LE  F E+     T  + +E+ +V+++ + V L+       +++P    + R + P + ++Y TS HQ    ++IY+IQI NQ+    FP VF P  PPRSV +D+  KP  ++S V+  +G +   R KYF+VLIQEM L LD GFV ++ D V+   V    E   F KD +         S++       +  +F+ FHISPIK+HLS SLS      K +        +HS  LNL L+S+G  +TD+QDV+FKL +FE        +++ S +  HY  QA++QMYVL+LGLDVLGNPFG+IR  ++GVE  FYEP +GA+ GPEEFVEG+A G+K+L G AVGG AGA S+I   M KG+AA+T+D DYQ+KRRE + K+P  L  G+ +GGKGL+ GFV G+TG+VTKPI GA+K+G  GFFKGVGKGLVG VTRP  G++D ASS+F+GI+R  +T+ EV  +RPPRF  +DG+IR Y LR+  GN + +++ E         Y  HV   +K ++  +T + +  + +    G  + +WQ  +++    P I   +  +    KE+ + +F      K
Sbjct: 2096 YVLHLWPPILIRNLLPYKVAYYIEGIENTVVTLSEGHSSQIYNVEMDQAKLHLK-------------LLDYLNHDWKSEFYIRSSQQDINFINFTCLTEMEKSDLDIAIHMTYNTGQTVVAFHSPYWMVNKTNRMLQYKA-DGIHRKHPPNYTKPVL---------------------------FSFQP-----------------------NHFFNNN-------KVQLMVTDSELSDQFSIDTVGSHGAIRCKGLKMEYQVGVTINLSSFNITRIVTFIPFYMIKNKSK---YHISVAEEGSDKWLSLDLEQSIPFWPEN---ASNILLIQVERSEDPPKRIYFNKQDNCILLRLNNELGGIIAEVNLAEHSTVITFSDYHDGAATFLLINHTKSD-PVQYNQSSLGEIEDSLPPGKAVYYTWADPVGSRKLKWSCGQSYGEVTHK--DDMMTPISVGKKTIYLVSFFEGLQRIILFTEDPRVFKVTYESEKAELAELEVVLALQDVGISLVNNYTKQEVAYIGITSSDVVWEAKPKKKARWKPMSVKHTEKLEKEFREY-----TEASPLEDKVVELDNIPVRLTPSGNDMKILQPHVIPVRRNYLPALKVEYNTSAHQSSFRIQIYRIQIQNQIHGAIFPFVFYPIKPPRSVTMDSAPKPFTDVSIVMRSAGHSQISRIKYFKVLIQEMDLSLDLGFVYALADLVTKAEVTEKTEVEHFHKDVEAFEQEYEVVSSVDQ----SQVNLFEYFHISPIKLHLSVSLSSGRDEAKDSEQHGGLIPVHS--LNLLLKSIGATLTDVQDVVFKLAFFELNYQFHTTSELQSEVIRHYSKQAIKQMYVLILGLDVLGNPFGLIREFSEGVEAFFYEPYQGAIQGPEEFVEGMALGLKALVGGAVGGLAGAASKITSAMAKGVAAMTMDEDYQQKRREAMNKQPAGLREGITRGGKGLVSGFVSGITGIVTKPIKGAQKEGAAGFFKGVGKGLVGAVTRPTGGIIDMASSTFQGIKRATETS-EVESLRPPRFFNEDGVIRPYRLRDGSGNQM-LQVMENGR-FAKYKYFTHVMI-NKTDMFMITRRGVLFVTKG-TFGQLTCEWQYTFDEFTKEPFIVHGRR-LRIEAKERVKSVFHAKEFGK 3139          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. UniProt/SwissProt
Match: sp|Q8BX70|VP13C_MOUSE (Vacuolar protein sorting-associated protein 13C OS=Mus musculus OX=10090 GN=Vps13c PE=1 SV=2)

HSP 1 Score: 632.484 bits (1630), Expect = 1.254e-180
Identity = 485/1681 (28.85%), Postives = 818/1681 (48.66%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEE--------------------------------------------NKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQ-TAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSE--TASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQV----PSVPESKEEVKSRKI-LPKDDKSGSARTASD-------ESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIK-NDSSDFISIKFIQDK-------------NSNSKLIVDIAGIYMCICVDYLMMLTDFF 4835
            MV ES+V +L+N++LGDYV  L+KSQLKLG+ GGN  L+NL IKENA  + D+P KV+ G I KLTLKIPWK+LY E V+A L+GLY+L++P + +KYD EKE   L + KQKEL RIEE                                              L R+  K +   KD+F EKLA Q++KN+Q+ I++IHI+YED  T P R  + G+TL   S  T +   T  I+ E + +  +K VK+DSL+ YWN         +R  +   +K  I +S     D  ++ QPIS SA ++++   E+     P++  +++++ I     + QY  +  FL+S+D       +RKY+P +P+ +N   WW +  + +LE  +RR  + WSW  I+ HR   + Y   ++ KL   K+S+  Q  I+  E+ LD+ NI L RQQA+++V       + K       +   SG W      K D E+S     +  D+L        T EEK KL+ AIGYSE   +  +P +YV+  L L+L     II +N     +++++ I  +   V QR  A A+ +   + +  VTG +  D  VP+LV++   +   +LL ++FETNP +  A+Q + ++++P+E+IYD+ T+N +V+F    + L L +I++  L  +EE+KE TATGL H+ + R   D+++++KPSY I+P+ G + +   +L++D G+  + S+      + +  L          + + + AYDKF + + ++Q L  +  ++W+K R Q  S  HIL+P      L K ++  D  + K  V G LP + V ISD+ ++  L LI  IP PQ ++ P P     SI        L    K  L ++ +L  +    D E   A    +      +  E K A E+ +                  ++ L   F I    L++ +  K         + I+   V ++GT  T++ FD+   +Y+  + L     +  S K P+ L  +     G +LL +  + V++  P F T    T   ++  F S+ + L  +ALL  LN++ ++IP                      + T + KE +A+ + ++      +M                       S  SD  G+    ++F            A L    V V +EK +NI +I I G+ + +        +   + ++ + D  P  ++KK + I  +E +F   + L+   T    Y  D+S VD +V + VG I+I++L+ F++ + +FLN+FQ + + ++    + +E AA  + ++ +   S R  +DI++KAPVI IP++S S NA++VDLG +   N F++    D +   V+++ ++ L+ L++SR+ +   T   +  +LHPIN+   ++RNL+ N  H +P + I  R+ S++V ++Q D N+   +L  N  EA   +    P + E  E    R++  P+D  +     A+        + I V   F+++ + V L K          E         +K  +L +E  +  +  M  +  L NI++       +K   E +R +  +D SD I +K +  K             N+  KL V  + + + + ++ L+ L DF 
Sbjct:    1 MVLESVVADLLNRFLGDYVENLNKSQLKLGIWGGNVALDNLQIKENALSELDVPFKVKAGQIDKLTLKIPWKNLYGEAVVATLEGLYLLVVPGASIKYDAEKEEKSLQDIKQKELCRIEEALQKAAEKGAHSGEFMYGLENLLYKDVKPGRKRKKHKKHFKKRFKGLDRSKDKPKEAKKDTFLEKLATQVIKNVQVKITDIHIKYEDDITDPERPLSFGVTLREFSLLTTNEHWTPCILNE-AEKIIYKLVKLDSLSAYWNVGCCMSYRGSREHILEQLKREILTSTNIPPDHQYIFQPISASAKLYMNPGAES-ELKTPKLDGNVEVQNIAIELTKPQYLSMIDFLESLDYMVRNAPYRKYKPCLPLHTNCRQWWKYAIDSVLEVHIRRYTQPWSWSNIKNHRQLLKSYKMAYKTKLTQAKVSEEIQKQIQDLEKSLDVFNIILVRQQAQVEVIHSGQKLRKKSAEAGEKRGWFSGFWGKKESKKRDEESS---VPETIDDL-------MTPEEKDKLFTAIGYSENAYNLALPKQYVAHILTLKLVSTSIIIRENR-NVPEILRVQIIGLGTQVSQRPGAQALKIEAKLEHWYVTGLRQQD-IVPSLVASIGDTT-SSLLKIEFETNPENSPADQTLIVQSQPVEVIYDAKTINAVVEFFQSNKGLDLEQITSATLMKLEEIKERTATGLTHIIETRKVLDLRINLKPSYLIIPQTGFHHEKSNLLILDFGTFQLNSKDQGAQKTANASL----------EEIIDKAYDKFDVEIRSVQLLFAKAEENWKKCRFQHPSTMHILQPMDIHVELAKAMVEKDVRMAKFKVSGGLPLMHVRISDQKIKDALCLINSIPLPQKSSTPSPERQVASI------PVLSGGTKALLGTSLLLDGVESESDEEFFDAEDGDSQAARTVKASELKKAAEVPNE----------------ELVSLLLKFEIKEVVLELTKQQKE-------EETILVFNVTQLGTEATMRTFDLTAVSYLRKISLDYHD-IKGSRKKPIHLISSSDRP-GLDLLKVEYIKVDRNGPSFQTTFEKTEQTVKVAFSSLNLLLQTQALLSSLNYLTTVIP-------------------SDSQNTGVAKEVQAMPEKQKNSPLQKVM---------------------VPSRDSDVIGF----RLF------------AKLNAFCVTVCDEK-SNIAEIKIQGLDSSLSLQSKKQSLFARLENIIVTDVDPKTIHKKAVSIVGNE-VFRFNLDLYPDATEGDSYT-DMSTVDGVVALHVGCIQIVYLHKFLMSLLSFLNNFQVAKEALSAATAQAAEKAATSVKDLAQR--SFRVSVDIDLKAPVIVIPQSSLSTNAVVVDLGLIRVHNRFSLVSGEDTANPPVIDKMEVQLTKLKLSRTAIQPGTSHPDIQLLHPINLEFFVSRNLAANWYHKVPVVEIKGRLDSMNVSLNQEDLNLLFRILAENLGEATEDLDKGKPRIQERGETKACREVSTPQDVHTTQGVPAARVEETRPVDIINVLLNFEIKEVVVTLMKKAERKGSPFHE---------LKILHLGMEAKVKAHD-MTAAAYLRNISMRCFHFPDSK--GEPLRIVNTSDVSDGILLKLLFIKADSDGPDFKTIHDNTKQKLKVSFSSLDLVLHLEALLSLMDFL 1552          

HSP 2 Score: 558.14 bits (1437), Expect = 5.906e-158
Identity = 390/950 (41.05%), Postives = 574/950 (60.42%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG-----WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFY--ESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDF-YINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEG-LEVDLSKKLMIK--PEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEA------MFVKDCQMIRASLIETS-TIKTILSGGKKCVFDNFHISPIKIHLSFSL------SRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCK-SKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINES------KHTIVFTLKEKQ-----RKLFSKDNITKEIEADLI 10091
            K   F+K  K  LKI+ S WS+ FSLDTVGS G V C    + Y VGV I +SS  L+++VT  P+  + N+SS+ L   E+  +       W  V   E +PFWP +  GK  +     E      ++PF FY  + +  L+ LE    GI V++   E + +I    Y EG A   ++NH   DV + +KQ  + +EL+L   +T ++AW D    R+  W    +  +H  +L  D    F Y   ++ +WVSF+    R+LLFT+D+ +   A  + ++E  D E+ +SLHS+GLSLV+N  +QE++Y+ ITSSGV W +++ K + KP    Q  +LE A+ +   RL    A  +   VK++   EV+  K  M    P +C + R F  G+ ++++ SPHQ  +  R+Y +Q+DNQ+    FPVVF P  PP+S+ALD+  KP I++S +   +  +  +++KYF VLIQEM L +DQGF+ +++   +   PT D EA      +  +D   +   L+E+S T  +ILS      F++FHISP+K+HLS SL      S   +    A+HS  +NL L+S+G  +TD+ D+IFKL Y+E +      +Q++ S+  HY  Q L+QMYVLVLGLDVLGNPFG+IRG+++GVE LFYEP +GAV GPEEF EG+  GV+SL GH VGGAAG VSRI G++GKG+AA+T+D +YQ+KRRE++ ++P++ G  LA+GGKG + G V GVTG++TKP++GAKK+G  GFFKG+GKGLVG V RP  G++D ASS+F+GI+RVA++  EV  +RPPR I +DGIIR Y  +E+EG+++     +K +    E Y FH     +K+ V+ +TN+R   +   EILG  S+ WQ  +E    PP ++E+      K   +F  K+       RK++ KD IT +   D I
Sbjct: 2802 KKNIFSKN-KVQLKISTSAWSNGFSLDTVGSYGCVKCPATNMEYLVGVSIKMSSFNLSRVVTLTPFCTVANKSSLDLEVGEIASDGSIPTNKWHYVASSECIPFWPENLSGKLCVRVVGYEGS----SKPF-FYNRQDNGTLLSLEDLNGGILVDINTAEHSTVITFSDYHEGSAPALIMNHTQWDV-LTYKQSGSQEELVLLPGETRLFAWADPTGIRKLTWNYAANFGEH--DLLKDECGQFPYDANIQIHWVSFLDGRQRVLLFTDDVALVSKALQAEEMEQADHEVALSLHSLGLSLVNNENKQEVSYVGITSSGVVW-EMKPKQKWKPFSQKQIMSLEQAYSK---RL----ASQDRGWVKLDSNFEVNFDKVPMEMRLPIRCPIKRDFLSGIQVEFKQSPHQRSLRARLYWLQVDNQLPGTMFPVVFHPVAPPKSIALDSEPKPFIDVSVITRFNEYSKVLQFKYFMVLIQEMALKVDQGFLGAVISLFT---PTTDPEAERKRTKLIQQDIDALNTELMESSMTDMSILS-----FFEHFHISPVKLHLSLSLGSGGEESDKEKQEMIAIHS--VNLLLKSIGATLTDVDDLIFKLAYYEIRYQFYKRDQLMWSVVRHYSEQFLKQMYVLVLGLDVLGNPFGLIRGLSEGVEALFYEPFQGAVQGPEEFAEGLVIGVRSLVGHTVGGAAGVVSRITGSVGKGLAAITMDKEYQQKRREEMGRQPKDFGDSLARGGKGFLRGVVGGVTGIITKPVEGAKKEGAAGFFKGIGKGLVGAVARPTGGIIDMASSTFQGIQRVAESTEEVSSLRPPRLIHEDGIIRPYDRQESEGSDLLENHIKKLE---GEAYQFHCAVPGNKRAVLMITNRRALFIKEVEILGHMSVDWQCLFEDFVCPPEVSENLLKISVKEQGLFHKKDSANIGHLRKIYLKDPITAKRAFDAI 3721          

HSP 3 Score: 346.28 bits (887), Expect = 1.387e-93
Identity = 351/1480 (23.72%), Postives = 664/1480 (44.86%), Query Frame = 3
Query: 2853 IVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTS--PDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTSVVL----EESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSG----------SARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELI--RNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXM-VPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQ-IYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFE--IEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDA------YSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADS--ISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKC---YNVPIPTLLTSNGKIYIS-VKQLNTEISNSGAL--WNIGKNAQPSDTQILLCKS---NTGVMYYYSVALSIEEVQIVNSSETLR-TYKLDINVPLALHNQLPIKISY--QSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAV 7166
            I+H +G    +K  DM   AY+ ++ +    F D S   P+ +  T   + G   + + LL ++  S  PDF T+H NT+ KL+  F S+++ LH EALL +++F++S                       +   ++ EKE E    LK                 L  E R++ ++A   S + D   +D                ITA L    + + ++K +NI +I IHGM A +      T+V   + ++ + +   L+++KK + I  DE +F  Q++L+   T    Y  D+S+VD  ++++VG I+I++++ F + + +FLN+FQ + + ++    + +E AA+ + ++ ++  S R  +DI++KAPVI IP++S S N ++ DLG +  +N F++     + L    +E  I L+ L+++R++L  ++ +++  IL P+N+ + + RNLS      IP + I   +  + V +SQ D  +   +L  N  EA +Q PS  +  +E    K   +D +SG            +   D+++T+QF F  + L + L+  D++     S       L ++    ++  G M  + +M VS++L    + D +    +  + +I  +N ++++S  I I + QDKN  S++   +  +Y+C  V++LM + DFF+KA P   +   K + +P R       K  K     P      +  +   +  PE++ V  +   D+ A+       L  S  K   ++   + D + + CPF  E R K+   ++ P S+ +      +     ++ ++  +I I+P ++ ++  IM  ++ +      T++  + +   +   DN W  +   +    F+               GV+   +V +   D E    ++   + +  ++V LE  +  + VP+L+ E    G++KN  + +     +++ V Y+N+   VWEPL+E    E N+ +S +  ++     D  L   +DF     I     ++ + S   + +T+SKS L+V SNL K F +       YSL          AP+ VKN  G  V   +    +LK   S E+  +Y    G+    D    + S     +Q K+      +S   +  ++    TEV ++  +       +  N S    ++++V   A  G K + LRS LQ+ N+      +Y            KN  LLE +   +    ++VP+ +      ++Y+     L  + ++S     W    +       +L C +   +   +   +VAL  E   I    E     Y + +  PL L N LP  + Y  +    +H++  G    V  + +  +    V   Y  K W G   +   + E  ++ F +      + +DL VH+     +  ++++SPYW++NKT   L Y++ ++  V+H A   D +
Sbjct: 1452 ILH-LGMEAKVKAHDMTAAAYLRNISMRCFHFPD-SKGEPLRIVNTSDVSDG---ILLKLLFIKADSDGPDFKTIHDNTKQKLKVSFSSLDLVLHLEALLSLMDFLSS--------------------AIPSSDSSSSEKEPE----LK----------------PLVGESRSLAIRAVPSSYEGD--AFD--------------LKITAELNAFNIFICDQK-SNIAEIKIHGMDASISVKPKQTDVFARLKNIIVMNVDSLSIHKKAVSILGDE-VFRFQMSLYPDATEGENYG-DMSKVDGRLSLKVGCIQIVYVHKFFMSLLSFLNNFQAAKEALSTATVQAAERAASSVKDLAQK--SFRLLMDIDLKAPVITIPQSSVSPNVVIADLGLIRVENKFSLVSVEQLALPPVADEMSIQLTQLKLARTVLQADSPQHDVEILKPVNMLLCIQRNLSAAWYTQIPGMEIKGELKPMQVALSQDDLTVLMKILLENLGEASSQ-PSPTQYAQEAARVK---RDTRSGPDYLKEQELADPKPPGDQTVTLQFDFHFDSLSIILYNSDSSQEPRLSFHNDSFRLGELTLHLMASAGKMFKDGSMNVSLKLKTCTLDDLREGIERATSRMIDKKNDQDNNSSMIDISYSQDKN-GSQVDAVLDKLYVCASVEFLMTVADFFIKAMPQSPENIAKEIQIPSRQTAAGRVKMEKDDSVRP------NMTLKAMITDPEVVFVASLTKADAPALTASFQCNLSLSTSKLEQMMEASVRDLKVLACPFLRERRGKSITTVLQPCSLFMEKCTWASGKQNINIVVKEFVIKISPIILNTVMTIMAAMSPK------TKEDEWKDTPKE--TDNLWAVKSITDYNSWFL---------------GVDMATEVTENFRDSEHPSIEENCVVAVESVQVTLECGLGHRTVPLLLAESKFSGNIKNWTSLMAAAADMTLEVHYYNETHAVWEPLIERV--EGNKPWSLKLNVKKNPIQDKSLMPGDDF-----IPEPQTAVHISSGATMNITISKSCLNVFSNLAKGFSEGAASTFDYSLKDR-------APFTVKNALG--VPMKVQPNRNLKVMGSPEKSDIYDVGAGQHLELDYASLEPS-----RQGKLSILSRQESSLFTLTFVPYGYTEVASVPVARPGRRLYNVRNPSASHSDSVLVQIDATEGNKVVTLRSPLQIKNHFSIAFIIYKF---------VKNVKLLERIGIARPEEEFHVPLDSY---RCQLYVQPAGGLEQQYTHSSTYISWKEELHRSREVRCMLQCPAVEVSFLPLIVNTVALPDELSYIGAHGEDWDPAYVIHLYPPLTLRNLLPYSLRYLLEGTAETHELAEGSSADVLHSRISGEIIELVLVKYLGKNWNGHFRICDTLPEFFLVCFSSDTAEVMT-VDLSVHVRRIGCRMELSVFSPYWLINKTSRVLQYRS-EEIHVKHPADFRDII 2796          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. UniProt/SwissProt
Match: sp|Q709C8|VP13C_HUMAN (Vacuolar protein sorting-associated protein 13C OS=Homo sapiens OX=9606 GN=VPS13C PE=1 SV=1)

HSP 1 Score: 616.69 bits (1589), Expect = 6.987e-176
Identity = 443/1508 (29.38%), Postives = 751/1508 (49.80%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEE--------------------------------------------NKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSE--TASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIP----VLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQV----PSVPESKE 4373
            MV ES+V +L+N++LGDYV  L+KSQLKLG+ GGN  L+NL IKENA  + D+P KV+ G I KLTLKIPWK+LY E V+A L+GLY+L++P + +KYD  KE   L + KQKEL+RIEE                                              L R+  K +   KD+F EKLA Q++KN+Q+ I++IHI+YED  T P R  + G+TL  LS  T +   T  I+ E + +  +K +++DSL+ YWN N       +R  +   +KN I +S     +  ++ QPIS SA ++++   E+     P++  +++++ I     + QY  +   L+S+D       +RKY+P +P+ +N   WW +  + +LE  +RR  +MWSW  I+ HR   + Y   ++ KL   K+S+  Q  I+  E+ LD+ NI L RQQA+++V +     + K       +     G +     K   +   SL  +  D+L        T EEK KL+ AIGYSE T +  +P +YV+  + L+L      I +N     +++K+ I  +   V QR  A A+ V   + +  +TG +  D  VP+LV++   +   +LL + FETNP D  A+Q + ++++P+E+IYD+ TVN +V+F    + L L +I++  L  +EE+KE TATGL H+ + R   D+++++KPSY ++P+ G + +   +L++D G+  + S+   +  + ++ L          + + + AYDKF + +  +Q L     + W+K R Q  S  HIL+P      L K ++  D  + +  V G LP + V ISD+ ++ VL L+  IP PQ +  +      S +   SG   G+     L ++ +L  +    D E   A           +  E K A E+ +                  +I+L   F I    L+  +  K           I+   V ++GT  T++ FD+ V +Y+  + L   + ++ S + P+ L  +     G +LL +  +  +K  P F T    T   ++  F S+ + L  +AL+  +N++ ++IP     +++ +E +  T      E+ +K +TL K   +  D              +D ID                            ++F            A L    VIV NEK NNI +I I G+ + +        +   + ++ + D  P  V+KK + I  +E +F   + L+   T    Y  D+S+VD ++++ VG I+I++L+ F++ +  FLN+FQ + ++++    + +E AA  + ++ +   S R  ++I++KAPVI IP++S S NA++VDLG +   N F++    D     V++   + L+ L + R+++       +  +LHPIN+   + RNL+ +  H +P + I   + S++V ++Q D N+   +L  N  E    +    P V E+ E
Sbjct:    1 MVLESVVADLLNRFLGDYVENLNKSQLKLGIWGGNVALDNLQIKENALSELDVPFKVKAGQIDKLTLKIPWKNLYGEAVVATLEGLYLLVVPGASIKYDAVKEEKSLQDVKQKELSRIEEALQKAAEKGTHSGEFIYGLENFVYKDIKPGRKRKKHKKHFKKPFKGLDRSKDKPKEAKKDTFVEKLATQVIKNVQVKITDIHIKYEDDVTDPKRPLSFGVTLGELSLLTANEHWTPCILNE-ADKIIYKLIRLDSLSAYWNVNCSMSYQRSREQILDQLKNEILTSGNIPPNYQYIFQPISASAKLYMNPYAES-ELKTPKLDCNIEIQNIAIELTKPQYLSMIDLLESVDYMVRNAPYRKYKPYLPLHTNGRRWWKYAIDSVLEVHIRRYTQMWSWSNIKKHRQLLKSYKIAYKNKLTQSKVSEEIQKEIQDLEKTLDVFNIILARQQAQVEVIRSGQKLRKKSADTGEKRGGWFSGLWGKKESK--KKDEESLIPETIDDL-------MTPEEKDKLFTAIGYSESTHNLTLPKQYVAHIMTLKLVSTSVTIRENK-NIPEILKIQIIGLGTQVSQRPGAQALKVEAKLEHWYITGLRQQD-IVPSLVASIGDTT-SSLLKIKFETNPEDSPADQTLIVQSQPVEVIYDAKTVNAVVEFFQSNKGLDLEQITSATLMKLEEIKERTATGLTHIIETRKVLDLRINLKPSYLVVPQTGFHHEKSDLLILDFGTFQLNSKDQGLQKTTNSSL----------EEIMDKAYDKFDVEIKNVQLLFARAEETWKKCRFQHPSTMHILQPMDIHVELAKAMVEKDIRMARFKVSGGLPLMHVRISDQKMKDVLYLMNSIPLPQKSSAQSPERQVSSIPIISGGTKGL-----LGTSLLLDTVESESDDEYFDAEDGEPQTCKSMKGSELKKAAEVPNE----------------ELINLLLKFEIKEVILEFTKQQKE-------EDTILVFNVTQLGTEATMRTFDLTVVSYLKKISLDYHE-IEGSKRKPLHLISSSDKP-GLDLLKVEYIKADKNGPSFQTAFGKTEQTVKVAFSSLNLLLQTQALVASINYLTTIIPSDDQSISVAKEVQIST------EKQQKNSTLPKAIVSSRD--------------SDIIDF---------------------------RLF------------AKLNAFCVIVCNEK-NNIAEIKIQGLDSSLSLQSRKQSLFARLENIIVTDVDPKTVHKKAVSIMGNE-VFRFNLDLYPDATEGDLYT-DMSKVDGVLSLNVGCIQIVYLHKFLMSLLNFLNNFQTAKESLSAATAQAAERAATSVKDLAQR--SFRVSINIDLKAPVIVIPQSSISTNAVVVDLGLIRVHNQFSLVSDEDYLNPPVIDRMDVQLTKLTLYRTVIQPGIYHPDIQLLHPINLEFLVNRNLAASWYHKVPVVEIKGHLDSMNVSLNQEDLNLLFRILTENLCEGTEDLDKVKPRVQETGE 1390          

HSP 2 Score: 550.821 bits (1418), Expect = 1.002e-155
Identity = 383/920 (41.63%), Postives = 561/920 (60.98%), Query Frame = 3
Query: 7377 KAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG-----WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFY--ESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDF-YINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEG-LEVDLSKKLMIK--PEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEA------MFVKDCQMIRASLIETS-TIKTILSGGKKCVFDNFHISPIKIHLSFSL------SRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCK-SKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDN 10061
            K  LKI+ S WS  FSLDTVGS G V C    + Y VGV I +SS  L++IVT  P+  I N+SS+ L   E+  +       W  +   E +PFWP S  GK  +     E      ++PF FY  + +  L+ LE    GI V+V   E + +I    Y EG A   ++NH   D+ + +KQ  +P+E++L   Q  ++AW D    R+  W    +  +H  +L  DG   F Y   ++ +WVSF+    R+LLFT+D+ +   A  + ++E  D EIT+SLHS+GLSLV+N  +QE++YI ITSSGV W +++ K + KP    Q   LE ++       +  +   +   +K++   EV+  K  M    P +  + R F  G+ ++++ S HQ  +  R+Y +Q+DNQ+    FPVVF P  PP+S+ALD+  KP I++S +   +  +  +++KYF VLIQEM L +DQGF+ +I+   +   PT D EA      +  +D   + A L+ETS T  +ILS      F++FHISP+K+HLS SL      S   +    A+HS  +NL L+S+G  +TD+ D+IFKL Y+E +      +Q++ S+  HY  Q L+QMYVLVLGLDVLGNPFG+IRG+++GVE LFYEP +GAV GPEEF EG+  GV+SLFGH VGGAAG VSRI G++GKG+AA+T+D +YQ+KRRE+L+++P + G  LA+GGKG + G V GVTG++TKP++GAKK+G  GFFKG+GKGLVG V RP  G+VD ASS+F+GI+R A++  EV  +RPPR I +DGIIR Y  +E+EG+++   +      +  E Y +H     SKK ++ +TN+R+  +   EILG+  + WQ  +E    PP+++E+    V  +  K++ LF K +
Sbjct: 2815 KVQLKISTSAWSSSFSLDTVGSYGCVKCPANNMEYLVGVSIKMSSFNLSRIVTLTPFCTIANKSSLELEVGEIASDGSMPTNKWNYIASSECLPFWPESLSGKLCVRVVGCEGS----SKPF-FYNRQDNGTLLSLEDLNGGILVDVNTAEHSTVITFSDYHEGSAPALIMNHTPWDI-LTYKQSGSPEEMVLLPRQARLFAWADPTGTRKLTWTYAANVGEH--DLLKDGCGQFPYDANIQIHWVSFLDGRQRVLLFTDDVALVSKALQAEEMEQADYEITLSLHSLGLSLVNNESKQEVSYIGITSSGVVW-EVKPKQKWKPFSQKQIILLEQSY-------QKHQISRDHGWIKLDNNFEVNFDKDPMEMRLPIRSPIKRDFLSGIQIEFKQSSHQRSLRARLYWLQVDNQLPGAMFPVVFHPVAPPKSIALDSEPKPFIDVSVITRFNEYSKVLQFKYFMVLIQEMALKIDQGFLGAIIALFT---PTTDPEAERRRTKLIQQDIDALNAELMETSMTDMSILS-----FFEHFHISPVKLHLSLSLGSGGEESDKEKQEMFAVHS--VNLLLKSIGATLTDVDDLIFKLAYYEIRYQFYKRDQLIWSVVRHYSEQFLKQMYVLVLGLDVLGNPFGLIRGLSEGVEALFYEPFQGAVQGPEEFAEGLVIGVRSLFGHTVGGAAGVVSRITGSVGKGLAAITMDKEYQQKRREELSRQPRDFGDSLARGGKGFLRGVVGGVTGIITKPVEGAKKEGAAGFFKGIGKGLVGAVARPTGGIVDMASSTFQGIQRAAESTEEVSSLRPPRLIHEDGIIRPYDRQESEGSDL---LENHIKKLEGETYRYHCAIPGSKKTILMVTNRRVLCIKEVEILGLMCVDWQCPFEDFVFPPSVSEN----VLKISVKEQGLFHKKD 3701          

HSP 3 Score: 322.013 bits (824), Expect = 3.033e-86
Identity = 316/1282 (24.65%), Postives = 579/1282 (45.16%), Query Frame = 3
Query: 3468 ITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKI--------LPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELI--RNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXX--XXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQ-IYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDA------YSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKP-CNSDEEFKVYLKADG---EVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDN---EGPSRGNVSEREIN-----TLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKC---YNVPIPT-----LLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKS---NTGVMYYYSVALSIEEVQIVNSSETLR-TYKLDINVPLALHNQLPIKISY--QSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAV 7166
            ITA L    V V ++K  NI DI IHGM A +      T+V   + D+ + +    +++KK + I  DE +F  Q+ L+   T    Y  D+S+VD  ++ +VG I+I++++ F + +  FLN+FQ + + ++    + +E AA+ + ++ ++  S R  +DIN+KAPVI IP++S S NA++ DLG +  +N F++      S   V+++  I L+ L++SR+IL  +  +N+  IL P+N+ + + RNL+      IP + I  ++  + V +S+ D  +   +L  N  EA +Q       +E V+ RK+        L + +    ++ + ++ +++QF F  E L + L+  D N     +       L +++   ++  G M  + +M VSV+L    + D +    +  + +I  +N ++++S  I I + QDKN  S++   +  +Y+C  V++LM + DFF+KA P        +  ++P R       K  K     P      +  +   +  PE++ V  +   D+ A+       L  S  K   ++   + D + + CPF  E R KN   ++ P S+ +      +     ++ ++  II I+P ++ ++  IM  L+ ++ +     DGS   +++   ++N W               G+      NT   GV++  ++ +    +E    ++   + +  I+V LE  +  + VP+L+ E    G++KN  + +     V++ V Y+N+   VWEPL+E    +       +++     D  L   +DF     I    ++I + S + + +T+SKS L+V +NL K F +       YSL          AP+ VKN  G  +         +KP CN        L+  G   +  ++D VD  Q+L  E         G    +SR+  S +   +    ++   N     P R   + R  N     +++V   A  G K + LRS LQ+ N+      +Y            KN  LLE +   +    ++VP+ +      +   G +    K+  T IS     W    +       +L C S   +   +   +VAL  E   I    E     Y + +   L L N LP  + Y  +    +H++  G    V  + +  +    V   YQ K W G   +   + E   + F + +    + +DL VH+     +  ++++SPYW++NKT   L Y++ +D  V+H A   D +
Sbjct: 1601 ITAELNAFNVFVCDQK-CNIADIKIHGMDASISVKPKQTDVFARLKDIIVMNVDLQSIHKKAVSILGDE-VFRFQLTLYPDATEGEAYA-DMSKVDGKLSFKVGCIQIVYVHKFFMSLLNFLNNFQTAKEALSTATVQAAERAASSMKDLAQK--SFRLLMDINLKAPVIIIPQSSVSPNAVIADLGLIRVENKFSLVPMEHYSLPPVIDKMNIELTQLKLSRTILQASLPQNDIEILKPVNMLLSIQRNLAAAWYVQIPGMEIKGKLKPMQVALSEDDLTVLMKILLENLGEASSQPSPTQSVQETVRVRKVDVSSVPDHLKEQEDWTDSKLSMNQIVSLQFDFHFESLSIILYNNDINQESGVAFHNDSFQLGELRLHLMASSGKMFKDGSMNVSVKLKTCTLDDLREGIERATSRMIDRKNDQDNNSSMIDISYKQDKN-GSQIDAVLDKLYVCASVEFLMTVADFFIKAVPQSPENVAKETQILP-RQTATGKVKIEKDDSVRP------NMTLKAMITDPEVVFVASLTKADAPALTASFQCNLSLSTSKLEQMMEASVRDLKVLACPFLREKRGKNITTVLQPCSLFMEKCTWASGKQNINIMVKEFIIKISPIILNTVLTIMAALSPKTKE-----DGSKDTSKE---MENLW---------------GIKSINDYNTWFLGVDTATEITESFKGIEHSLIEENCGVVVESIQVTLECGLGHRTVPLLLAESKFSGNIKNWTSLMAAVADVTLQVHYYNEIHAVWEPLIERVEGKRQWNLRLDVKKNPVQDKSLLPGDDF-----IPEPQMAIHISSGNTMNITISKSCLNVFNNLAKGFSEGTASTFDYSLKDR-------APFTVKNAVGVPI--------KVKPNCN--------LRVMGFPEKSDIFD-VDAGQNLELEYASMVPSSQGNLSILSRQESSFFTLTIVPHGYTEVANIPVARPGRRLYNVRNPNASHSDSVLVQIDATEGNKVITLRSPLQIKNHFSIAFIIYKF---------VKNVKLLERIGIARPEEEFHVPLDSYRCQLFIQPAGILEHQYKESTTYIS-----WKEELHRSREVRCMLQCPSVEVSFLPLIVNTVALPDELSYICTHGEDWDVAYIIHLYPSLTLRNLLPYSLRYLLEGTAETHELAEGSTADVLHSRISGEIMELVLVKYQGKNWNGHFRIRDTLPEFFPVCF-SSDSTEVTTVDLSVHVRRIGSRMVLSVFSPYWLINKTTRVLQYRS-EDIHVKHPADFRDII 2801          

HSP 4 Score: 57.3806 bits (137), Expect = 3.958e-6
Identity = 36/120 (30.00%), Postives = 66/120 (55.00%), Query Frame = 3
Query: 2820 EKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIP 3179
            EK G + + +L V ++G    +K +DM  +AY+  + +    F D S   P+ +  +   T  + LL + L   +   P+F T+H +T+ +L+  F S+++ LH EALL  ++F++S  P
Sbjct: 1443 EKKG-RPLHELNVLQLGMEAKVKTYDMTAKAYLKKISMQCFDFTD-SKGEPLHIINSSNVTD-EPLLKMLLTKADSDGPEFKTIHDSTKQRLKVSFASLDLVLHLEALLSFMDFLSSAAP 1559          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. UniProt/SwissProt
Match: sp|A1Z713|VPS13_DROME (Vacuolar protein sorting-associated protein 13 OS=Drosophila melanogaster OX=7227 GN=Vps13 PE=1 SV=2)

HSP 1 Score: 523.857 bits (1348), Expect = 1.280e-147
Identity = 353/907 (38.92%), Postives = 534/907 (58.88%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG-WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLE-KKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEM-KAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIR-RKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIR---ASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLF 10049
            +++ F    KA ++I++  WS+K  LD  GS G+V+C      Y VGV  +L+ + LTK +TF+P+Y++ N+    +   E    A  W+ + P E  P WPR++   ++++R   +     +T  F F E    L+KLE  K+ GI V+VQ TE    I    Y+   A   LINH G  +  H K   T  E IL A  T+MYAW D    +  ++   G  K+ ++ L  DGI +  + +  K  WVSF+    R+LLFT +  +A     +A L+SI Q I + +H IGLS+++N    ++ Y+ +TSSG+ W   +  KNR K L + ++  LE  + +++  +  S  +V+ + +      +D    ++ K  +  L R F P ++L  ++SP Q  +H++I +IQ+DNQ  D  FPVV AP PPP+SVA  T LKP IE S V      +   ++KY R+LIQE    +D  F+ +I +  +  V        F +D + I    ++  E  +++      +K  +DN H+ P+KIH+SFS++       T      L   +Q VG+ +TD+ DV+F+L +FE++       Q+++ ITSHY  QAL+Q+YVLVLGLDVLGNP+G++ G+ +GVEDLFYEP +GA+ GP EF EG+  GVKSLFGH VGGAAGAVS+I G MGKG+AALT D DYQ+KRR+ +  +P+N   GLA+  KGL++GFV GVTGVVTKP+ GA+ +G+EGFFKG+GKG +G+V RP +GVVDFAS SFE ++R AD + +V R+RPPRF   D ++R Y L EA GN I +K T+K      + ++       K   + +TN R+ ++ RNE+ G+W+  W   + ++    ++  +   + FT+K   +K+ 
Sbjct: 2394 RDKLFFDKKKASIRIDNGQWSEKIPLDVAGSVGEVICFANNQKYPVGVHNHLTQNSLTKQITFIPFYIVCNKCHFDIELQEQSRPADPWLHLEPNEMEPLWPRNDTKNNLVVRVDGK-----ITPAFDFTEVICTLLKLEDSKYGGINVDVQTTEGGVYITFTDYKPADAPGLLINHTGKQIVYHEK--GTKNEHILNAKSTIMYAWDDPTGPKMLVF---GTNKEETD-LKRDGIGEVIMQDGGKVLWVSFLDGLQRVLLFTENESIANRTESTASLQSITQSIDLRIHGIGLSVINNETGLDILYLGVTSSGIIWESKKVTKNRFKELTINENALLEIEYQKYL--VHKSVNDVQTYKLD-NKFPIDFDLMILKKTVERNLRRSFYPAIWLSRKSSPFQSQLHVKINRIQVDNQFLDPIFPVVLAPIPPPKSVASTTSLKPFIECSMVQRIMPNSTVRQFKYARILIQEFLFKVDLNFLTAIAEMFAKEVSDEAAAKQFRQDVESIELPLSAFFEEHSLEE-----QKSFYDNLHLGPLKIHVSFSMA----GSDTKALPGFLGSLVQGVGVTLTDVNDVVFRLAFFEREYQFFSQKQLINEITSHYTGQALKQLYVLVLGLDVLGNPYGLVVGLKKGVEDLFYEPFQGAIQGPGEFAEGLVLGVKSLFGHTVGGAAGAVSKITGAMGKGLAALTFDEDYQKKRRQGIQNKPKNFHEGLARSSKGLVMGFVDGVTGVVTKPVTGARDNGVEGFFKGLGKGAIGLVARPTAGVVDFASGSFEAVKRAADASEDVKRMRPPRFQHYDFVLRPYCLMEATGNKI-MKETDKGKFATTDNFIHCEEIIQKSEYLVVTNYRVMYVQRNEMFGVWTSLWSYLWNEIS---SVAATARGVQFTVKTDGKKVL 3273          

HSP 2 Score: 459.144 bits (1180), Expect = 7.669e-128
Identity = 276/838 (32.94%), Postives = 463/838 (55.25%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIE---ENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTN--FTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRP-NVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFII------SDNSLKEY-KLMKLVIHSMS---AHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKY-TKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRK-LRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPP 2483
            MVFE++V +++NK LGDY+  LD++QLK+G+ GG+  L+NL I+ENA D+ DLPV++  G++ KL LKIPWK+LYS+PVI  ++ LYVL+ PN+ ++Y+ EKE  Y  + K+  L+ +E   + +L+ + PK +      F EKL AQIV NLQ+ I+N+H+RYEDT+T     F+ GI+L  L   T D       + + ++ + FK   +  L+ Y N   + +++ N++ L    K NI+  E K  + ++++ PISC+A + ++M PE  +  F  P++ L L++E++       Q+ ++    D+M+R      +RKYRP N+P + +   WWHF    ILEE+VR+ R  W+W +I+ HR RC  Y   ++++ L KK S    +T ++ E ELD+ N+ L RQ+              ++      +     GW  G   K D +T+S        +L +K  +  T EEK K+Y+AIGY E     D+P  Y ++++N +L  L+  +      S  + K++ +L  LV+ + S   A + QR +A+AIS+   M  ++VTG    D + P LV ++   +  NLL V FETNPLDK  +Q++ + A PL+I YD+ T+  ++     P ++ L +        I   KE +ATG++++ D++   D+ + + P+  ++P +G Y   +  +L+V +G + + S+              G+D       + E AYD+F + +  +Q L++  G+ W+  L    S++ H+LRP   +     CV+ ND  LP I V   LP + V +S+  +   +++   IP P+   P
Sbjct:    1 MVFEAVVADVLNKVLGDYIENLDRNQLKIGIWGGDVVLQNLKIRENALDELDLPVQLIYGYLGKLVLKIPWKNLYSQPVIVNIEDLYVLVSPNNNVQYNAEKEAKYEMDLKKAALDALEAARKKELEMDQPKADA----GFAEKLTAQIVNNLQVQITNVHLRYEDTTTT-GSPFSFGISLHELELYTTDCDWEKCYMAQQAS-QVFKIANLSCLSAYLNCGGQLYAN-NKSDLSQQFKTNIACKETK-PNYNYVLGPISCNAKLKLNMNPELDDPPFEKPKIDLTLEMEKLNVGLTNTQFDNLMKLGDAMNRQQLGIPYRKYRPYNIPYKGHARDWWHFAITSILEEEVRKPRESWTWGHIKTHRERCNTYAQKYKEQCLSKKPSAVLTETCRLLETELDVFNLLLIRQRVN-------IEIAKQREAVPEQKSGWFSGWGWGGGAKKDDQTTSQ-------KLVEKFEAAMTSEEKEKMYRAIGYQENAKPTDLPESYEAIRMNFKLIALEVGLYKDERNSSAATKDFHELPSLVLLNFSMATALITQRPAAEAISIIAGMREIKVTGLTRNDYT-PLLVESKITDEF-NLLEVFFETNPLDKLCDQRVKVVARPLQITYDAPTILALINAFQTPGDVTLSKFEDAASTKISNFKERSATGMQYMIDKKAVLDVDILLMPNILVVPHKGVYDAGNVSLLVVSMGQVHLSSQPRRESNKLQHLFSAGEDKDEILKTVMENAYDRFTVAVDDVQMLVVRAGEPWQNALAEANSTEMHVLRPVSLKVTAALCVVDNDPRLPNIKVDIDLPAILVNVSEDRIFLAIKVATSIPLPEQKEP 814          

HSP 3 Score: 223.402 bits (568), Expect = 2.504e-56
Identity = 257/1087 (23.64%), Postives = 501/1087 (46.09%), Query Frame = 3
Query: 2988 TKKHTKGQNLLF-INLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMT-QWAITASLQKLRVIVANEKDNNILDISIHGMRAD--VKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKND----FAIDQSTSVVLEESKITLSNLRVSRSILLENT------VKNEKGIL------HPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESI---------TVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKI----------------NELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXM-VPVRGYEKNPRKYRKKP--LAS----PVEPRLAD-----FEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLL---EVYPEEHNRQYS-FEIEYISCDDSGLFD-EEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINK 6062
            T K     N LF ++  I +K+SP+F T + +T   +   F+ +++ LHQE L  ++  +N+    L++V               TR +  +                 SI G   D I     KRT+ +  E   E    +     KK     +  T +  + A+L ++ +++   K   I ++++    +   +K+SY  TEV+I + D+++ D +P  ++K I+ I   ++ F+ Q+ ++N+   T  Y  D    D  + +++G +KIIFL  FV  +  FLN+F  +  T++      +E+A  K  +  E   ++R KL+I +KAP+I +P  S+  NAL++DLG L   N+       ++    V++E K+ + ++++S+ +LL+        V  E G L      +P++  + +TRNLS+     +P+++++ R+ SI + +   DY +  LVL  N NE + + P   E+ +E + R   P+   S + R +    +         +++F F+ + + + L +G+               L +     LSV+G+   N  +  SV L NI + D + +S  +I                +E+I    N+ +  + +  I  K  ++   V + G  + +C+D+L+ LT F         +        PV    ++ +   +    LA+    PVE    +       + + +  P+I+LVE++ + +++ I+      L Y  + +  I+N  I   +   C F  E R+     I+ P  ISL  + P   GM  SL +  +IIN++PA I+ ++K M ++++ +  + +  + S   N       N W +  F    + F         K+    D +E+  +   +  D E+++ ++  + +P I +++ES V     P++  +  +     N    +    +++++++Y+N  +  WEP++   EV      R+Y+ +E+++    + G+   + + ED    E  A+ + + S + LE+T+SK+ L +LS L +AF  A   +      I  APYV++N  G DV   + K
Sbjct:  973 TPKQENSSNYLFTVSCTIADKSSPEFSTKYNSTEQLVVANFEVLQIVLHQECLQRIMEVVNNFQRNLDLV------------LSSTRPRDRM----------------GSIGG--GDGI-----KRTLNVILEDTEEIMTTDQMKRRKKTRRTHVVETVKVRVIANLDQVGLVLTGRK-RPIAEMNVKKFVSSLIIKSSY--TEVNIGLKDIQVLDLNPYTIHKNILSIVGKDA-FNCQIVIYNK-EETQDYNSD----DMKITVDIGCMKIIFLNWFVAGVMNFLNNFTAAQATISQAGAAAAESARQKAMDAYET--ATRMKLNIRIKAPIIIVPIGSQDRNALLLDLGLLELTNNTVEVAVAEEERLAVIDEIKLQICDVKISKIVLLDGNESTVDEVDAEVGFLSKFNMMNPMSCTLSITRNLSYTWYRDVPELNLSGRLKSIELTLFADDYALVMLVLNRNLNEGLEEFPPSEEAPQEAQVR---PERRNSRAGRLSRTVQVSPIREKIHESIKFNFQFDGVVINLMEGEG------------AGLARFGIYFLSVKGTKLDNGTLSTSVVLCNIQMDDMRSNSKSQIRQYLSRKDWVQPKLDTDEIIDACYNERNFMVDVTAII-KEDDTFAEVRVRGFDLIVCIDFLLKLTTFLTLPPEENPRESVYIKPAPVSETARDTKHSIRSSAILAAQELVPVESSSHEVPNRKMNLILHIDEPDIILVENLEDLNTSCIIFNAQVHLNYRSINDKQIVNGQIDALKMYMCAFLPERREMTRHYILHPCVISLQGSTPEEEGMHISLKLSDIIINVSPATIELLNKAMLSVSSGTMTKCAIAEES--RN-----YSNLWHQHHFHSRTYWFT--------KVEQGVDALEA--EQRSVSTDNEKQKTEKCVIEIPSITLVIESGVGYYTKPLISLDTRITAVFNNWSRSLTAHGSLTLNMNYYNQALAEWEPIIELNEVIGRNGVREYTPWELKF----EMGMEKVQSELED--DAEQQAMHMNIHSAETLEITLSKTCLGLLSELAEAFSQAIDQNGLTKPDIV-APYVLENDTGFDVNLNLRK 1973          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. TrEMBL
Match: A0A5K4EAP5 (VPS13C protein, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 2264.19 bits (5866), Expect = 0.000e+0
Identity = 1425/3688 (38.64%), Postives = 2132/3688 (57.81%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISK----------LTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETK-DSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDP------DIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTK--------GPDGSVPTLVSTQAQSKLMN-------------LLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMP-------------------GSGDTDL----------IFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQ-----TAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVL----PDSETASLTSTIXXXXXXXXXFKDAL--------------------EIMDNN---VXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTK-GQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEE-----KTETWSSPNKEETRKQTTLEK--ENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTSVV-------------LEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSAR--------TASDE------SITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKI--NELIRNIKNDSS------DFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPR------------KYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQ-STD------ETSTRDGSF----INNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDD--SGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLH-----LEQHKSIFGAPYVVKNTCGKDVVFYINKE------FD----------LKPCNSDEEFKVYLKADGEVQLYD-----------------AVDEKQSLITEEKQAKIVKF-----------GFADSISREYLSIYRTEVRALLFSPKD--NEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYL--LLEEVLGGKCYNVPIPTLLT-SNGKIYISVKQLNTEISNSGALW---NIG-KNAQPSDT---------------------------------QILLCKSNTGVM------YYYSVALSIEEVQ------------------------IVNSSETLRT-----------------YKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDTVES--PAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKP-VTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVE---------NAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELI--LPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKV----EGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKI 10118
            MVFESLVVELIN+YLG Y+  L+ SQLK+GLLGGNA LENLDIK NAFDD DLPVKV QGHISK          LTLKIP+K+L++EP IAEL GLYVLI+PN  ++YD  KE+ Y  E KQKEL  +E  +LK   PK   ++K DSFGEKLAAQ++KNLQISI +IHIRYED+ + PNR F++G+TL+ L+FQTCDS+   I IK++S R+F K VK+ SL VYWN     F+ + +  L++ M+++I+S +   T   +L++PIS +AM+H+H +PE TN++VP+M L +   +I   F+ +QY DIT FL++ DR  T+ ++RKYRP  P+  N  +WW F YN +LEE VRRR  MWSW++I  HR   R Y  IW +KL   KLSQ++   I+  EE LD+ NI LCRQQAE++ +  K     K         + SGG + GWF +     S  + S    +L K++ +E T EEKA L+  I YSE           + PI YVS  + + L++L  ++ D+ L +  ++K  ++ ++A V+QR+   A++V+L M++++  G +              P L+++     L N             LL +DFE NPLD+ A+Q+I+I+A+ L+I+YD++T+N IV F TPP+++ L E+S  VL+S EEVKE+T +GLRHLA  R YTD+ +DIKPSYFILP+ G Y  DC++LLVDLGS  + S RTS+P                    +G TD           +  K GKL +D +K+ AYDKF+I LS++Q +M+ +GDDWR LR    S NHIL+P      LK+CV+ ND NLP++ V GCLP   V  +D VL+S+ ELI+++PFP+     T P  P    + +L++       I P   L +  +L+    L     DS  +S  S   +DD  +E   D +                    +++D N    I  + + +   K   +IDL   FVI   E+QVL+   N+  +      I+   +HE+GT+L  +R+   +QA+IG+L +A+PQF    T  PV LA+T++H + G +LL + L+I EK +PDF T + NTRH+L+C FK ++V +HQEA L+++N+ N+L   L+   +E     + E  +S    E  KQ  L +  ENE  + L  +      +G     I   TE+R +R++A ++++++       GK   IPE+ +TQW + A+L K+ V + + K+ ++   +++G+R DV+T+Y T E+S  +++  + D      Y+KI+W++  E++ S+Q+  F   T +    +D  +VD  +++++GK+  IFLY+F+ R+  F+ ++QE++  ++NK Q  S+AA  ++   ++    +R  L+I  +APVIY+P++S S  +LM+D G +T  N F     + V+             LE   + L NLR+SR +L E++V+ EK +L PIN+ +   RNL+ N    IP + +   +  I++ +SQGDY + Q VL  NFN+  +   +  ++          P + K+ + R        T SD        IT+ F   M+ + + L+  D    EW ++ P DK L     +  +V G M  +S+ +   +L++IN+ D++  S K+I   +++R + + ++      + I ++F QD   N K+ + +  I++C  +DYLM L DF +K+ P         +  V    K  R            K    P A P      + E+ V++  PE++LVED+ N DSNAI + T     Y++ ++  +IN  I+      CP+        + +I+SP+ +S Y ++PIN  + G+L M+ L INI P  I+ +S I +++ +  +TD      ET + D S     +++ D+  +  FW+  +  E    ++      K+KI    + VE   D+A+++ + E RR D I +R+  I++ILES++  K +PML+ + ++D  L  P+T + L   + +S+SY+ND IN WEPL+E  PEE +R +S ++E +S ++  +    ++D+E++  ++ S  +IL+LSRD LE+T+SK+AL++L+NLG++FE AY L       +   +   APY + N  G  ++   N +      FD          L   +S+ +  +    + ++  Y                    D+KQS+++  K ++   +           G + S S     +YR +   L  S KD  NE P+  +  +  I  ++    A LG+K +  RS +QV NNT + I +Y    KS    +  N+L  LL  V  G+ Y +P+  + +     I+I  +     IS + A W     G +   PS+T                                 Q++ C +N+G M      Y+Y+VA+     Q                        +   ++ LR                  +++ I   + L+NQLP  I++     +  I  G    ++TA     + I++++ Y    + G L+L P+MEE SVI F++++ Y    + LG+H     GQ  +T+Y+PYWM+N                                                 K++   + +S+D VE+  PA         T T ++   +     F K  KA+L++ +S WSDKFSLDTVGSSG+V C  K  ++YE+GVKI+LSSSGLTKIVTF+PY++I+N+++I + C E+ E         N GWIKVP GEAVPFWP +   K+M+++C+V   E +VT  FPFYESHSILMKL+ K+ GIFVEV+ TEE  +I LQ+YQEGMALV+L+N+L     + + Q    Q ++  L A  ++MYAW   + KRE I+       +HSN LT D IE+F +N  KAY VSF+W+  R+LLFT + +VAK+ARLS+DLE IDQEI ISL SIG+SLVDN  + ELAYISITSSGV+W+Q++R NR KPL+L  SE LE A+  +VN    ++ +V   IVK+    + +EVD ++ +++KP++  ++R F+PGVFLQY++S  Q+ +H +++++Q+D+Q  D  FPVV + FP P+SVALD+G KPL E SA+I ++   G+ R+KYF VLIQEMQL LDQGF+  I +F S SV    +E  F  D  +I + LI+   ++  +  G + +FD+FHISPIK+H+SFSL+       +A  SEVLNLFLQS+G+A+T++QDV+FKL YFE+Q  IM + QM + IT HYV Q +RQMYVLVLGLDVLGNPFGV+RG+AQGVEDLFYEPV+GA+LGPEEF EGV  GV+SL GHAVGGAAGAVSRI GT+GKGIAALTLD +Y+RKRREQLA+RPE  G GLAQGG+GL++G   GVTGVVTKP +GAK++G+EGFFKG GKGLVG VTRPVSGVVDFASSSFEGIRR+ADT  EV R+RPPRFI  DGIIR Y  REA+G  I  ++ +  D I  + Y+FH++     + + LT   +  ++  ++LG +SI W+   E L   P IN+S   I+  LKEKQ+KLF+  +  K+ + DL + K ++S+I
Sbjct:    1 MVFESLVVELINRYLGSYIEALNASQLKIGLLGGNAQLENLDIKANAFDDLDLPVKVLQGHISKQKLLHLLLGSLTLKIPFKNLFTEPTIAELTGLYVLIVPNIAVEYDEAKEKRYAKELKQKELVSVETARLK---PKHSDDSKADSFGEKLAAQVIKNLQISIKDIHIRYEDSFSIPNRTFSLGLTLSALTFQTCDSNQKPIFIKDESIRQFIKFVKLTSLGVYWNPMSTKFAEKAKVPLRSAMRSSIASPDNLNTGFHYLVKPISSTAMLHIHTRPEETNYSVPQMDLVVNFSEIELCFSLSQYHDITCFLEAQDRIVTQGKYRKYRPLTPISQNYKVWWRFAYNAVLEESVRRRHLMWSWEHISKHRKISREYIAIWRKKLSGDKLSQAQLANIEAYEEFLDVFNIVLCRQQAELQFNASKQKHSQKAN-------SKSGGGWFGWFSRGSAAGSDDMESSSEGDLMKRLETEMTSEEKAHLFAVIDYSESAASGVSGSAINFPISYVSSSIAVTLRQLSLVLLDDKLSDPNVLKFSVNKLTADVKQRAGDQALAVSLRMDSLEALGAQPTLKESYLAKSSIKPVLITSHVNQSLSNGNNQAGNTSKRSHLLCIDFEKNPLDRKADQRISIQADALQIVYDAETINKIVHFFTPPKDVYLQELSNTVLSSFEEVKEVTTSGLRHLATNRSYTDVHIDIKPSYFILPDSGIYRSDCRLLLVDLGSFTVNSSRTSVPPVCKTVQDQASSNDENKNDCTGKTDAKEPISNISGQVKHKSGKLTFDELKDEAYDKFNINLSSVQVIMVNEGDDWRALRKMNKSSNHILKPLALSCTLKRCVLRNDVNLPRVIVDGCLPVFSVDFTDAVLKSLYELIVNVPFPEADKSLTTPANP----DELLKDVVVLPNSIIPGSVLATRDLLKVTRQLNRNDSDSTLSSWVSDTVDDDLHEESEHDRISQQSKLENDTTNVNDDLHGSQLIDKNKSKAIRQRDQANLRRKRAKLIDLKLDFVIRKVEIQVLERQLNSQNKNIEDHLILSFNIHEVGTSLIKRRWTQEIQAHIGTLSVAIPQFTHRETYEPVYLARTQRHEETGHHLLAVQLIIAEKNAPDFDTYYQNTRHRLQCDFKVLDVYVHQEATLLLMNYFNNLRISLSKQSKELEHSSEIEWATSIGDIEGLKQAKLRETLENEMKQQLPGRLTAADAVG---SHIARKTERRNIRMEAASLAQKT-------GKVAVIPELNITQWMVNATLDKVNVTLGS-KETDLFSTTVNGLRIDVRTTYDTVEISAILSEFIVIDHIVNTSYRKILWVDPTENVVSLQITHFQDNTQSIENSIDPDKVDLAISLQIGKLHSIFLYHFITRVLNFMEAYQEAVGIMSNKFQALSDAAVQQVHEAVDNSSQTRLSLNIVAQAPVIYMPQHSLSNVSLMIDFGRITLSNHFEFINPSKVLPDTTIPVPEPGIMLEHMVVRLENLRLSRVVLKESSVQAEKHVLLPINVELKTRRNLNPNIYSAIPILLVNGGLNEINISLSQGDYRVLQEVLLDNFNDLPSSTKTSIKTTPVTTDSSAKPTNKKNKTQRIVEEKNISTQSDNHDNNPVKITISFDLGMKSVILNLYTCDQPVAEWLNDFPEDKRLATFNLKQFNVSGQMASDSSSQFIAKLNDINLQDSRPGSDKQITRGQILRVLGHSATKDNRHDELIYVEFNQDALLNKKIQISLRSIHLCASMDYLMSLLDFQMKSTPTSKNESNN-LTSVTDKSKQKRLNNSSITKPDVKKTESLPTAYPF-----NLELKVQIDNPELVLVEDIYNVDSNAIKLTTELSFGYNMKQDIVVINALINSLSIAACPYNETVGGPFSKEILSPSDLSFYASQPINGSLHGTLHMDTLTININPNTIRLLSAISSSVQSSLTTDKNPDICETVSNDESMKSVNVDHSDEKSLTEFWKPIQLKELNMPYLGLTSDSKDKI----ECVEKACDIAKVVEETENRRIDIINIRLKTIRIILESQLDTKFMPMLVLDSTLDAVLTKPITHVELKFLIELSLSYYNDSINQWEPLIETLPEEGDRMWSLQLELVSINNNKAECLTDDDWENVGCLQASTNTILILSRDNLEITISKTALEMLNNLGRSFEAAYKLKNIKSKYDDSTNRIIAPYCIMNKTGCQLMLRYNSQALSLIHFDSDNTMTKSESLHQTSSEPKKAIVSNTEHDIVTYQNSVLLDSQQEIGFTELAKTDKKQSIVSSYKDSRHHIWISLSDTSHQPSGSSISNSEVVFQLYRGDSELLCLS-KDPSNEKPTNSD-RKSTIYPIVADVEACLGVKSITFRSTVQVLNNTSERICIYSHLIKS----SVANHLPGLLTIVDAGQSYALPVEIVNSRQQTGIFIGPEYEKPVISVTPAYWPEFACGVEKYTPSNTNTHLPFLAPYAQSVSSTNTEYKISNSSQFKWPNQLVECHTNSGSMNNNGIIYFYNVAVVNHNYQDNRLDNTNNDNNNTGNTDQQRKTSLTAVADELRATQKKMIQGDKLSITHCDFQMIIQTAVVLYNQLPFSINFILTDITDTIAAGSHYALKTASPN-NAYIEISFEYTGSMYRGKLELHPQMEEYSVIEFESRKEYEVFDLPLGLHRTSNLGQICLTLYAPYWMIN-------------------------------------------------KTEKDLTYKSVDDVETVHPA---------TFTGALLYSSLSKSFFGKR-KANLRVCESNWSDKFSLDTVGSSGRVHCTTKSRMSYEIGVKIDLSSSGLTKIVTFMPYFVIINKANINIDCCEVDETETKSTQSTNTGWIKVPAGEAVPFWPHATNSKNMLLKCRVS--ENIVTAAFPFYESHSILMKLDGKYPGIFVEVETTEETTVITLQMYQEGMALVRLVNNLDGSQPVFYHQSGI-QHIVHRLDAGMSIMYAWDCPQAKRELIFYCNETDNRHSNKLTYDSIEEFKVNNTKAYLVSFMWNMQRVLLFTQNANVAKNARLSSDLEPIDQEIVISLQSIGISLVDNHSRAELAYISITSSGVRWSQVKRGNRLKPLELTLSENLERAYTNYVNASNDTD-KVAFSIVKLTDTRQPIEVDFNRMIILKPDQYGITRAFDPGVFLQYKSSISQMQLHAKLFRLQVDSQRLDSTFPVVLSAFPQPKSVALDSGFKPLFEWSAIIGRTANPGSFRFKYFHVLIQEMQLKLDQGFLYDITNFFSSSVTRTSKEEAFKHDYLLITSKLIDLPVVQAHMQDGNRSIFDSFHISPIKVHVSFSLTGSTEGKSSAFPSEVLNLFLQSLGVALTEVQDVVFKLDYFERQACIMTLGQMSTEITHHYVGQGVRQMYVLVLGLDVLGNPFGVLRGLAQGVEDLFYEPVKGAILGPEEFAEGVTLGVRSLLGHAVGGAAGAVSRITGTLGKGIAALTLDEEYKRKRREQLARRPETFGAGLAQGGRGLVMGVFHGVTGVVTKPFEGAKREGVEGFFKGFGKGLVGAVTRPVSGVVDFASSSFEGIRRLADTTQEVSRVRPPRFIRSDGIIRPYDKREADGYLILKQVDK--DGIFGQ-YLFHIHSVRGNSALILTTNNLLIIESMDLLGTFSIDWKTPLENLSEAPVINKSG--ILIKLKEKQKKLFTSGHQIKQFDCDLNLAKLMISEI 3578          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. TrEMBL
Match: G4VDJ9 (VPS13C protein, putative OS=Schistosoma mansoni OX=6183 GN=Smp_021170 PE=4 SV=1)

HSP 1 Score: 2224.13 bits (5762), Expect = 0.000e+0
Identity = 1408/3646 (38.62%), Postives = 2124/3646 (58.26%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETK-DSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDP------DIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTK--------GPDGSVPTLVSTQAQSKLMN-------------LLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMP-------------------GSGDTDL----------IFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQ-----TAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVL----PDSETASLTSTIXXXXXXXXXFKDAL--------------------EIMDNN---VXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTK-GQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEE-----KTETWSSPNKEETRKQTTLEK--ENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTSVV-------------LEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNE-------AINQVP-----SVPESKEEVKSRKILPKDDKSGSARTASDE--SITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKI--NELIRNIKNDSS------DFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXX-XXXXXXXXXXMVPVRGYEK----------NPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQ-STD------ETSTRDGSF----INNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDD--SGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSL-----HLEQHKSIFGAPYVVKNTCGKDVVFYINKE------FD----------LKPCNSDEEFKVYLKADGEVQLYD-----------------AVDEKQSLITEEKQAKIVKF-----------GFADSISREYLSIYRTEVRALLFSPKD--NEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYL--LLEEVLGGKCYNVPIPTLLT-SNGKIYISVKQLNTEISNSGALW---NIG-KNAQPSDT---------------------------------QILLCKSNTGVM------YYYSVALSIEEVQIVNSSETLRT-----------------YKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQ-SLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYC---NELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELI--LPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKV----EGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVP-TYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKI 10118
            MVFESLVVELIN+YLG Y+  L+ SQLK+GLLGGNA LENLDIK NAFDD DLPVKV QGHIS LTLKIP+K+L++EP IAEL GLYVLI+PN  ++Y+  KE+ Y  E KQKEL  +E  +LK   PK   ++K DSFGEKLAAQ++KNLQISI +IHIRYED+ + PNR F++G+TL+ L+FQTCDS+   I IK++S R+F K VK+ SL VYWN     F+ + +  L++ M+++I+S +   T   +L++PIS +AM+H+H +PE TN++VP+M L +   +I   F+ +QY DIT FL++ DR  T+ ++RKYRP  P+  N  +WW F YN +LEE VRRR  MWSW++I  HR   R Y  IW +KL   KLSQ++   I+  EE LD+ NI LCRQQAE++    KAN             + SGG + GWF +     S  + S    +L K++ +E T EEKA L+  I YSE           + PI YVS  + + L++L  ++ D+ L +  ++K  ++ ++A V+QR+   A++V+L M++++  G +              P L+++     L N             LL +DFE NPLD+ A+Q+I+I+A+ L+I+YD++T+N IV F TPP+++ L E+S  VL+S EEVKE+T +GLRHLA  R YTD+ +DIKPSYFILP+ G Y  DC++LLVDLGS  + S RTS+P                    +G TD           +  K GKL +D +K+ AYDKF+I LS++Q +M+ +GDDWR LR    S NHIL+P      LK+CV+ ND NLP++ V GCLP   V  +D VL+S+ ELI+++PFP+     T P  P    + +L++       I P   L +  +L+    L     DS  +S  S   +DD  +E   D +                    +++D N    I  + + +   K   +IDL   FVI   E+QVL+   N+  +      I+   +HE+GT+L  +R+   +QA+IG+L +A+PQF    T  PV LA+T++H + G +LL + L+I EK +PDF T + NTRH+L+C FK ++V +HQEA L+++N+ N+L   L+   +E     + E  +S    E  KQ  L +  ENE  + L  +      +G     I   TE+R +R++A ++++++       GK   IPE+ +TQW + A+L K+ V + + K+ ++   +++G+R DV+T+Y T E+S  +++  + D      Y+KI+W++  E++ S+Q+  F   T +    +D  +VD  +++++GK+  IFLY+F+ R+  F+ ++QE++  ++NK Q  S+AA  ++   ++    +R  L+I  +APVIY+P++S S  +LM+D G +T  N F     + V+             LE   + L NLR+SR +L E++V+ EK +L PIN+ +   RNL+ N    IP + +   +  I++ +SQGDY + Q VL  NFN+       +I   P     S   + ++ K+++I+ + + S  +    +    IT+ F   M+ + + L+  D    EW ++ P DK L     +  +V G M  +S+ +   +L++IN+ D++  S K+I   +++R + + ++      + I ++F QD   N K+ + +  I++C  +DYLM L DF +K+      +      V  +  +K          N +K    P A P      + E+ V++  PE++LVED+ N DSNAI + T     Y++ ++  +IN  I+      CP+        + +I+SP+ +S Y ++PIN  + G+L M+ L INI P  I+ +S I +++ +  +TD      ET + D S     +++ D+  +  FW+  +  E    ++      K+KI    + VE   D+A+++ + E RR D I +R+  I++ILES++  K +PML+ + ++D  L  P+T + L   + +S+SY+ND IN WEPL+E  PEE +R +S ++E +S ++  +    ++D+E++  ++ S  +IL+LSRD LE+T+SK+AL++L+NLG++FE AY L       +   +   APY + N  G  ++   N +      FD          L   +S+ +  +    + ++  Y                    D+KQS+++  K ++   +           G + S S     +YR +   L  S KD  NE P+  +  +  I  ++    A LG+K +  RS +QV NNT + I +Y    KS    +  N+L  LL  V  G+ Y +P+  + +     I+I ++     IS + A W     G +   PS+T                                 Q++ C +N+G M      Y+Y+VA  + +  +   ++ LR                  +++ I   + L+NQLP  I++     +  I  G    ++TA     + I++++ Y    + G L+L P+MEE SVI F++++ Y    + LG+H     GQ  +T+Y+PYWM+NKT   LTYK  +D +  H A  T A+L+S LSKS F K+     +A ++  +S +S + SLDTV              S+  ++        F  ++K  L                 SSG                       LTKIVTF+PY++I+N+++++      +    N GWIKVP GEAVPFWP +   K+M+++C+V   E +VT  FPFYESHSILMKL+ K+ GIFVEV+ TEE  +I LQ+YQEGMALV+L+N+L     + + Q    Q ++  L A  ++MYAW   + KRE I+       +HSN LT D IE+F +N  KAY VSF+W+  R+LLFT + +VAK+ARLS+DLE IDQEI ISL SIG+SLVDN  + ELAYISITSSGV+W+Q++R NR KPL+L  SE LE A+  +VN    ++ +V   IVK+    + +EVD ++ +++KP++  ++R F+PGVFLQY++S  Q+ +H +++++Q+D+Q  D  FPVV + FP P+SVALD+G KPL E SA+I ++   G+ R+KYF VLIQEMQL LDQGF+  I +F S SV  T   +  F  D  +I + LI+   ++  +  G + +FD+FHISPIK+H+SFSL+       +A  SEVLNLFLQS+G+A+T++QDV+FKL YFE+Q  IM + QM + IT HYV Q +RQMYVLVLGLDVLGNPFGV+RG+AQGVEDLFYEPV+GA+LGPEEF EGV  GV+SL GHAVGGAAGAVSRI GT+GKGIAALTLD +Y+RKRREQLA+RPE  G GLAQGG+GL++G   GVTGVVTKP +GAK++G+EGFFKG GKGLVG VTRPVSGVVDFASSSFEGIRR+ADT  EV R+RPPRFI  DGIIR Y  REA+G   ++ +    D I  + Y+FH++     + + LT   +  ++  ++LG +SI W+   E L   P IN+S   I+  LKEKQ+KLF+  +  K+ + DL + K ++S+I
Sbjct:    1 MVFESLVVELINRYLGSYIEALNASQLKIGLLGGNAQLENLDIKANAFDDLDLPVKVLQGHISSLTLKIPFKNLFTEPTIAELTGLYVLIVPNIAVEYNEAKEKRYAKELKQKELVSVETARLK---PKHSDDSKADSFGEKLAAQVIKNLQISIKDIHIRYEDSFSIPNRTFSLGLTLSALTFQTCDSNQKPIFIKDESIRQFIKFVKLTSLGVYWNPMSTKFAEKAKVPLRSAMRSSIASPDNLNTGFHYLVKPISSTAMLHIHTRPEETNYSVPQMDLVVNFSEIELCFSLSQYHDITCFLEAQDRIVTQGKYRKYRPLTPISQNYKVWWRFAYNAVLEESVRRRHLMWSWEHISKHRKISREYIAIWRKKLSGDKLSQAQLANIEAYEEFLDVFNIVLCRQQAELQKHSQKAN-------------SKSGGGWFGWFSRGSAAGSDDMESSSEGDLMKRLETEMTSEEKAHLFAVIDYSESAASGVSGSAINFPISYVSSSIAVTLRQLSLVLLDDKLSDPNVLKFSVNKLTADVKQRAGDQALAVSLRMDSLEALGAQPTLKESYLAKSSIKPVLITSHVNQSLSNGNNQAGNTSKRSHLLCIDFEKNPLDRKADQRISIQADALQIVYDAETINKIVHFFTPPKDVYLQELSNTVLSSFEEVKEVTTSGLRHLATNRSYTDVHIDIKPSYFILPDSGIYRSDCRLLLVDLGSFTVNSSRTSVPPVCKTVQDQASSNDENKNDCTGKTDAKEPISNISGQVKHKSGKLTFDELKDEAYDKFNINLSSVQVIMVNEGDDWRALRKMNKSSNHILKPLALSCTLKRCVLRNDVNLPRVIVDGCLPVFSVDFTDAVLKSLYELIVNVPFPEADKSLTTPANP----DELLKDVVVLPNSIIPGSVLATRDLLKVTRQLNRNDSDSTLSSWVSDTVDDDLHEESEHDRISQQSKLENDTTNVNDDLHGSQLIDKNKSKAIRQRDQANLRRKRAKLIDLKLDFVIRKVEIQVLERQLNSQNKNIEDHLILSFNIHEVGTSLIKRRWTQEIQAHIGTLSVAIPQFTHRETYEPVYLARTQRHEETGHHLLAVQLIIAEKNAPDFDTYYQNTRHRLQCDFKVLDVYVHQEATLLLMNYFNNLRISLSKQSKELEHSSEIEWATSIGDIEGLKQAKLRETLENEMKQQLPGRLTAADAVG---SHIARKTERRNIRMEAASLAQKT-------GKVAVIPELNITQWMVNATLDKVNVTLGS-KETDLFSTTVNGLRIDVRTTYDTVEISAILSEFIVIDHIVNTSYRKILWVDPTENVVSLQITHFQDNTQSIENSIDPDKVDLAISLQIGKLHSIFLYHFITRVLNFMEAYQEAVGIMSNKFQALSDAAVQQVHEAVDNSSQTRLSLNIVAQAPVIYMPQHSLSNVSLMIDFGRITLSNHFEFINPSKVLPDTTIPVPEPGIMLEHMVVRLENLRLSRVVLKESSVQAEKHVLLPINVELKTRRNLNPNIYSAIPILLVNGGLNEINISLSQGDYRVLQEVLLDNFNDLPSSTKTSIKTTPVTTDSSAKPTNKKNKTQRIVEEKNISTQSDNHDNNPVKITISFDLGMKSVILNLYTCDQPVAEWLNDFPEDKRLATFNLKQFNVSGQMASDSSSQFIAKLNDINLQDSRPGSDKQITRGQILRVLGHSATKDNRHDELIYVEFNQDALLNKKIQISLRSIHLCASMDYLMSLLDFQMKSTPTSKNESNNLTSVTDKSKQKRLNNSSITKPNVKKTESLPTAYPF-----NLELKVQIDNPELVLVEDIYNVDSNAIKLTTELSFGYNMKQDIVVINALINSLSIAACPYNETVGGPFSKEILSPSDLSFYASQPINGSLHGTLHMDTLTININPNTIRLLSAISSSVQSSLTTDKNPDICETVSNDESMKSVNVDHSDEKSLTEFWKPIQLKELNMPYLGLTSDSKDKI----ECVEKACDIAKVVEETENRRIDIINIRLKTIRIILESQLDTKFMPMLVLDSTLDAVLTKPITHVELKFLIELSLSYYNDSINQWEPLIETLPEEGDRMWSLQLELVSINNNKAECLTDDDWENVGCLQASTNTILILSRDNLEITISKTALEMLNNLGRSFEAAYKLKNIKSKYDDSTNRIIAPYCIMNKTGCQLMLRYNSQALSLIHFDSDNTMTKSESLHQTSSEPKKAIVSNTEHDIVTYQNSVLLDSQQEIGFTELAKTDKKQSIVSSYKDSRHHIWISLSDTSHQPSGSSISNSEVVFQLYRGDSELLCLS-KDPSNEKPTNSD-RKSTIYPIVADVEACLGVKSITFRSTVQVLNNTSERICIYSHLIKS----SVANHLPGLLTIVDAGQSYALPVEIVNSRQQTGIFIGLEYEKPVISVTPAYWPEFACGVEKYTPSNTNTHLPFLAPYAQSVSSTNTEYKISNSSQFKWPNQLVECHTNSGSMNNNGIIYFYNVA--VRKTSLTAVADELRATQKKMIQGDKLSITHCDFQMIIQTAVVLYNQLPFSINFILTDITDTIAAGSHYALKTASPN-NAYIEISFEYTGSMYRGKLELHPQMEEYSVIEFESRKEYEVFDLPLGLHRTSNLGQICLTLYAPYWMINKTEKDLTYKV-NDVETVHPATFTGALLYSSLSKSFFGKR-----KANLRVCESNWSDKFSLDTV-------------GSSGRVHCTTKSRMSFEVSIKIDL----------------SSSG-----------------------LTKIVTFMPYFVIINKANVMDETETKSTQSTNTGWIKVPAGEAVPFWPHATNSKNMLLKCRVS--ENIVTAAFPFYESHSILMKLDGKYPGIFVEVETTEETTVITLQMYQEGMALVRLVNNLDGSQPVFYHQSGI-QHIVHRLDAGMSIMYAWDCPQAKRELIFYCNETDNRHSNKLTYDSIEEFKVNNTKAYLVSFMWNMQRVLLFTQNANVAKNARLSSDLEPIDQEIVISLQSIGISLVDNHSRAELAYISITSSGVRWSQVKRGNRLKPLELTLSENLERAYTNYVNASNDTD-KVAFSIVKLTDTRQPIEVDFNRMIILKPDQYGITRAFDPGVFLQYKSSISQMQLHAKLFRLQVDSQRLDSTFPVVLSAFPQPKSVALDSGFKPLFEWSAIIGRTANPGSFRFKYFHVLIQEMQLKLDQGFLYDITNFFSSSVTRTSKVKEAFKHDYLLITSKLIDLPVVQAHMQDGNRSIFDSFHISPIKVHVSFSLTGSTEGKSSAFPSEVLNLFLQSLGVALTEVQDVVFKLDYFERQACIMTLGQMSTEITHHYVGQGVRQMYVLVLGLDVLGNPFGVLRGLAQGVEDLFYEPVKGAILGPEEFAEGVTLGVRSLLGHAVGGAAGAVSRITGTLGKGIAALTLDEEYKRKRREQLARRPETFGAGLAQGGRGLVMGVFHGVTGVVTKPFEGAKREGVEGFFKGFGKGLVGAVTRPVSGVVDFASSSFEGIRRLADTTQEVSRVRPPRFIRSDGIIRPYDKREADG---YLILKVNKDGIFGQ-YLFHIHSVRGNSALILTTNNLLIIESMDLLGTFSIDWKTPLENLSEAPVINKSG--ILIKLKEKQKKLFTSGHQIKQFDCDLNLAKLMISEI 3529          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. TrEMBL
Match: W6V289 (Vacuolar protein sorting-associated protein OS=Echinococcus granulosus OX=6210 GN=EGR_00351 PE=4 SV=1)

HSP 1 Score: 1928.29 bits (4994), Expect = 0.000e+0
Identity = 1246/3604 (34.57%), Postives = 2010/3604 (55.77%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDG----------------------------------------------------SVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSI----------LIVSERTS------------MPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESIL----REYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXX--XXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQ------NLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLI------PVLNIVEEEKTETWSSPNK------EETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI---------DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKE-------------EVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDS---SDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDN----FWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRR---ADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKA----------FEDAYS-----LHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKV--------------------YLKADGEVQLYDAVDEKQSLITEEKQA-----KIVKFGFA----DSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVST-TAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGK---IYISVKQLNTEISNSGALW------NIGKNAQPSDTQILL------------------C----KSNTGV---MYYYSVALS----------IEEVQIVNSSETLR-TYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLK-VQSN---IKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVK-KSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFA---------KTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKK-PVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG------WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLE----VDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSL-SRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLK-----EKQRKLFSKDNITKEIEA 10082
            MVFE+LV +L+N+YLG+Y+  L+ SQL+LGLL GN +LEN+D++  AFDDF++P +V QGHI    L     H Y           YV         Y+  KE+ Y  E K+K L  IEE K +R   K ++   DSF EKLAAQI+KN+Q+ I NIHIRYED +T P   F+ G+TL  L+FQTCDSSG  +++  D ++EFFK V++DSLAVYWN + K ++      L+ +M ++++SSER + ++ ++++PIS +A++HVHM+PE   FT+P++ +DLK E+I   F  NQY  +   LDS+DR   +N+F KY+  +  ++     W F Y  +LEE VRRR  MWSWK+IQ HR   R YT +W ++LL + L+  ++  I+  E+EL+++N+ L RQ AE++ +K +A K++ +           GG  S     +  +T ++       ++ ++V+ E T EEK KLY A+ YSE  +    P EYVS  +   L  L  ++++N LK   ++K+ ++++++  +QR   +A+  + + +     G  GP G                                                    + P L+S+    +  +LL VDF  NP+D++A++ + I A PL++IYD+DTVN IV F   P  L+L EIS+ V+ S++E+K MT TGLRHL  RR   D++VDI+PS  +LPERG Y + C++++VD GS+          L  SE TS            + G   +D  + +  + NY+ +   AYD+F + LS  Q +++++G++WR+LRS   +  H+L+P G +  L++C    +  LP+  V G LP LG+  +D+VL+S+ ++I H+P P+T P + +PT  + L    + +  K   + P         L+A++VL  +ETA    + + D    E + F D+ E  +  +    + + +     N++ + A F++    + + +   +  +    A  ++K +++EIG   TL+++D  + A++  L L  P+F +  + + +CL  T   +  Q      +L   +LLI +K+ PDF T +ANTRH L C+F+ +++ LHQEAL+ +L F   L       P L  +E++  +     N+       E  + +++   +EA     +     ++ GL+  +     E+R +RL  +AVSE +       G+ + IPE+  TQW I  +L K++V   +  +  ++  S+ GMR D++ +Y TTE+++ ++D+ I D +  ++Y++I+WIE   ++F MQ  L+N+GT     + D  +VD  V ++ GK  +I LY F+ R+                            I  V+ +P   R  L +NV+APVIY+P+NS S  AL+ DLG ++ KN F +         D    ++++   + L + ++S +IL++  V+ ++ ++ PIN+ ++M R +  ++   +PQ+ ++  + SI + M+ GDY +   V   NF EA + + S+P S               E+ ++K     D S S    S    +  + F +  L++ELF+G  +P  W  E+   + L    C  L +EG    +++  +  RL +I+++DT+  S + I  ++    +     S+FI + +  D  SN  L V++  I +C  +DY M+L+ FF +      +P  K        ++      ++P  + V        I   +A PEI+L EDM NP+ NAI+V T+    Y++++E  ++N  I+ F+ + CPF    R KN+M+++ PTS+S Y  +P+   + GS+ ME L+IN+   +I+SISKIMN LT  + D +        +  ++ + D+    FW  +    ++ + I  G ++ +  ++ ++G E G DVA IL+ V+  R   A  I +R+  + + +ES++  K VPML+ E  +DG++K+P T + + +   ++VSY+NDH+N WE LLE  P E NR +S ++ Y S +    + ++++++L +++ S   +  +S+D LE+T+SK+ALDVLS LGKA          FE+AY      + L +   I  APYV++N  G  ++  ++ +   +   +DE                         L+A   +  YD    K   +   + A     + +  G A    D I+     ++ +   AL      N   S  +++++E +  IV+T TA+LG K L L+S LQV N T + I ++ L   +  S+      LL  + GG  Y+  +P  + +N +   I +         S     W         K+    DT I L                  C    K+  G    +Y Y++ +            + +Q  +S+ T    Y + I  P +LHN LP+ I++        ++PG      TA L  V+S+   + V + Y KK++ G++++  + EE+S++  + ++GY  S ++LG+  + + G  ++T+Y PYW++NKTG +LTYK  ++ +  H A  +D  LFS            T   A+++ K  S   LQ + + +      H++    + AS ++ +N ++ F          + VK  ++  DSLWS KFSLDTVGS  +V C+ K   +YE+GVKINLS+SGLTKI+TF+PY+M++N++S+ + C + V + G      WI +  G+  PFWP +   + M+M C+V+ +  ++T  FP YES+++L+KL   ++G++ +VQ T+EA +INLQLY+EGMALV +IN +     +HF Q  T     L +   + Y W D  + R+F   V+  +K     +T+D  E F       + VSF+    R LLFTND  VA     S +LES+   I++ L S+G+SLV N L++E+ YISI SS + WN++RR NR KPLK   SEALE  ++ F+NR+  +E +  + +   + +     VDL++ +M++PE C L R FEPG+ LQYR SP+Q+ +H +I+++Q+D+Q  D +FPVVFAPFP P SV +D+G K L+E+  VI K+ +    R+K    LIQEMQ  LDQGF+N ++DF +GSV   DE   F+ D ++   +L++   +K +L  G++ + D  HISPIK+H+SFSL      +  +ALHS+VL LFLQS+G+A+TD+QDV+FKLGYFE++  IM  +++++ +  +Y  QA++Q YVL+LGLDV+GNPFGVIRGMAQGVEDLFYEPV+GAV+G EEF EGVA GV+SLFGH VGGAAGA+SRI GT+GKG+AALTLD +Y+R+RRE++ + P+N G G+A+GGKGL++G V GVTG++T+PI GA+K+G+EGFFKG+GKGL+G VTRPVSG+VDFASSSFEGIRR   T+ +V  +RPPRFI  DG+IR Y   EAEG+ I  ++ ++    P+E YVFH+  +  K +  LT +RI  +  NEILG  +I WQ    +L      ++S+H   + L+       + KLF   +  K+IE 
Sbjct:    1 MVFETLVADLLNRYLGNYLETLNASQLRLGLLSGNVSLENVDVRATAFDDFEIPARVVQGHIRTFFL-----HTYC----------YV--------AYNEAKEKQYRREAKRKTLEAIEELKQERQSEKGDS--PDSFFEKLAAQIIKNVQVKIENIHIRYEDQTTIPGVRFSTGLTLNRLAFQTCDSSGEPVVLSSDLSKEFFKLVELDSLAVYWNHDTKMYAGLPTGLLRNVMSSSVASSERTVVEIDYILRPISFNALLHVHMQPEKVQFTIPQVGVDLKFEEIEVEFQHNQYVGLVLLLDSVDRLMLRNKFWKYKSLIESKNYPRARWLFAYTAVLEEIVRRRSNMWSWKHIQEHRQMVREYTALWRKRLLKESLTPEQEGKIEYFEDELNVMNLALARQHAEVQAAKSRAAKESSRRGGGGWFSWFLGGSSSAASATATGDTLATCVRGDGPQVIQRVQQEMTPEEKEKLYAALNYSEGMSRCTYPPEYVSTAVKFSLGGLAIMLANNDLKNPGILKVQLNTVTSDFKQRVGDNAMEEDSV-DKCCSFGRPGPGGPNLHDKDAVSLKSLPRGFFGRYCCQFVLLCPCSFSVRLAGFEVVGPRNSSTDTAPILISSAVTGE--SLLSVDFAKNPIDRTADRCLFIAAAPLDVIYDADTVNKIVDFFKLPPGLRLDEISSSVMPSLDEMKAMTTTGLRHLLSRRTCLDLRVDIQPSCLLLPERGVYIEGCRLIMVDFGSVSLRSMLAHQDLARSETTSDQVSVASRASSALVGRAQSDERYKQLLQANYEQLLFEAYDQFEVTLSATQIILVQKGENWRELRSLADTPGHVLKPLGIKLVLRQCTAPLEFGLPQFQVDGRLPLLGIDFTDKVLESLCDIIAHVPLPETDPSQRIPTDPNALLKDVKFFDTKTEDLLPGQ-------LKAVHVLRMAETALAPPSPESDQADDEADVFFDSYETPEACISSAVQSSVRKPLA-NLVMICASFLVEEIRICMFEQTTSGDISDPPAP-MLKFVINEIGADFTLRKWDQEMNAHVNRLSLKAPRFKEYGSGNELCLIDTFSRSDDQTTPSSEHLFTAHLLIADKSGPDFATKYANTRHCLVCEFRVLKIHLHQEALVSLLGFFTDLAKVLAKDPELGAIEDKNQKALEWANRLGDTEASEHLQTSSVMTPHEARLSAAKTTPVDAVSGLLARK----NERRDIRL--DAVSEAAKM-----GRYLRIPEVDATQWKIQLTLDKVQVFFCS-SEMQLMAFSMRGMRVDLRMTYLTTEIAMALSDICISDLNETSLYRQILWIEPGANVFLMQTVLYNRGTKALDDQYDPEKVDVAVCLQFGKAHVIMLYWFLRRV---------------------------VIQEVVNQPLPPRLALSVNVEAPVIYMPQNSTSRTALVFDLGRISIKNHFEVIPKPVLSKNDPINMLMMDCMSVRLEDFKMSAAILVDGGVEIDRNVIQPINLSLNMNRKVFSSKGDGVPQLDVSGALESIRLSMTYGDYKLINEVFLDNFEEADSLMGSLPISNPTNVATSEDPVIVTELTTQK---AADVSTSDSLDSASEKSASWTFVLRRLEIELFRGTDDPRNWNDEIHASRRLGVFTCTELFLEGDSFDDTSSNMMARLKDISLIDTRPHSDEHITNILSQAGDSQGQMSNFIEVLYHSDNQSNQTLNVNVCSIMVCASLDYFMILSKFFTEGAHHRNRPAAKPSP--PPSQRTSVMKHRQPQRTTVSQNPGTLRIKTNIADPEIVLPEDMSNPNCNAILVTTSLNFDYAMLREETVMNASITKFRILACPFDRSQRDKNSMEVVVPTSVSFYARQPVAAALHGSINMESLLINVNAPIIRSISKIMNQLTESAMDVSLVPQTVGGSQHEKTLGDDGTEDFWSIKPVKASD-IPIPMGQIDYD--DSASEGTE-GCDVADILMKVDDERVEKASSILIRIGYVCLSMESQIGNKQVPMLLMEAHVDGEMKSPSTVLEVSLNFELTVSYYNDHVNEWEQLLETLPTEDNRLWSLQVGYHSAEQEFFYTKKEWQELSTLQNSGRLLTFISQDNLEITISKTALDVLSKLGKASFPRPIPGASFEEAYVSPRPVIPLRESIEI-KAPYVLRNQTGLRLMVVVDGQ---RLRTTDESISAKSASSLSLGAAQQKIGLVGHVLEAGQNLGFYDVHMNKIPTVQYLRSAPLAPPRFINIGLAPKSVDLIND--WGVFASRTAALKIHRTANYIVSAVSINDKEKSQPIVATITAFLGQKTLFLQSTLQVVNETPEAIRIFSLLSPT-FSDAVAQIQLLAIIAGGGSYS--LPVEIVTNKEITGIRMCPDLEGAAPSTDVIYWPPKVCPQTAKSENRGDTCIYLLPRLDSGRESEWPVQEVGCSVPLKAEAGAGKALYNYTITMERRFPEGQDGHPDFLQPPSSTTTEPVAYNMVIRAPASLHNHLPVPITFYLCDAISTVEPG-----HTAVLSSVKSSGFSVSVNFTYNKKDYLGAINISNRTEEMSLLPCETQDGYDISLLNLGLRCSRRLGHIDLTVYCPYWLVNKTGLSLTYKDQNELEFHHPAGFSDVFLFSV-----------TSKTALLQHKPSSKLHLQPVSSTD------HENAASDAVASTSSEHNCSKPFHSMHRGIRLIQKVKIAMRTEDSLWSSKFSLDTVGSWDRVHCEGKLGRSYEIGVKINLSASGLTKIITFMPYFMVVNKTSVAVECAQ-VRDIGKNILDTWIPIKAGDVKPFWPATGDTQKMLMTCRVDQK--VITDYFPLYESNTVLLKLPNPYIGLYTDVQTTDEATVINLQLYKEGMALVHIINDMDGGRNVHFYQKGTGVTHTLKSGYQMFYTWDDASKPRQFFTFVDNSQKTRQVEITTDSYETFVSGNANIHVVSFLSKLQRTLLFTNDPTVANLTAKSGELESVTDRISLVLQSVGISLVTNQLRKEVCYISIRSSDIIWNKMRRGNRLKPLKPDVSEALEDVYNTFLNRVAQNE-DFPKRVTLPDTIRPTTTVDLNQMVMLEPENCTLQRTFEPGMQLQYRASPNQIQIHAKIFRVQVDSQRLDAHFPVVFAPFPQPTSVVVDSGSKALVEVFTVICKTTDEEVYRFKRLECLIQEMQFQLDQGFLNDMIDFFAGSVIIQDELVGFLADQKLTSGALVDAPVVKDVLQTGRESIIDYIHISPIKMHVSFSLLGSSQESQPSALHSDVLKLFLQSLGVALTDVQDVVFKLGYFERRGRIMSFSKILTEMGRYYAGQAIKQTYVLILGLDVIGNPFGVIRGMAQGVEDLFYEPVKGAVVGTEEFAEGVALGVRSLFGHTVGGAAGAMSRITGTLGKGVAALTLDDEYKRRRREEMTRTPDNFGAGMARGGKGLVMGVVGGVTGIITQPILGARKEGVEGFFKGLGKGLIGTVTRPVSGMVDFASSSFEGIRRATSTSKDVLPVRPPRFIHLDGVIRPYDRNEAEGSIILSRLRDRS---PSEDYVFHIPLRRNKGICMLTTERILLVTMNEILGSCTIDWQAKLSQL------SDSQHKYEYGLELQLGNASKTKLFGGASNVKQIEC 3475          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. TrEMBL
Match: A0A068Y6L9 (Vacuolar protein sorting associated protein 13A OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000774600 PE=4 SV=1)

HSP 1 Score: 1720.67 bits (4455), Expect = 0.000e+0
Identity = 1114/3274 (34.03%), Postives = 1835/3274 (56.05%), Query Frame = 3
Query:  819 MKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRP-----NVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPD-GSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSIL---------------------IVSERTSMP-GSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESIL----REYSGKQLGIAPKLNLTSNQVLRAINVLPDSETA--SLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIV-------KLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQ------NLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLI------PVLNIVEEEKTETWSSPNK------EETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI---------DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKE-------------EVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDS---SDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVD----NFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAY-----SLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKV------------------YLKADGEVQLYDAVDEKQSLITEEKQA-----KIVKFGFA----DSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVST-TAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALW-------NIGKNAQPSDTQI-LLCKSNTG------------------------VMYYYSVALS----------IEEVQIVNSSETLR-TYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACL-KVQS---NIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQ-SLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKK-PVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG------WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLE----VDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFS-LSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLK-----EKQRKLFSKDNITKEIEA 10082
            M+P    FT+P++ +DLK ++I   F  NQY  +   LDS+DR   +N+F KY+      N P R++ S W  F Y  +LEE VRRR  MWSWK+IQ HR   R YT +W ++LL + L+  ++  ++  E+EL+++N+ L RQ AE++ +K +A K++ +           GG  S     +  +T ++       ++ ++V+ E T EEK KLY A+ YSE  +    P EYVS  +   L  L  ++++N LK   ++K+ ++++++  +QR   +A+  ++ +   +V G +     + P L+S+    +  +LL VDF  NP+D++A++ + I A PL++IYD+DTVN IV F   P  L+L EIS+ V+ S++E+K MT  GLRHL  RR   D+++DI+PS F+LPERG Y + C++++VD GS+                      + S  +S P G   +D  + +  + NY+ +   AYD+F + LST Q +++++G++WR+LRS   +  H+L+P G +  L++C+   +  LP+  V G LP LG+  +D+VL+S+ ++I H+P P+T P + +PT  + L    + +  K   + P         L+A++VL  +ETA    +   D+ D+E + F D+ E  +  +    + + +     N++ + A F++        ++I+  + E+  + +IV       K +++ IG   TL+++D  + A++  L L  P+F +  + + +CL  T   +  Q      +L   +LLI +K+ PDF T +ANTRH L C+F+ +++ LHQEAL+ +L F   L       P L  +E++  +     N+       E  + +++   +EA   + +     ++ GL+  +     E+R +RL  +AVSE +       G+ + IPE+  TQW I  +L K++V   +  +  ++  S+ GMR D++ +Y TTE+++ ++D+ I D +  ++Y++I+WIE   ++F MQ  L+N+GT     + D  +VD  V+++ GK  +I LY F+ R+  F++SF+++ +    KA E + AA  +I  V+ +P   R  L +NV+APVIY+P+NS S  AL+ DLG ++ KN F +         D    ++++   + L + ++S +IL++  V+ ++ ++ PIN+ ++M R +  ++   +PQ+ ++  + SI + M+ GDY +   V   NF EA + + S+P S               E+ ++K     D S S    S    +  + F +  L++ELF+G  +P  W  E+   + L    C  L +EG    +++  +  RL +I+++DT+  S + I  ++    +     S+FI + +  D  SN  L V++  I +C  +DY M+L+ FF +      +P  K        ++      ++P  + V    +   I   +A PEI+L EDM NP+ NAI+V T+    Y++++E  ++N  I+ F+ + CPF    R KN+M+++ PTS+S Y  +P+   + GS+ ME L+IN+   +I+SIS+IMN LT  + D +        +  ++ + D    +FW  +    ++ + I  G ++ +  ++ ++G E G DVA IL+ V+  R ++I +R+  + + +ES++  K VPML+ E  +DG++K+P T + + +   ++VSY+NDH+N WE LLE  P E NR +S ++EY S +    + ++++++L +++ S   +  +S+D LE+T+SK+ALDVLS LGK+FE+AY      + L +   I  APYV++N  G  ++  ++ +  L+  +     K                    L+A   +  YD    K   +   + A     + +  G A    D I+     I+ +    L      N   S  +++  E +  IV+T TA+LG K L L+S LQV N T   I ++ L   +  S+   +  LL  + GG  Y++P+  +             L     ++  ++          K+    DT I LL + ++G                        V+Y Y++ +            + +Q  +S+ T    Y + I  P +LHN LP+ I++        ++PG      TA L  V+S   ++ V + Y KK++ G++++  + EE+S++  + ++GY  S ++LG+  + + G  ++T+Y PYW++NKTG +LTYK  ++ +  H A  +D  LFS  SK+   +      + +++  DS +S + SLDTV S                                         W            G+V C+ K   +YE+GVKINLS+SGLTKI+TF+PY+MI+N++ + + C + V + G      WI +  G+  PFWP +   + M+M C+V+ +   +T  FP YES+++L+KL   ++G++ +VQ T+EA +INLQLY+EGMALV +IN +     +HF Q  T     L +   + Y W D  + R+F   V+  +K     +T+D  E F       + VSF+    R LLFTND  VA     S +LES+   I++ L S+G+SLV N L++E+ YISI SS + WN++RR NR KPLK   SEALE  ++ F+NR+  +E +  + +   + +     VDL++ +M++PE C L R FEPG+ +QYR SP+Q+ +H +I+++Q+D+Q  D +FPVVFAPFP P SV +D+G K L+E+  VI K+ +    R+K    LIQEMQ  LDQGF+N ++DF +GSV   DE   F+ D ++   +L++   +K +L  G++ + D  HISPIK+H+SFS L     +  +ALHS+VL LFLQS+G+A+TD+QDV+FKLGYFE++  IM  +++++ +  +Y  QA++Q YVL+LGLDV+GNPFGVIRGMAQGVEDLFYEPV+GAV+G EEF EGVA GVKSLFGH VGGAAGA+SRI GT+GKG+AALTLD +Y+R+RRE++ + P+N G G+A+GGKGL++G V GVTG++T+PI GA+K+G+EGFFKG+GKGL+G VTRPVSG+VDFASSSFEGIRR   T+ +V  +RPPRFI  DG+IR Y   EAEG+ I  ++ ++    P+E YVFH+  +  K +  LT +RI  +  NEILG  +I WQ    +L      ++S+H     L+       + KLF   +  K+IE 
Sbjct:    1 MQPGKVQFTIPQVGVDLKFDEIEVEFQHNQYVGLVLLLDSVDRLVLRNKFWKYKSLIESKNYP-RASTSRWL-FAYTAVLEEIVRRRSNMWSWKHIQEHRQMVREYTALWRKRLLKESLTPEQEAKLEYFEDELNVMNLALARQHAEVQAAKSRAAKESSRRGGGGWFSWFLGGSSSAASATTTGDTLATCVRVDGPQMIQRVQQEMTPEEKEKLYAALNYSEGMSRCTYPPEYVSTAVKFSLGGLAIMLANNDLKNPGILKVQLNTVTSDFKQRVGDNAMDFSVRLAGFEVVGPRNSSTDTAPILISSAVTGE--SLLSVDFAKNPIDRTADRCLFIAAAPLDVIYDADTVNKIVDFFKLPPGLRLDEISSSVMPSLDEMKAMTTAGLRHLLSRRTCLDLRIDIQPSCFLLPERGVYIEGCRLIMVDFGSVSLRSMLAHQDLARSETTSDQVSVASRASSAPVGRAQSDERYMQLLQANYEQLLLEAYDQFEVTLSTTQIILVQKGENWRELRSLADTPGHVLKPLGIKLVLRQCIAPLEFGLPQFQVDGRLPLLGIDFTDKVLESLCDIIAHVPLPETDPSQRIPTDPNALLKDVKFFDVKTEDLLPGQ-------LKAVHVLRMAETALAPPSPEFDQADDEADVFFDSYETPEACISSAVQSSVRKPLA-NLVMICASFLV--------EEIRICMFEQATSGDIVDPPAPMLKFVINGIGADFTLRKWDQEMNAHVNRLSLKAPRFKEYGSGNELCLIDTFSRSHDQTTPSSEHLFTAHLLIADKSGPDFATKYANTRHCLVCEFRVLKIHLHQEALVSLLGFFTDLAKVLAKDPELGAIEDKNQKALEWANRLGDTEASEHLQTSSVMTPHEARLSVAKTTPVDAVSGLLARK----NERRDIRL--DAVSEAAKM-----GRYLRIPEVDATQWKIQLTLDKVQVFFCS-SEMQLMAFSMRGMRVDLRMTYLTTEIAMALSDICISDLNETSLYRQILWIEPGANVFLMQTVLYNRGTKALDDQYDPEKVDVAVSLQFGKAHVIMLYWFLRRVVCFMDSFKDATEYAIEKASEVTGAAKTQIQEVVNQPLPPRLALSVNVEAPVIYMPQNSTSRTALVFDLGRISIKNHFEVIPKPVLSKNDPINMLMMDCMSVRLEDFKMSAAILVDGGVEIDRNVIQPINLSLNMNRKVFSSKGDGVPQLDVSGALESIRLSMTYGDYKLINEVFLDNFEEADSLMGSLPISNPTNVATSEDPVVVTELTTQKTA---DVSTSDSLGSASEKSAFWTFVLRRLEIELFRGTDDPRNWNDEIHASRRLGVFTCTELFLEGDSFDDTSSNMMARLKDISLIDTRPHSDEHITNILSQAGDSQGQMSNFIEVLYHSDNRSNQTLNVNVCSIMVCASLDYFMILSKFFTEGAHHRNRPAAKPS--PPPSQRTSTMKHRQPQRTTVSQNPSTLRIKTNIADPEIVLPEDMSNPNCNAILVTTSLNFDYAMLREETVMNASITKFRILACPFDRSQRGKNSMEVVVPTSVSFYARQPVAAALHGSINMESLLINVNAPIIRSISRIMNQLTESAMDVSLVPQTVGGSQHEKTLGDDGTEDFWSIKPVKASD-IPIPMGQVDYD--DSASEGTE-GCDVAGILMKVDDERVEKILIRINYVCLSMESQIGNKQVPMLLMEAHIDGEMKSPSTALGVSLYFELAVSYYNDHVNEWEQLLETLPTEGNRLWSLQVEYHSAEQESSYTKKEWQELSTLQNSGRLLTFISQDNLEITISKTALDVLSKLGKSFEEAYVSPRPVIPLRESVEI-KAPYVLRNQTGLRLMVVVDGQ-RLRTTDKSISAKSASSLSLGAAQQKIGLVGHVLEAGQNLGFYDVHMNKIPTVQYLRSAPLAPPRFINIGLAPKSVDLIND--WGIFASRTAGLKIHRTANYIVSAVSINAEEKSQPIVATITAFLGQKTLFLQSTLQVVNETPKAIRIFSLLPLT-LSDAVAHTQLLAIIAGGGSYSLPVEIVTNKEITGIRMCPDLEGAAPSTDVIYWPPKVCPQTAKSENRGDTCIYLLPRLDSGRESEWPVQEVGCSVPLKAEAGAGKVLYNYTITMERRFPKGQDGHPDFLQPPSSTTTEPVAYNMVIRAPASLHNHLPVPITFYLCDAISTVEPG-----HTAVLSSVKSSGFSVSVNFTYNKKDYLGAINISNRTEEMSLLPCETQDGYDISLLNLGLRCSRRLGHIDLTVYCPYWLVNKTGLSLTYKDQNELEFHHPAGFSDVFLFSVTSKTALLQ-----HKIVMRTEDSLWSSKFSLDTVGS-----------------------------------------W------------GRVHCEGKLGRSYEIGVKINLSASGLTKIITFMPYFMIVNKTPVAVECAQ-VRDIGKNILDTWIPIKAGDVKPFWPATGDTQKMLMTCRVDQKA--ITDYFPLYESNTVLLKLPNPYIGLYTDVQTTDEATVINLQLYKEGMALVHIINDMDGGRNVHFYQKGTGVTHTLKSGYQMFYTWDDASKPRQFFTFVDSSQKTRQVEITTDSYETFVSGNANIHVVSFLSKLQRTLLFTNDPIVANLTAKSGELESVTDRISLVLQSVGISLVTNQLRKEVCYISIRSSDIIWNKMRRGNRLKPLKPDVSEALEDVYNTFLNRVAQNE-DFPKRVTLPDTIRPTTTVDLNQMVMLEPENCTLQRTFEPGMQIQYRASPNQIQIHAKIFRVQVDSQRLDAHFPVVFAPFPQPASVVVDSGSKALVEVFTVICKTTDEEVYRFKRLECLIQEMQFQLDQGFLNDMIDFFAGSVIIQDELVGFLADQKLTSGALVDAPVVKDVLQTGRESIIDYIHISPIKMHVSFSLLGSSQESQPSALHSDVLKLFLQSLGVALTDVQDVVFKLGYFERRGRIMSFSKILTEMGRYYAGQAIKQTYVLILGLDVIGNPFGVIRGMAQGVEDLFYEPVKGAVVGTEEFAEGVALGVKSLFGHTVGGAAGAMSRITGTLGKGVAALTLDDEYKRRRREEMIRTPDNFGAGMARGGKGLVMGVVGGVTGIITQPILGARKEGVEGFFKGLGKGLIGTVTRPVSGMVDFASSSFEGIRRATSTSKDVLPVRPPRFIHLDGVIRPYDRNEAEGSIILSRLRDRS---PSEDYVFHIPLRRNKGICMLTTERILLVTMNEILGSCTIDWQAKLSQL------SDSQHKYECGLELQLGNASKTKLFGGTSNVKQIEC 3152          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. TrEMBL
Match: A0A068WCF9 (Vacuolar protein sorting associated protein 13A OS=Echinococcus granulosus OX=6210 GN=EgrG_000774600 PE=4 SV=1)

HSP 1 Score: 1710.66 bits (4429), Expect = 0.000e+0
Identity = 1118/3270 (34.19%), Postives = 1831/3270 (55.99%), Query Frame = 3
Query:  819 MKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRP-----NVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPD-GSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSI----------LIVSERTS------------MPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESIL----REYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXX--XXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQ------NLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLI------PVLNIVEEEKTETWSSPNK------EETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI---------DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKE-------------EVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDS---SDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDN----FWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYS-----LHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKV--------------------YLKADGEVQLYDAVDEKQSLITEEKQA-----KIVKFGFA----DSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVST-TAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGK---IYISVKQLNTEISNSGALW------NIGKNAQPSDTQI-LLCKSNTG------------------------VMYYYSVALS----------IEEVQIVNSSETLR-TYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLK-VQSN---IKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQ-SLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG------WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLE----VDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFS-LSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLK-----EKQRKLFSKDNITKEIEA 10082
            M+PE   FT+P++ +DLK E+I   F  NQY  +   LDS+DR   +N+F KY+      N P R++ S W  F Y  +LEE VRRR  MWSWK+IQ HR   R YT +W ++LL + L+  ++  I+  E+EL+++N+ L RQ AE++ +K +A K++ +           GG  S     +  +T ++       ++ ++V+ E T EEK KLY A+ YSE  +    P EYVS  +   L  L  ++++N LK   ++K+ ++++++  +QR   +A+  ++ +   +V G +     + P L+S+    +  +LL VDF  NP+D++A++ + I A PL++IYD+DTVN IV F   P  L+L EIS+ V+ S++E+K MT TGLRHL  RR   D++VDI+PS  +LPERG Y + C++++VD GS+          L  SE TS            + G   +D  + +  + NY+ +   AYD+F + LS  Q +++++G++WR+LRS   +  H+L+P G +  L++C    +  LP+  V G LP LG+  +D+VL+S+ ++I H+P P+T P + +PT  + L    + +  K   + P         L+A++VL  +ETA    + + D    E + F D+ E  +  +    + + +     N++ + A F++    + + +   +  +    A  ++K +++EIG   TL+++D  + A++  L L  P+F +  + + +CL  T   +  Q      +L   +LLI +K+ PDF T +ANTRH L C+F+ +++ LHQEAL+ +L F   L       P L  +E++  +     N+       E  + +++   +EA     +     ++ GL+  +     E+R +RL  +AVSE +       G+ + IPE+  TQW I  +L K++V   +  +  ++  S+ GMR D++ +Y TTE+++ ++D+ I D +  ++Y++I+WIE   ++F MQ  L+N+GT     + D  +VD  V ++ GK  +I LY F+ R+ +F++SF+ + +    KA E + AA  +I  V+ +P   R  L +NV+APVIY+P+NS S  AL+ DLG ++ KN F +         D    ++++   + L + ++S +IL++  V+ ++ ++ PIN+ ++M R +  ++   +PQ+ ++  + SI + M+ GDY +   V   NF EA + + S+P S               E+ ++K     D S S    S    +  + F +  L++ELF+G  +P  W  E+   + L    C  L +EG    +++  +  RL +I+++DT+  S + I  ++    +     S+FI + +  D  SN  L V++  I +C  +DY M+L+ FF +      +P  K        ++      ++P  + V        I   +A PEI+L EDM NP+ NAI+V T+    Y++++E  ++N  I+ F+ + CPF    R KN+M+++ PTS+S Y  +P+   + GS+ ME L+IN+   +I+SISKIMN LT  + D +        +  ++ + D+    FW  +    ++ + I  G ++ +  ++ ++G E G DVA IL+ V+  R ++I +R+  + + +ES++  K VPML+ E  +DG++K+P T + + +   ++VSY+NDH+N WE LLE  P E NR +S ++ Y S +    + ++++++L +++ S   +  +S+D LE+T+SK+ALDVLS LGK+FE+AY      + L +   I  APYV++N  G  ++  ++ +   +   +DE                         L+A   +  YD    K   +   + A     + +  G A    D I+     ++ +   AL      N   S  +++++E +  IV+T TA+LG K L L+S LQV N T + I ++ L   +     A+  LL   + GG  Y+  +P  + +N +   I +         S     W         K+    DT I LL + ++G                         +Y Y++ +            + +Q  +S+ T    Y + I  P +LHN LP+ I++        ++PG      TA L  V+S+   + V + Y KK++ G++++  + EE+S++  + ++GY  S ++LG+  + + G  ++T+Y PYW++NKTG +LTYK  ++ +  H A  +D  LFS  SK+   +      +  ++  DS +S + SLDTV S                                         W      D V   GK+       +YE+GVKINLS+SGLTKI+TF+PY+M++N++S+ + C + V + G      WI +  G+  PFWP +   + M+M C+V+ +  ++T  FP YES+++L+KL   ++G++ +VQ T+EA +INLQLY+EGMALV +IN +     +HF Q  T     L +   + Y W D  + R+F   V+  +K     +T+D  E F       + VSF+    R LLFTND  VA     S +LES+   I++ L S+G+SLV N L++E+ YISI SS + WN++RR NR KPLK   SEALE  ++ F+NR+  +E +  + +   + +     VDL++ +M++PE C L R FEPG+ LQYR SP+Q+ +H +I+++Q+D+Q  D +FPVVFAPFP P SV +D+G K L+E+  VI K+ +    R+K    LIQEMQ  LDQGF+N ++DF +GSV   DE   F+ D ++   +L++   +K +L  G++ + D  HISPIK+H+SFS L     +  +ALHS+VL LFLQS+G+A+TD+QDV+FKLGYFE++  IM  +++++ +  +Y  QA++Q YVL+LGLDV+GNPFGVIRGMAQGVEDLFYEPV+GAV+G EEF EGVA GV+SLFGH VGGAAGA+SRI GT+GKG+AALTLD +Y+R+RRE++ + P+N G G+A+GGKGL++G V GVTG++T+PI GA+K+G+EGFFKG+GKGL+G VTRPVSG+VDFASSSFEGIRR   T+ +V  +RPPRFI  DG+IR Y   EAEG+ I  ++ ++    P+E YVFH+  +  K +  LT +RI  +  NEILG  +I WQ    +L      ++S+H   + L+       + KLF   +  K+IE 
Sbjct:    1 MQPEKVQFTIPQVGVDLKFEEIEVEFQHNQYVGLVLLLDSVDRLMLRNKFWKYKSLIESKNYP-RASTSRWL-FAYTAVLEEIVRRRSNMWSWKHIQEHRQMVREYTALWRKRLLKESLTPEQEGKIEYFEDELNVMNLALARQHAEVQAAKSRAAKESSRRGGGGWFSWFLGGSSSAASATATGDTLATCVRGDGPQVIQRVQQEMTPEEKEKLYAALNYSEGMSRCTYPPEYVSTAVKFSLGGLAIMLANNDLKNPGILKVQLNTVTSDFKQRVGDNAMDFSVRLAGFEVVGPRNSSTDTAPILISSAVTGE--SLLSVDFAKNPIDRTADRCLFIAAAPLDVIYDADTVNKIVDFFKLPPGLRLDEISSSVMPSLDEMKAMTTTGLRHLLSRRTCLDLRVDIQPSCLLLPERGVYIEGCRLIMVDFGSVSLRSMLAHQDLARSETTSDQVSVASRASSALVGRAQSDERYKQLLQANYEQLLFEAYDQFEVTLSATQIILVQKGENWRELRSLADTPGHVLKPLGIKLVLRQCTAPLEFGLPQFQVDGRLPLLGIDFTDKVLESLCDIIAHVPLPETDPSQRIPTDPNALLKDVKFFDTKTEDLLPGQ-------LKAVHVLRMAETALAPPSPESDQADDEADVFFDSYETPEACISSAVQSSVRKPLA-NLVMICASFLVEEIRICMFEQTTSGDISDPPAP-MLKFVINEIGADFTLRKWDQEMNAHVNRLSLKAPRFKEYGSGNELCLIDTFSRSDDQTTPSSEHLFTAHLLIADKSGPDFATKYANTRHCLVCEFRVLKIHLHQEALVSLLGFFTDLAKVLAKDPELGAIEDKNQKALEWANRLGDTEASEHLQTSSVMTPHEARLSAAKTTPVDAVSGLLARK----NERRDIRL--DAVSEAAKM-----GRYLRIPEVDATQWKIQLTLDKVQVFFCS-SEMQLMAFSMRGMRVDLRMTYLTTEIAMALSDICISDLNETSLYRQILWIEPGANVFLMQTVLYNRGTKALDDQYDPEKVDVAVCLQFGKAHVIMLYWFLRRVVSFMDSFKNATEYAIEKASEVTGAAKTQIQEVVNQPLPPRLALSVNVEAPVIYMPQNSTSRTALVFDLGRISIKNHFEVIPKPVLSKNDPINMLMMDCMSVRLEDFKMSAAILVDGGVEIDRNVIQPINLSLNMNRKVFSSKGDGVPQLDVSGALESIRLSMTYGDYKLINEVFLDNFEEADSLMGSLPISNPTNVATSEDPVIVTELTTQK---AADVSTSDSLDSASEKSASWTFVLRRLEIELFRGTDDPRNWNDEIHASRRLGVFTCTELFLEGDSFDDTSSNMMARLKDISLIDTRPHSDEHITNILSQAGDSQGQMSNFIEVLYHSDNQSNQTLNVNVCSIMVCASLDYFMILSKFFTEGAHHRNRPAAKPSP--PPSQRTSVMKHRQPQRTTVSQNPGTLRIKTNIADPEIVLPEDMSNPNCNAILVTTSLNFDYAMLREETVMNASITKFRILACPFDRSQRDKNSMEVVVPTSVSFYARQPVAAALHGSINMESLLINVNAPIIRSISKIMNQLTESAMDVSLVPQTVGGSQHEKTLGDDGTEDFWSIKPVKASD-IPIPMGQIDYD--DSASEGTE-GCDVADILMKVDDERVEKILIRIGYVCLSMESQIGNKQVPMLLMEAHVDGEMKSPSTVLEVSLNFELTVSYYNDHVNEWEQLLETLPTEDNRLWSLQVGYHSAEQEFFYTKKEWQELSTLQNSGRLLTFISQDNLEITISKTALDVLSKLGKSFEEAYVSPRPVIPLRESIEI-KAPYVLRNQTGLRLMVVVDGQ---RLRTTDESISAKSASSLSLGAAQQKIGLVGHVLEAGQNLGFYDVHMNKIPTVQYLRSAPLAPPRFINIGLAPKSVDLIND--WGVFASRTAALKIHRTANYIVSAVSINDKEKSQPIVATITAFLGQKTLFLQSTLQVVNETPEAIRIFSLLSPTFSDAVAQTQLL-AIIAGGGSYS--LPVEIVTNKEITGIRMCPDLEGAAPSTDVIYWPPKVCPQTAKSENRGDTCIYLLPRLDSGRESEWPVQEVGCSVPLKAEAGAGKALYNYTITMERRFPEGQDGHPDFLQPPSSTTTEPVAYNMVIRAPASLHNHLPVPITFYLCDAISTVEPG-----HTAVLSSVKSSGFSVSVNFTYNKKDYLGAINISNRTEEMSLLPCETQDGYDISLLNLGLRCSRRLGHIDLTVYCPYWLVNKTGLSLTYKDQNELEFHHPAGFSDVFLFSVTSKTALLQ-----HKIAMRTEDSLWSSKFSLDTVGS-----------------------------------------W------DRVHCEGKL-----GRSYEIGVKINLSASGLTKIITFMPYFMVVNKTSVAVECAQ-VRDIGKNILDTWIPIKAGDVKPFWPATGDTQKMLMTCRVDQK--VITDYFPLYESNTVLLKLPNPYIGLYTDVQTTDEATVINLQLYKEGMALVHIINDMDGGRNVHFYQKGTGVTHTLKSGYQMFYTWDDASKPRQFFTFVDNSQKTRQVEITTDSYETFVSGNANIHVVSFLSKLQRTLLFTNDPTVANLTAKSGELESVTDRISLVLQSVGISLVTNQLRKEVCYISIRSSDIIWNKMRRGNRLKPLKPDVSEALEDVYNTFLNRVAQNE-DFPKRVTLPDTIRPTTTVDLNQMVMLEPENCTLQRTFEPGMQLQYRASPNQIQIHAKIFRVQVDSQRLDAHFPVVFAPFPQPTSVVVDSGSKALVEVFTVICKTTDEEVYRFKRLECLIQEMQFQLDQGFLNDMIDFFAGSVIIQDELVGFLADQKLTSGALVDAPVVKDVLQTGRESIIDYIHISPIKMHVSFSLLGSSQESQPSALHSDVLKLFLQSLGVALTDVQDVVFKLGYFERRGRIMSFSKILTEMGRYYAGQAIKQTYVLILGLDVIGNPFGVIRGMAQGVEDLFYEPVKGAVVGTEEFAEGVALGVRSLFGHTVGGAAGAMSRITGTLGKGVAALTLDDEYKRRRREEMTRTPDNFGAGMARGGKGLVMGVVGGVTGIITQPILGARKEGVEGFFKGLGKGLIGTVTRPVSGMVDFASSSFEGIRRATSTSKDVLPVRPPRFIHLDGVIRPYDRNEAEGSIILSRLRDRS---PSEDYVFHIPLRRNKGICMLTTERILLVTMNEILGSCTIDWQAKLSQL------SDSQHKYEYGLELQLGNASKTKLFGGASNVKQIEC 3152          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Cavefish
Match: vps13a (vacuolar protein sorting 13 homolog A [Source:ZFIN;Acc:ZDB-GENE-030926-1])

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 679/2287 (29.69%), Postives = 1098/2287 (48.01%), Query Frame = 3
Query: 3468 ITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTS-----VVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPES-KEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKN--DSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLA----SPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLT--AQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSF-------EIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFG---APYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSIS-REYLSIYRTEVRALLFSPKDNEGPS--------RGNVSEREINT-----LIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPT------LLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQI-LLCKSNTGVMYYYSVALSI--EEVQIVNSSETL-RTYKLDINVPLALHNQLPIKISYQSQIFSH----DIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAK------EG-YSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSS-IVLYCNELVENAGWIKVPPGEA-VPFWPRSEVGKSMMMR---CKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDD-VEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWN-QIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVE-GLEVDLSKK----LMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFV----SGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTG-KTALHSEV-----LNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKN---VIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEI 10076
            I A L  L+V +  EK   I +ISI G        +Y   VSI                        D+ +F  ++  +   T    Y +D+  VD  V + VG I++IFL  FV  +  F+N+FQE+ + +A    + +E AA  +  + E+  S+R  LD+++KAPV+++P++S S N ++ DLG +T KN F I  S S      +L+   + LS+L++ R+   +   + E  +L P+N+ + + RNLS +  H++P I I A +  +S+ +SQ D  +    L  N +E  + VP+   S K E  S K     +  GS  T    +  V+ G K                             K+K EN         N +M  SV+L+   +LD +    K I   +  ++   + +  + + + Q +   +   V +  +Y+C  +++L+ + D F+KA               +G+   P+  ++   A    +P +P  +  E+++ V  PEI+ V D+   D+ A+++ T   L       S  +   I+D + V CPF  + +  N   ++ P  +     +         L++  L + ++P +I ++  I + LT  A++ +E  +            +  + WE+R++ + +  F+ +            +G E    V  ++      + + + LR+  I + LE+ V  + VPML+ + S  GD+KN  T I L   +++ V+Y+N+ + VWEPLLE  P E + +  F       +++    + SG+ DE D+  ++    + ISI   S+D L +T++K  L++LSNLG AF +A     +Q    F    AP+VVKN  G  V    ++ F  KP     + +     DGE     +++   +L T    A   +F    S+S + Y+         + FSP  +   S        RG  S   +++      I   ++  G K +++RS  Q  N+      ++                      G  C  V +P       L +   ++ +       E       ++  + +Q  D  +   C+ ++   + + V +    + V  +N+ E   + Y L +   + L N LP  I+Y            +K G    + TA +   S       Y +++W     L    +E++ I F++       +G  S + +D+ VH+  + GQA V ++SP        Y +  K G   Q + D                           I +K    Y +  L                         + K + F +  K  L I+DS  SD FS+DTVGS G V CK +   Y VGVKI+ SS  LT++VT LP+YM++N++  ++  C E  +   W +  PGEA VPFWP  E  K M ++   C+     +   QP      + +L+ L+    GI V+V +TE + +I    Y +G A   LINH  D  +E +   +   +E + P  + V Y W +    R   W       +  N    D ++D   +E K + +SF     R++LFT +  + K    S  +E  +QEI+++L  +G+SLV+NS  QE+AYI ITSS V W  + ++K+R K L    +E LE  +  +V       + V+  ++ +E G +V L+       M++P    L R F P + ++Y  S  Q    ++I ++QI NQ+    FP VF P  PP+SV +D+  KP  ++S +   +G +  +R KYF+VLIQEM L +D GF+ +IL+      +G+V +  E  +F KD + ++  L   S   T        +++ FHISPIK+HLSFSLS     G KT   +E+     LNL L+S+G  +TD+QDV+FKL +FE         Q+   +  HY  QA++QMYVLVLGLDVLGNPFG+IRG+++GVE  FYEP +GA+ GPEEFVEG+A GVK+L G AVGG AGA SRI G M KG+AA+T+D +YQ+KRRE + K+P  L  GL +GGKGL+ GFV G+TG+VTKPI GA+K+G  GFFKGVGKGLVG VTRP  G++D ASS+F+GI+R A+T+ +V  +RPPRFI +DG+IR Y  RE  G+ +  KI             +  +  +K N    + +T + IF + +    G  + +WQ  +++    P I E +  +    KE+ + +F      K I
Sbjct: 1077 IRADLSCLKVFIRGEK-ARISEISIEG------KLHYIIAVSIA-----------------------DKEVFDFRMVNYVDATEGDAY-MDMQIVDTSVTLTVGCIQVIFLNKFVSSVLAFINNFQEAKEALAEVTVQAAEKAATGVLELAEK--STRISLDVDIKAPVVFLPQSSISTNVIVADLGLVTVKNHFEIVPSPSHTKIPPILDVMSVALSDLKMYRTTFKDEKFQTEIQLLKPVNMDLSIKRNLSASWYHSLPDIQINAHLKPMSLILSQEDMIVVLRTLSENLSETSDAVPAPKGSDKAETSSTK-----ESQGSGGTTVVTAAVVE-GQKA---------------------------AKLKIENE--------NDSMTASVKLAEC-LLDDKRKIVKMITSRMMAMRKGAEQNTMVDVNYRQGREGTTLETV-VQDLYLCASMEFLLTVADIFMKAM-------------AQGFSSPPKSNKQTSTATKDAAPAQPAASKMEMNIVVKNPEIVFVADLTRADAPALVMTTQCELLMKSDPNSQQMTAAITDLKVVACPFVHKQQDSNITTVLQPCQVFFTSKQSPTQPQAIELSINSLTLKVSPIIINTVITIQSALTPAAETPEELESP-----------VPPDLWERRDWKDLKLWFLEE------------EGEEDTQSVTPLI-----PQGESLQLRISSICLTLEAGVGHRTVPMLLAKSSFHGDVKNWSTLINLHCHLNMEVNYYNEIMGVWEPLLE--PLEDDTKDGFRPWTLDLKMKKKQANRSGISDEVDY--IVPDYKTVISIT--SKDQLNITLTKCGLNMLSNLGTAFAEA----AKQTAECFQKDQAPFVVKNRLGLPVSVLYSEVF--KPIGVQSKGRTVELQDGE-----SLNMDYTLTT----ADADQFSAMTSLSSKNYIQ------PTVYFSPVGHTTASVIPLIKVGRGMYSVMHLDSGVTRFFICQISSNEGSKFVKIRSPFQFINHFSVPFRVFE---------------------GSTCLGVSLPNEEFCVPLGSYKAQLSLQPAAEGDEQYECSESFSYDEVSQKPDECVEKTCRHHSSDAHVFKVNMVAVRDTVTSLNAQEEFDKPYVLHLWPTVLLRNLLPYPITYSLLAIGSPTPTQLKEGHSSQLHTAVMDHSSLELKLLGYLQQDWVAHYHLRNDHDEINFITFRSALQDDDVDGESSRAELDIAVHVKKEAGQAVVAVHSP--------YWMVNKTGRLLQYKADD--------------------------IHRKHPKDYDMPLL------------------------FSFKPRNFLQNNKVRLMISDSELSDDFSIDTVGSYGDVKCKGRAKDYLVGVKIDASSFSLTRLVTVLPFYMLVNRTKHVIRVCEEGQDE--WTEAQPGEAAVPFWPERE-SKKMKVKVDGCQTAAHTINFHQP-----ENCLLLHLDNTLGGIIVDVNLTEHSAVIRFSDYHDGAAPFLLINHTKDKTLEFYQSSHQQEKEELAPG-RAVYYTWAEPTGSRVLRWSWGPYSAELKNE--EDLLKDVN-DEGKLFVISFYEGLQRVVLFTTERRIYKLLCESERVELAEQEISLALQDMGISLVNNSTSQEIAYIGITSSDVVWEIKPKKKSRWKVLNGKDAEMLEQHYKSYVE-----SSPVDHSLLDLENGYQVCLTPNSVDMRMLQPYDAPLRRNFLPALKVEYSVSARQKAYRVQINRVQIQNQLPGAIFPFVFYPIKPPKSVRMDSEPKPFTDVSIITRAAGHSDILRIKYFKVLIQEMDLRMDLGFLYAILELFTAENAGTVTSEQEVELFEKDIEYLKTGLNPVSATDT----SPISLYEYFHISPIKLHLSFSLSSGGEDGNKTKRETEMIPVQSLNLLLKSIGATLTDVQDVVFKLAFFELTFQFRTTQQLQWEVIRHYSKQAIKQMYVLVLGLDVLGNPFGLIRGLSEGVEAFFYEPYQGAIQGPEEFVEGMALGVKALVGGAVGGLAGAASRITGAMAKGVAAMTMDEEYQQKRREAMNKQPSGLKEGLTRGGKGLVSGFVSGITGIVTKPIKGAQKEGAAGFFKGVGKGLVGAVTRPTGGIIDMASSTFQGIKRAAETSQDVESLRPPRFIHEDGVIRPYKEREGFGSQMLQKIEN------GRFAKYRYFAHAKVNDSDFLMITKRGIFFVTKG-TFGQLTCEWQYLFDEFTKDPMIVEDRR-LRIEAKERVKSVFHAKEFGKII 3111          

HSP 2 Score: 571.237 bits (1471), Expect = 3.871e-163
Identity = 360/1068 (33.71%), Postives = 586/1068 (54.87%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLK---RNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPET-TNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSS-------SLASDGSDELQKKVRSEF----TQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSE-RTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTE---SILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINS 3170
            MVFESLVV+++N++LGDYVV LD SQL LG+ GG+A L NL+IKENA    D+P KVR GHI +L LKIPWK+LY++ V A LD +Y+LI+P + +KYD EKE   L E +Q+EL RIEE K K   + +PK  TE +D+F EKL  Q++KNLQ+ ISNIH+RYED  T PN   + G++L NLS QT D++    ++ E + + FFK V++D+L  YWN N + +S+         ++ N++       D +F+ +PIS +A +   M P +  +F+ P++ L + L ++    +R QY  I   L S+D       +RKYRP VP+ +N   WW +  + +LE  V+ R  MWSW++I+ HR   + Y ++++ K+  KK ++     ++  E+ LD+ NITL RQQAEM+                    + +G        K + E S        + + DGS   ++     F    T  EKAKLY AIGYSE   +P++P  +  +K+  +L  +   I ++  K  ++++L +  +SA + QR SA AI +   ++  +VTG    + +   L S +   +   LL + FETNPLD  A+Q++++ ++PLEIIYD+ TVN +  F  PP +LQL E++      +E+ ++ T+TGL ++ + +   D+ +++  SY I+P+ G Y     + ++DLG   + S+ + ++P      L+ G       D+M   AYD F I LS++Q L  +   DW+K R +  S  HIL P   +    + ++  D+ +PK  + G LP L + ISD  ++ VLELI  IP P++ PP     T+    +L++    QL   P+    ++  LR+ +++ DSE             +   F+ +   ++ +  + ++   K    KNM +    F I+   +Q+L+      +       ++ L +  +GT L L+ FDM+   ++  + L   ++ D   +  V L  T  +T+  +LL +  +  +K +PDF + + NT   ++  F S+++ LH EALL  +NF+NS
Sbjct:    1 MVFESLVVDVLNRFLGDYVVNLDSSQLNLGIWGGDAILRNLEIKENALSQLDIPFKVRAGHIGRLELKIPWKNLYTQSVEATLDEVYLLIVPTASIKYDAEKEEKQLQEARQRELQRIEETKQKAAEQENPK--TEKQDTFVEKLVTQVIKNLQVKISNIHVRYEDDVTNPNCPLSFGVSLQNLSLQTADANWKPCLLDEKA-KLFFKLVRLDNLFAYWNVNSELYSNHTPPEALRRLQQNVAVQNSIPHDYNFIFRPISANAKLR--MNPRSDVDFSSPKVDLVVNLPEVAVELSRPQYVSILELLGSVDMMSRNLPYRKYRPCVPVHNNAYNWWRYVISSVLEVNVKPRLHMWSWQHIRRHRQLAKQYKELYKTKITSKKPTEVVLKKLEDTEKTLDIFNITLARQQAEMEA-------------------SKAGLRIYRPGVKMEEEQSQGWFGWMWNWSGDGSTPAKEAKPGGFDTLMTPAEKAKLYTAIGYSETAVNPNLPKSFEDMKVRFQLVSMSVSIKESREKP-EIIRLSVIGLSATLTQRPSAQAIKIIAQLSTFEVTGLPRSNVAPMLLSSRRVVEENKPLLSLMFETNPLDAKADQRLHVESQPLEIIYDATTVNSLSAFFMPPNDLQLDELTNATRMKLEQFRDRTSTGLMYIIETQKVLDLNINLMASYVIVPQMGFYDPSHNLAILDLGHFQMSSQSKANLP-----QLLAG--SSTIEDIMSR-AYDSFDIQLSSLQFLYTKPDGDWKKARKERQSALHILEPVDLKVVFSRAMVVTDSRMPKFKMSGELPLLSLRISDDKVRGVLELIDSIPLPESRPPPRAAATQVTPKVLKQRDTPQL--TPRRPAMTD--LRS-SIIFDSEEDLFFDAPSSPIEDLPFFEASPGALERSASVKRRSMVKQDPKKNMTEFLMNFEISKLSIQLLR------LSAGQEVPVLHLEIEGLGTELKLRTFDMSSYTFLREICLECSEYQDGDGRK-VHLITTLDNTE-DDLLTLEYVKADKNAPDFKSAYKNTEQLIKVNFSSLDIHLHTEALLNSMNFLNS 1022          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Cavefish
Match: vps13a (vacuolar protein sorting 13 homolog A [Source:ZFIN;Acc:ZDB-GENE-030926-1])

HSP 1 Score: 570.852 bits (1470), Expect = 4.566e-163
Identity = 360/1068 (33.71%), Postives = 587/1068 (54.96%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLK---RNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPET-TNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSS-------SLASDGSDELQKKVRSEF----TQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSE-RTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTE---SILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINS 3170
            MVFESLVV+++N++LGDYVV LD SQL LG+ GG+A L NL+IKENA    D+P KVR GHI +L LKIPWK+LY++ V A LD +Y+LI+P + +KYD EKE   L E +Q+EL RIEE K K   + +PK  TE +D+F EKL  Q++KNLQ+ ISNIH+RYED  T PN   + G++L NLS QT D++    ++ E + + FFK V++D+L  YWN N + +S+         ++ N++       D +F+ +PIS +A +   M P +  +F+ P++ L + L ++    +R QY  I   L S+D       +RKYRP VP+ +N   WW +  + +LE  V+ R  MWSW++I+ HR   + Y ++++ K+  KK ++     ++  E+ LD+ NITL RQQAEM+                    + +G        K + E S        + + DGS   ++     F    T  EKAKLY AIGYSE   +P++P  +  +K+  +L  +   I + S ++ ++++L +  +SA + QR SA AI +   ++  +VTG    + +   L S +   +   LL + FETNPLD  A+Q++++ ++PLEIIYD+ TVN +  F  PP +LQL E++      +E+ ++ T+TGL ++ + +   D+ +++  SY I+P+ G Y     + ++DLG   + S+ + ++P      L+ G       D+M   AYD F I LS++Q L  +   DW+K R +  S  HIL P   +    + ++  D+ +PK  + G LP L + ISD  ++ VLELI  IP P++ PP     T+    +L++    QL   P+    ++  LR+ +++ DSE             +   F+ +   ++ +  + ++   K    KNM +    F I+   +Q+L+      +       ++ L +  +GT L L+ FDM+   ++  + L   ++ D   +  V L  T  +T+  +LL +  +  +K +PDF + + NT   ++  F S+++ LH EALL  +NF+NS
Sbjct:    1 MVFESLVVDVLNRFLGDYVVNLDSSQLNLGIWGGDAILRNLEIKENALSQLDIPFKVRAGHIGRLELKIPWKNLYTQSVEATLDEVYLLIVPTASIKYDAEKEEKQLQEARQRELQRIEETKQKAAEQENPK--TEKQDTFVEKLVTQVIKNLQVKISNIHVRYEDDVTNPNCPLSFGVSLQNLSLQTADANWKPCLLDEKA-KLFFKLVRLDNLFAYWNVNSELYSNHTPPEALRRLQQNVAVQNSIPHDYNFIFRPISANAKLR--MNPRSDVDFSSPKVDLVVNLPEVAVELSRPQYVSILELLGSVDMMSRNLPYRKYRPCVPVHNNAYNWWRYVISSVLEVNVKPRLHMWSWQHIRRHRQLAKQYKELYKTKITSKKPTEVVLKKLEDTEKTLDIFNITLARQQAEMEA-------------------SKAGLRIYRPGVKMEEEQSQGWFGWMWNWSGDGSTPAKEAKPGGFDTLMTPAEKAKLYTAIGYSETAVNPNLPKSFEDMKVRFQLVSMSVSIKE-SREKPEIIRLSVIGLSATLTQRPSAQAIKIIAQLSTFEVTGLPRSNVAPMLLSSRRVVEENKPLLSLMFETNPLDAKADQRLHVESQPLEIIYDATTVNSLSAFFMPPNDLQLDELTNATRMKLEQFRDRTSTGLMYIIETQKVLDLNINLMASYVIVPQMGFYDPSHNLAILDLGHFQMSSQSKANLP-----QLLAG--SSTIEDIMSR-AYDSFDIQLSSLQFLYTKPDGDWKKARKERQSALHILEPVDLKVVFSRAMVVTDSRMPKFKMSGELPLLSLRISDDKVRGVLELIDSIPLPESRPPPRAAATQVTPKVLKQRDTPQL--TPRRPAMTD--LRS-SIIFDSEEDLFFDAPSSPIEDLPFFEASPGALERSASVKRRSMVKQDPKKNMTEFLMNFEISKLSIQLLR------LSAGQEVPVLHLEIEGLGTELKLRTFDMSSYTFLREICLECSEYQDGDGRK-VHLITTLDNTE-DDLLTLEYVKADKNAPDFKSAYKNTEQLIKVNFSSLDIHLHTEALLNSMNFLNS 1022          

HSP 2 Score: 514.227 bits (1323), Expect = 1.110e-145
Identity = 419/1210 (34.63%), Postives = 622/1210 (51.40%), Query Frame = 3
Query: 6654 CKSNTGVMYYYSVALSI--EEVQIVNSSETL-RTYKLDINVPLALHNQLPIKISYQSQIFSH----DIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAK------EG-YSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSS-IVLYCNELVENAGWIKVPPGEA-VPFWPRSEVGKSMMMR---CKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINH-------------------------------LGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWN-QIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVE-GLEVDLSKK----LMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFV----SGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTG-KTALHSEV-----LNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKN---VIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEI 10076
            C+ ++   + + V +    + V  +N+ E   + Y L +   + L N LP  I+Y            +K G    + TA +   S       Y +++W     L    +E++ I F++       +G  S + +D+ VH+  + GQA V ++SP        Y +  K G   Q + D                           I +K    Y +  L                         + K + F +  K  L I+DS  SD FS+DTVGS G V CK +   Y VGVKI+ SS  LT++VT LP+YM++N++  ++  C E  +   W +  PGEA VPFWP  E  K M ++   C+     +   QP      + +L+ L+    GI V+V +TE + +I    Y +G A   LINH                               LG+D E         +EL  P  + V Y W +    R   W       +  N    D ++D   +E K + +SF     R++LFT +  + K    S  +E  +QEI+++L  +G+SLV+NS  QE+AYI ITSS V W  + ++K+R K L    +E LE  +  +V       + V+  ++ +E G +V L+       M++P    L R F P + ++Y  S  Q    ++I ++QI NQ+    FP VF P  PP+SV +D+  KP  ++S +   +G +  +R KYF+VLIQEM L +D GF+ +IL+      +G+V +  E  +F KD + ++  L   S   T        +++ FHISPIK+HLSFSLS     G KT   +E+     LNL L+S+G  +TD+QDV+FKL +FE         Q+   +  HY  QA++QMYVLVLGLDVLGNPFG+IRG+++GVE  FYEP +GA+ GPEEFVEG+A GVK+L G AVGG AGA SRI G M KG+AA+T+D +YQ+KRRE + K+P  L  GL +GGKGL+ GFV G+TG+VTKPI GA+K+G  GFFKGVGKGLVG VTRP  G++D ASS+F+GI+R A+T+ +V  +RPPRFI +DG+IR Y  RE  G+ +  KI             +  +  +K N    + +T + IF + +    G  + +WQ  +++    P I E +  +    KE+ + +F      K I
Sbjct: 2015 CRHHSSDAHVFKVNMVAVRDTVTSLNAQEEFDKPYVLHLWPTVLLRNLLPYPITYSLLAIGSPTPTQLKEGHSSQLHTAVMDHSSLELKLLGYLQQDWVAHYHLRNDHDEINFITFRSALQDDDVDGESSRAELDIAVHVKKEAGQAVVAVHSP--------YWMVNKTGRLLQYKADD--------------------------IHRKHPKDYDMPLL------------------------FSFKPRNFLQNNKVRLMISDSELSDDFSIDTVGSYGDVKCKGRAKDYLVGVKIDASSFSLTRLVTVLPFYMLVNRTKHVIRVCEEGQDE--WTEAQPGEAAVPFWPERE-SKKMKVKVDGCQTAAHTINFHQP-----ENCLLLHLDNTLGGIIVDVNLTEHSAVIRFSDYHDGAAPFLLINHTKDKTLEFYQSCKERRSSTWLPEDLLDLSLSLGEDRETRGSHQQEKEELA-PG-RAVYYTWAEPTGSRVLRWSWGPYSAELKNE--EDLLKDVN-DEGKLFVISFYEGLQRVVLFTTERRIYKLLCESERVELAEQEISLALQDMGISLVNNSTSQEIAYIGITSSDVVWEIKPKKKSRWKVLNGKDAEMLEQHYKSYVE-----SSPVDHSLLDLENGYQVCLTPNSVDMRMLQPYDAPLRRNFLPALKVEYSVSARQKAYRVQINRVQIQNQLPGAIFPFVFYPIKPPKSVRMDSEPKPFTDVSIITRAAGHSDILRIKYFKVLIQEMDLRMDLGFLYAILELFTAENAGTVTSEQEVELFEKDIEYLKTGLNPVSATDT----SPISLYEYFHISPIKLHLSFSLSSGGEDGNKTKRETEMIPVQSLNLLLKSIGATLTDVQDVVFKLAFFELTFQFRTTQQLQWEVIRHYSKQAIKQMYVLVLGLDVLGNPFGLIRGLSEGVEAFFYEPYQGAIQGPEEFVEGMALGVKALVGGAVGGLAGAASRITGAMAKGVAAMTMDEEYQQKRREAMNKQPSGLKEGLTRGGKGLVSGFVSGITGIVTKPIKGAQKEGAAGFFKGVGKGLVGAVTRPTGGIIDMASSTFQGIKRAAETSQDVESLRPPRFIHEDGVIRPYKEREGFGSQMLQKIEN------GRFAKYRYFAHAKVNDSDFLMITKRGIFFVTKG-TFGQLTCEWQYLFDEFTKDPMIVEDRR-LRIEAKERVKSVFHAKEFGKII 3136          

HSP 3 Score: 254.218 bits (648), Expect = 1.083e-66
Identity = 234/911 (25.69%), Postives = 416/911 (45.66%), Query Frame = 3
Query: 3468 ITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTS-----VVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPES-KEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKN--DSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLA----SPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLT--AQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSF-------EIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIF---GAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGE 6128
            I A L  L+V +  EK   I +ISI G        +Y   VSI                        D+ +F  ++  +   T    Y +D+  VD  V + VG I++IFL  FV  +  F+N+FQE+ + +A    + +E AA  +  + E+  S+R  LD+++KAPV+++P++S S N ++ DLG +T KN F I  S S      +L+   + LS+L++ R+   +   + E  +L P+N+ + + RNLS +  H++P I I A +  +S+ +SQ D  +    L  N +E  + VP+   S K E  S K     +  GS  T    +  V+ G K                             K+K EN         N +M  SV+L+   +LD +    K I   +  ++   + +  + + + Q +   +   V +  +Y+C  +++L+ + D F+KA               +G+   P+  ++   A    +P +P  +  E+++ V  PEI+ V D+   D+ A+++ T   L       S  +   I+D + V CPF  + +  N   ++ P  +     +         L++  L + ++P +I ++  I + LT  A++ +E  +            +  + WE+R++ + +  F+ +            +G E    V  ++      + + + LR+  I + LE+ V  + VPML+ + S  GD+KN  T I L   +++ V+Y+N+ + VWEPLLE  P E + +  F       +++    + SG+ DE D+  ++    + ISI   S+D L +T++K  L++LSNLG AF +A     +Q    F    AP+VVKN  G  V    ++ F  KP     + +     DGE
Sbjct: 1077 IRADLSCLKVFIRGEK-ARISEISIEG------KLHYIIAVSIA-----------------------DKEVFDFRMVNYVDATEGDAY-MDMQIVDTSVTLTVGCIQVIFLNKFVSSVLAFINNFQEAKEALAEVTVQAAEKAATGVLELAEK--STRISLDVDIKAPVVFLPQSSISTNVIVADLGLVTVKNHFEIVPSPSHTKIPPILDVMSVALSDLKMYRTTFKDEKFQTEIQLLKPVNMDLSIKRNLSASWYHSLPDIQINAHLKPMSLILSQEDMIVVLRTLSENLSETSDAVPAPKGSDKAETSSTK-----ESQGSGGTTVVTAAVVE-GQKA---------------------------AKLKIENE--------NDSMTASVKLAEC-LLDDKRKIVKMITSRMMAMRKGAEQNTMVDVNYRQGREGTTLETV-VQDLYLCASMEFLLTVADIFMKAM-------------AQGFSSPPKSNKQTSTATKDAAPAQPAASKMEMNIVVKNPEIVFVADLTRADAPALVMTTQCELLMKSDPNSQQMTAAITDLKVVACPFVHKQQDSNITTVLQPCQVFFTSKQSPTQPQAIELSINSLTLKVSPIIINTVITIQSALTPAAETPEELESP-----------VPPDLWERRDWKDLKLWFLEE------------EGEEDTQSVTPLI-----PQGESLQLRISSICLTLEAGVGHRTVPMLLAKSSFHGDVKNWSTLINLHCHLNMEVNYYNEIMGVWEPLLE--PLEDDTKDGFRPWTLDLKMKKKQANRSGISDEVDY--IVPDYKTVISI--TSKDQLNITLTKCGLNMLSNLGTAFAEA----AKQTAECFQKDQAPFVVKNRLGLPVSVLYSEVF--KPIGVQSKGRTVELQDGE 1858          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Cavefish
Match: vps13c (vacuolar protein sorting 13 homolog C [Source:ZFIN;Acc:ZDB-GENE-070426-4])

HSP 1 Score: 518.85 bits (1335), Expect = 5.045e-147
Identity = 364/899 (40.49%), Postives = 537/899 (59.73%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG-------WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSN--NLTSDGIEDFYINEM-KAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSK--KLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILD-FVSGSVPTYDEEAMFV--KDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHV-YCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTI 9992
            K   F+K  K  L ++ S WS+ FSLDTVGS G V C  K + Y VGV I +SS  LT+IVT  P+Y ++N+SS  L   E+  + G       W  +   E +P WP S  GK   +  +V   E      F   + +  L+ +E+ F GI V+V I++ + +I+   Y +G A   L+NH    V I F+Q        L   +   +AW D    R+  W  +G    HS   +L  D    F  + + + +WVSF+    R+LLFT D+ V   AR + +LE I QEI ISL ++GLSL++N  + E+AYI ITSSGV W ++R KNR K         LE ++    N L    A     I    GLEV+ ++    M  P    + R F  G+ ++ + SPHQ  +  +++ +Q+DNQ++   FP+VF P  PP+S+ALD+  KP I++S +   +  +  M++KYF VL+QEM + +DQGF+ +I   F S +    D++ M +  +D + ++A L+E+S    I        F++FHISPIK+HLS SL       +    +  + LNL L+S+G  +TD+ D+IFKL +FE +       +++ ++  HY  Q L+QMYVLVLGLDVLGNPFG+IRG+++GVE  FYEP +GAV GPEEF EG   GV+SL GH VGGAAG VSRI G++GKG+AA+T+D +YQ+KRRE++ + P + G  LA+GGKGL+ G V GVTG+VTKP++GAKK+G  GFFKG+GKGLVGVV RP  G+VD ASS+F+GI+RVA++  EV ++RP R I +DGIIR Y  +E+EG +++ +   +   +  E +  H  Y   +K  I +TN+R+  +   +++G ++ +W+  +E     P++
Sbjct: 2545 KKNIFSKN-KLQLCVSTSSWSEGFSLDTVGSYGCVRCPDKTMDYLVGVSIQMSSFNLTRIVTMSPFYTLVNKSSFELEVGEVQNDMGNGNVSGKWHYISSKECLPLWPESGTGK---LCVRVVGSESASKSFFFNKQDNGTLLSMEQ-FGGIIVDVNISDHSTVISFTDYYDGAAPALLVNHT-PWVTISFRQSGCEASRELNPGEAQRFAWDDPAGVRKLCWTCQG----HSGELDLIKDECGQFACDSLAQVHWVSFLDGRQRVLLFTEDVAVVTKARQAEELEQIQQEIIISLQNLGLSLINNHNRHEIAYIGITSSGVVW-EMRPKNRWKSFNRKNISLLEKSYQ---NHLSGKTAP--GWITLETGLEVNFARVPMQMRLPYSSPIRRNFLSGIHMELKQSPHQRSLRAQLHWLQVDNQLTGAIFPIVFHPVHPPKSIALDSEPKPFIDVSIITRFNEHSQVMQFKYFMVLVQEMAVKIDQGFLGAIFSLFTSPAQSQPDKQKMKLIDRDLEALQAQLMESS----ITDASGLSFFEHFHISPIKLHLSLSLGSSGDESEDGDMVAIQSLNLLLKSIGATLTDVDDLIFKLAFFEVKYQFYRREKLMWAVIGHYTEQFLKQMYVLVLGLDVLGNPFGLIRGLSEGVEAFFYEPFQGAVQGPEEFAEGFVIGVRSLLGHTVGGAAGMVSRITGSVGKGLAAITMDKEYQQKRREEMNRPPRDFGESLAKGGKGLLKGVVGGVTGIVTKPVEGAKKEGAAGFFKGIGKGLVGVVARPTGGIVDMASSTFQGIQRVAESTEEVTKLRPVRLIREDGIIRPYDQQESEGYDLFQR--SEIKQLDGEYFREHYEYPGHRKTNIIVTNRRVMCVKEIDLIGHFNKEWECQFENFLKSPSV 3421          

HSP 2 Score: 449.129 bits (1154), Expect = 8.750e-126
Identity = 270/778 (34.70%), Postives = 439/778 (56.43%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEEN-KLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILI--VSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVI 2348
            MV ESLV +L+N+++GDYV  LDKSQLK+G+ GGN  LENL +KENA   +    +     + KLTLKIP K+LY+E V+A LDGLY+L++P + +KYD  KE  Y  E KQKEL RIEE  ++     K + E KD+F EKLA Q++KNLQ+ +++IHIRYED  + P+R  ++G+TL+ LS QT D S  + I+ E + +  +K  +++ L  YWN N   F   +   +   +K  IS+ +  L    ++ +PI  SA M ++   E      P+++L L+++ I     R QY  +   L+S+D       +RK+RP+VP+  +   WW +  N +LE  +RR  RMWSW  I  HR   + Y   ++ KL   K+ +     I+  E+ LD+ NITL RQQA+M+V +       KK+  +       G + S +  K   +              + + +  T EEK+KLY AIGYSE + +  +P  YV++K+N +L +    + + +    +++K+ +  +S  + QR  A AI V   + +  VTG +   G+VP+L+++   S   +LL V FE NP + SA+Q + + ++P+EIIYD+ TVN +V+F    + + L  I++  L+ +EE+KE TA+GL H+ + R   D+++D+KPSY ++P+ G Y  +  ++++D GS+ +  V +     GS  + L          + + + AY++F + L ++Q L  + G     ++S  S +N I      E +  +C++
Sbjct:    1 MVLESLVSDLLNRFIGDYVENLDKSQLKIGIWGGNVVLENLRVKENALRVY----RCFLWFLGKLTLKIPLKNLYTEAVVATLDGLYLLVVPGATIKYDAVKEERYQQEAKQKELQRIEEALQIAARKEKAQEEKKDTFAEKLATQVIKNLQVKVTSIHIRYEDDVSDPSRPVSMGVTLSELSLQTTDESWRACILNE-AAKIIYKLGRLECLCAYWNVNSPIFYRGSWEEIVDKLKAGISTRDEDLKGYQYIFRPIFASAKMCINPNSEI-ELKSPKINLQLEVQNIAIEMTRPQYLSMVDLLESVDSMVKNAPYRKFRPDVPVHKHAKQWWLYGINSVLEVHIRRFNRMWSWSNIWKHRQTLKAYKAAYKSKLTQGKVREDTDKQIQELEKSLDVFNITLARQQAQMEVVRSGQKVVGKKVAAQKQGGGGGGFFSSFFGRKEGKKKEQEEEH----RESESIDAIMTTEEKSKLYTAIGYSESSHNLALPKSYVAVKINFKLLRTSVTVREEA-NVPEILKIQMIDLSTTISQRPGAQAIKVEASLEHWYVTGLQ-QQGAVPSLIASVGASD-SSLLSVLFEINPEESSADQLLRVHSQPVEIIYDALTVNSLVEFFKAGKGVDLEVITSATLSKLEEIKEKTASGLSHIIETRKVLDLRIDLKPSYLLIPKSGFYHSNSDLMIIDFGSLHLSSVDQAAHQLGSSFSSL----------EEIMDRAYERFSLELRSVQVLYSKSGAHQITVQSLRSVENRIKTKVLPELSTDRCLV 755          

HSP 3 Score: 200.675 bits (509), Expect = 2.211e-50
Identity = 223/1050 (21.24%), Postives = 450/1050 (42.86%), Query Frame = 3
Query: 2862 EIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSD-FISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXX----------XMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQ-RRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDF--EDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAF 5957
            ++G    + ++DM    YI ++ +   +F D +   P+C+  +     G  LL +  +   K  P +VT+  +    L  QF S+++ LH EALL  ++F+++ +   +    E+          ETR+                                 + + RT   ++  VS  SD +              +T   I   L    V+V +++  NI DI I G+   +      T +   + D  I +  P  ++KK I I  DE +FS  ++L  + T   GY  D S+VD  V + VG I++++L+ FV+ +  F N FQ + + ++    + +  A + + +  ++  S R  L+I +KAP+I IP++S S NA+  DLG +T  N F++    +     V++   + L+ L++SR    +++++        I I +++ + +                    +V +SQ D  +   +L  N  EA +  P  P S +    +  +P               I  + G   E +                      CL + +   +   G M  N  +EVS  LS   + D +    +  + ++     DS+D  I + + Q     S + V +  +Y+C  V++LM + +FF++A P    P             +++P +   +  +K       +P +  +    + + V  PE++ V +++  D+ A++       ++   +E+ ++  ++ DF+ + CPF    R K+   ++ P S+ L      ++ + GS+T+E +II ++P ++ ++  I   +T ++ +E  T             + + W  R      + F+               GVE+  +V +   +V+  +  +     +  ++V LES    + +P+L+ E S+    +N  + + L   +++ V+YFN+   VWEPL+E   E   R+++  ++     ++ + ++     +D + +      I + S+D + +T+SK  L+VL NL +  
Sbjct: 1288 QLGVHTKVHKYDMQATTYIKTISMKCLEFTD-ACGDPLCILSSSAEA-GAELLKVEYV---KVCPPYVTLSPSNNQSL-VQFSSLDLMLHTEALLSTMDFLSAALSSSSSPSPER----------ETRR---------------------------------SDDSRTSSARSTVVSSPSDGD--------------VTDLKIDMQLGAFNVLVCDQR-CNIADIRIQGLHGSLLMQGTQTCILARLRDFIIINVDPKTIHKKAISIVGDE-VFSFSMSLTPKATEGVGYT-DTSKVDGRVKLNVGCIQVVYLHKFVMSLLNFSNHFQTAKEALSAATAQAAVKAVSSVRDFAQK--SFRLSLNIRLKAPLIIIPQSSTSNNAVEADLGLITVSNSFSLLPVDNCPLPAVIDNMDVQLTQLKLSR---YQSSLE--------IPILLELKKKMD----------------CYCNVALSQDDLTVLLKILMENIGEAGSVQP--PSSSDSAYRQTAVP---------------IRTRLGVHSESV----------------------CLGEFRLCEMRAAGKMFSNGNLEVSTVLSACTLDDRRSGIQRVTSRMLGKRDEDSADAMIDVTYSQSGGERSVIAV-LQKLYLCGSVEFLMAVGEFFLQALPKTQPPAPALPPAPAPDKPSLLPFKHVSE--QKINSGAKTAPGQKMV----LRMVVVDPEVVFVANLMKADAPALVASFQCDFRFDSQEETQLMKANVKDFKVLACPF---IRTKDNQPVLRPCSVVLETRMSDSSPLTGSVTVEEVIIKVSPIILNTVLTITAAMTPRAPEERGTAAAP-------ETLSSLWSVRNIYTCNYWFL---------------GVETAAEVTESFCEVDGGKEGESFRAEVKVVQVTLESGQGHRTIPLLLAESSITACARNWSSTLSLAADITLEVNYFNEAHAVWEPLIERV-ESGKRRWNLTVQM---KNNPVREKSPVPGDDFVMLPDPRTGINICSKDTMNITLSKCCLNVLHNLAQVL 2167          

HSP 4 Score: 127.487 bits (319), Expect = 2.871e-28
Identity = 87/299 (29.10%), Postives = 165/299 (55.18%), Query Frame = 3
Query: 3453 MTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTS----VVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEA 4337
            +  + + A L    VIV +++ ++I +I I G+ A V      TEV   + D+ + D  P  ++KK++ I  +E +FS +++L+   T   GY  D +RVD  V + +G I+I +L+ F+  + TF+++FQ + + ++    + +E AA+ + +  ++  S R  L+I +KAP+I IP++S S NA +VDLG +T  N F++  +       V+E   I L++L++ R        ++E  +L PIN+ + + RNL+ +   +IP + +   + S+++ + Q D  +   +L  N  E 
Sbjct:  951 VVSFKLYAMLGSFGVIVCDDR-SSIANIQIKGVDASVVVQTKETEVFARLRDIVVMDVDPKTIHKKVVSIVGEE-VFSFKMSLYPGATEGDGY-CDTARVDSRVTLRLGCIQITYLHKFLTSLMTFVDNFQTAKEALSAATAQAAEKAASSVRDFAQK--SFRLSLNIRLKAPLIIIPQSSTSHNAFVVDLGLITVSNSFSLLPAEGFPLPAVMETMDINLTHLKLCR--YCHQRPQSEVELLQPINLELLVKRNLAASWFTSIPGVEVTGVLKSMNISLGQEDLVVLMSILAENIGEG 1242          

HSP 5 Score: 55.4546 bits (132), Expect = 1.690e-6
Identity = 34/143 (23.78%), Postives = 70/143 (48.95%), Query Frame = 3
Query: 6744 TYKLDINVPLALHNQLPIKISY--QSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAV 7166
             Y + ++ P+ + N LP  I Y  +      +++ G    V  A +  +    V   YQ + W   + + P + E   + F + +   +  +D+ +H++   G+  ++++SPYW++NKT   L Y+A +D  V+H +   D +
Sbjct: 2399 AYVIHLHPPVTVRNLLPYSIRYLLEGSADFQELQEGGTADVLNASISGEIMELVLVKYQGRNWNSHVKISPDVPEFFPVCFTS-DSSEQLTVDVCLHVSRAAGRMVLSVFSPYWIINKTSRVLQYRA-EDTYVKHPSDFRDVI 2539          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Cavefish
Match: vps13c (vacuolar protein sorting 13 homolog C [Source:ZFIN;Acc:ZDB-GENE-070426-4])

HSP 1 Score: 518.464 bits (1334), Expect = 6.220e-147
Identity = 364/899 (40.49%), Postives = 537/899 (59.73%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG-------WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSN--NLTSDGIEDFYINEM-KAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSK--KLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILD-FVSGSVPTYDEEAMFV--KDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHV-YCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTI 9992
            K   F+K  K  L ++ S WS+ FSLDTVGS G V C  K + Y VGV I +SS  LT+IVT  P+Y ++N+SS  L   E+  + G       W  +   E +P WP S  GK   +  +V   E      F   + +  L+ +E+ F GI V+V I++ + +I+   Y +G A   L+NH    V I F+Q        L   +   +AW D    R+  W  +G    HS   +L  D    F  + + + +WVSF+    R+LLFT D+ V   AR + +LE I QEI ISL ++GLSL++N  + E+AYI ITSSGV W ++R KNR K         LE ++    N L    A     I    GLEV+ ++    M  P    + R F  G+ ++ + SPHQ  +  +++ +Q+DNQ++   FP+VF P  PP+S+ALD+  KP I++S +   +  +  M++KYF VL+QEM + +DQGF+ +I   F S +    D++ M +  +D + ++A L+E+S    I        F++FHISPIK+HLS SL       +    +  + LNL L+S+G  +TD+ D+IFKL +FE +       +++ ++  HY  Q L+QMYVLVLGLDVLGNPFG+IRG+++GVE  FYEP +GAV GPEEF EG   GV+SL GH VGGAAG VSRI G++GKG+AA+T+D +YQ+KRRE++ + P + G  LA+GGKGL+ G V GVTG+VTKP++GAKK+G  GFFKG+GKGLVGVV RP  G+VD ASS+F+GI+RVA++  EV ++RP R I +DGIIR Y  +E+EG +++ +   +   +  E +  H  Y   +K  I +TN+R+  +   +++G ++ +W+  +E     P++
Sbjct: 2429 KKNIFSKN-KLQLCVSTSSWSEGFSLDTVGSYGCVRCPDKTMDYLVGVSIQMSSFNLTRIVTMSPFYTLVNKSSFELEVGEVQNDMGNGNVSGKWHYISSKECLPLWPESGTGK---LCVRVVGSESASKSFFFNKQDNGTLLSMEQ-FGGIIVDVNISDHSTVISFTDYYDGAAPALLVNHT-PWVTISFRQSGCEASRELNPGEAQRFAWDDPAGVRKLCWTCQG----HSGELDLIKDECGQFACDSLAQVHWVSFLDGRQRVLLFTEDVAVVTKARQAEELEQIQQEIIISLQNLGLSLINNHNRHEIAYIGITSSGVVW-EMRPKNRWKSFNRKNISLLEKSYQ---NHLSGKTAP--GWITLETGLEVNFARVPMQMRLPYSSPIRRNFLSGIHMELKQSPHQRSLRAQLHWLQVDNQLTGAIFPIVFHPVHPPKSIALDSEPKPFIDVSIITRFNEHSQVMQFKYFMVLVQEMAVKIDQGFLGAIFSLFTSPAQSQPDKQKMKLIDRDLEALQAQLMESS----ITDASGLSFFEHFHISPIKLHLSLSLGSSGDESEDGDMVAIQSLNLLLKSIGATLTDVDDLIFKLAFFEVKYQFYRREKLMWAVIGHYTEQFLKQMYVLVLGLDVLGNPFGLIRGLSEGVEAFFYEPFQGAVQGPEEFAEGFVIGVRSLLGHTVGGAAGMVSRITGSVGKGLAAITMDKEYQQKRREEMNRPPRDFGESLAKGGKGLLKGVVGGVTGIVTKPVEGAKKEGAAGFFKGIGKGLVGVVARPTGGIVDMASSTFQGIQRVAESTEEVTKLRPVRLIREDGIIRPYDQQESEGYDLFQR--SEIKQLDGEYFREHYEYPGHRKTNIIVTNRRVMCVKEIDLIGHFNKEWECQFENFLKSPSV 3305          

HSP 2 Score: 427.943 bits (1099), Expect = 2.578e-119
Identity = 263/763 (34.47%), Postives = 428/763 (56.09%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEEN-KLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILI--VSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHI 2303
            MV ESLV +L+N+++GDYV  LDKSQLK+G+ GG +      I+  +  +  L    R G   KLTLKIP K+LY+E V+A LDGLY+L++P + +KYD  KE  Y  E KQKEL RIEE  ++     K + E KD+F EKLA Q++KNLQ+ +++IHIRYED  + P+R  ++G+TL+ LS QT D S  + I+ E + +  +K  +++ L  YWN N   F   +   +   +K  IS+ +  L    ++ +PI  SA M ++   E      P+++L L+++ I     R QY  +   L+S+D       +RK+RP+VP+  +   WW +  N +LE  +RR  RMWSW  I  HR   + Y   ++ KL   K+ +     I+  E+ LD+ NITL RQQA+M+V +       KK+  +       G + S +  K   +              + + +  T EEK+KLY AIGYSE + +  +P  YV++K+N +L +    + + +    +++K+ +  +S  + QR  A AI V   + +  VTG +   G+VP+L+++   S   +LL V FE NP + SA+Q + + ++P+EIIYD+ TVN +V+F    + + L  I++  L+ +EE+KE TA+GL H+ + R   D+++D+KPSY ++P+ G Y  +  ++++D GS+ +  V +     GS  + L          + + + AY++F + L ++Q L  + G     ++S  S +N I
Sbjct:    1 MVLESLVSDLLNRFIGDYVENLDKSQLKIGIWGGRSRALLHFIRPESGSETGL----RSGQW-KLTLKIPLKNLYTEAVVATLDGLYLLVVPGATIKYDAVKEERYQQEAKQKELQRIEEALQIAARKEKAQEEKKDTFAEKLATQVIKNLQVKVTSIHIRYEDDVSDPSRPVSMGVTLSELSLQTTDESWRACILNE-AAKIIYKLGRLECLCAYWNVNSPIFYRGSWEEIVDKLKAGISTRDEDLKGYQYIFRPIFASAKMCINPNSEI-ELKSPKINLQLEVQNIAIEMTRPQYLSMVDLLESVDSMVKNAPYRKFRPDVPVHKHAKQWWLYGINSVLEVHIRRFNRMWSWSNIWKHRQTLKAYKAAYKSKLTQGKVREDTDKQIQELEKSLDVFNITLARQQAQMEVVRSGQKVVGKKVAAQKQGGGGGGFFSSFFGRKEGKKKEQEEEH----RESESIDAIMTTEEKSKLYTAIGYSESSHNLALPKSYVAVKINFKLLRTSVTVREEA-NVPEILKIQMIDLSTTISQRPGAQAIKVEASLEHWYVTGLQ-QQGAVPSLIASVGASD-SSLLSVLFEINPEESSADQLLRVHSQPVEIIYDALTVNSLVEFFKAGKGVDLEVITSATLSKLEEIKEKTASGLSHIIETRKVLDLRIDLKPSYLLIPKSGFYHSNSDLMIIDFGSLHLSSVDQAAHQLGSSFSSL----------EEIMDRAYERFSLELRSVQVLYSKSGAHQITVQSLRSVENRI 739          

HSP 3 Score: 184.882 bits (468), Expect = 1.271e-45
Identity = 189/852 (22.18%), Postives = 389/852 (45.66%), Query Frame = 3
Query: 3453 MTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPP-------DKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSD-FISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKN--PRKY-RKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPF-RSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQ-RRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAF 5957
            +T   I   L    V+V +++  NI DI I G+   +      T +   + D  I +  P  ++KK I I  DE +FS  ++L  + T   GY  D S+VD  V + VG I++++L+ FV+ +  F N FQ + + ++    + +  A + + +  ++  S R  L+I +KAP+I IP++S S NA+  DLG +T  N F++    +     V++   + L+ L++SR    +++++        I I +++ + +                    +V +SQ D  +   +L  N  EA +  P  P S +    +  +P   +    R     + T      +++L ++  + D     + S++ P         CL + +   +   G M  N  +EVS  LS   + D +    +  + ++     DS+D  I + + Q     S + V +  +Y+C  V++LM + +FF++A P    P           + +  P K+  ++ + +P +  +    + + V  PE++ V +++  D+ A++       ++   +E+ ++  ++ DF+ + CPF R++  +     ++ P S+ L      ++ + GS+T+E +II ++P ++ ++  I   +T ++ +E  T             + + W  R      + F+               GVE+  +V +   +V+  +  +     +  ++V LES    + +P+L+ E S+    +N  + + L   +++ V+YFN+   VWEPL+E   E   R+++  ++ +S +          +D + +      I + S+D + +T+SK  L+VL NL +  
Sbjct: 1290 VTDLKIDMQLGAFNVLVCDQR-CNIADIRIQGLHGSLLMQGTQTCILARLRDFIIINVDPKTIHKKAISIVGDE-VFSFSMSLTPKATEGVGYT-DTSKVDGRVKLNVGCIQVVYLHKFVMSLLNFSNHFQTAKEALSAATAQAAVKAVSSVRDFAQK--SFRLSLNIRLKAPLIIIPQSSTSNNAVEADLGLITVSNSFSLLPVDNCPLPAVIDNMDVQLTQLKLSR---YQSSLE--------IPILLELKKKMD----------------CYCNVALSQDDLTVLLKILMENIGEAGSVQP--PSSSDSAYRQTAVPIRTR----RCIKQINAT-----SLQYLTLKTLQTD-----FTSKISPCLGVHSESVCLGEFRLCEMRAAGKMFSNGNLEVSTVLSACTLDDRRSGIQRVTSRMLGKRDEDSADAMIDVTYSQSGGERSVIAV-LQKLYLCGSVEFLMAVGEFFLQALPKTQPPAPALPPAPAPDKPSLLPFKHVSEQKINTPGQKMV----LRMVVVDPEVVFVANLMKADAPALVASFQCDFRFDSQEETQLMKANVKDFKVLACPFIRTKDNQPAPPYVLRPCSVVLETRMSDSSPLTGSVTVEEVIIKVSPIILNTVLTITAAMTPRAPEERGTAAAP-------ETLSSLWSVRNIYTCNYWFL---------------GVETAAEVTESFCEVDGGKEGESFRAEVKVVQVTLESGQGHRTIPLLLAESSITACARNWSSTLSLAADITLEVNYFNEAHAVWEPLIERV-ESGKRRWNLTVQ-VSNNPVREKSPVPGDDFVMLPDPRTGINICSKDTMNITLSKCCLNVLHNLAQVL 2064          

HSP 4 Score: 126.331 bits (316), Expect = 6.372e-28
Identity = 100/362 (27.62%), Postives = 192/362 (53.04%), Query Frame = 3
Query: 3453 MTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTS----VVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQV------PSVPESKEEVKSR-KILPKDDKSGSA----RTASDESITVQFGFKMEFLDVEL 4493
            +  + + A L    VIV +++ ++I +I I G+ A V      TEV   + D+ + D  P  ++KK++ I  +E +FS +++L+   T   GY  D +RVD  V + +G I+I +L+ F+  + TF+++FQ + + ++    + +E AA+ + +  ++  S R  L+I +KAP+I IP++S S NA +VDLG +T  N F++  +       V+E   I L++L++ R        ++E  +L PIN+ + + RNL+ +   +IP + +   + S++V +   D  +   +L  N  E    +      P++ +  E+ +   ++LP +  S S     R+ S+  ++V   F  E ++V L
Sbjct:  848 VVSFKLYAMLGSFGVIVCDDR-SSIANIQIKGVDASVVVQTKETEVFARLRDIVVMDVDPKTIHKKVVSIVGEE-VFSFKMSLYPGATEGDGY-CDTARVDSRVTLRLGCIQITYLHKFLTSLMTFVDNFQTAKEALSAATAQAAEKAASSVRDFAQK--SFRLSLNIRLKAPLIIIPQSSTSHNAFVVDLGLITVSNSFSLLPAEGFPLPAVMETMDINLTHLKLCR--YCHQRPQSEVELLQPINLELLVKRNLAASWFTSIPGVEVTGVLKSMNVSLLCEDLVVLMSILAENIGEGSRTMSPDLKKPAIEDKSEQSEEHSEVLPLETGSQSTITNERSFSENIVSVLLNF--ELMEVTL 1200          

HSP 5 Score: 55.4546 bits (132), Expect = 1.657e-6
Identity = 34/143 (23.78%), Postives = 70/143 (48.95%), Query Frame = 3
Query: 6744 TYKLDINVPLALHNQLPIKISY--QSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAV 7166
             Y + ++ P+ + N LP  I Y  +      +++ G    V  A +  +    V   YQ + W   + + P + E   + F + +   +  +D+ +H++   G+  ++++SPYW++NKT   L Y+A +D  V+H +   D +
Sbjct: 2283 AYVIHLHPPVTVRNLLPYSIRYLLEGSADFQELQEGGTADVLNASISGEIMELVLVKYQGRNWNSHVKISPDVPEFFPVCFTS-DSSEQLTVDVCLHVSRAAGRMVLSVFSPYWIINKTSRVLQYRA-EDTYVKHPSDFRDVI 2423          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Cavefish
Match: vps13c (vacuolar protein sorting 13 homolog C [Source:ZFIN;Acc:ZDB-GENE-070426-4])

HSP 1 Score: 504.597 bits (1298), Expect = 1.279e-142
Identity = 352/834 (42.21%), Postives = 506/834 (60.67%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG-------WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSN--NLTSDGIEDFYINEM-KAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSK--KLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILD-FVSGSVPTYDEEAMFV--KDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTA--LHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIW 9800
            K   F+K  K  L ++ S WS+ FSLDTVGS G V C  K + Y VGV I +SS  LT+IVT  P+Y ++N+SS  L   E+  + G       W  +   E +P WP S  GK   +  +V   E      F   + +  L+ +E+ F GI V+V I++ + +I+   Y +G A   L+NH    V I F+Q        L   +   +AW D    R+  W  +G    HS   +L  D    F  + + + +WVSF+    R+LLFT D+ V   AR + +LE I QEI ISL ++GLSL++N  + E+AYI ITSSGV W ++R KNR K         LE ++    N L    A     I    GLEV+ ++    M  P    + R F  G+ ++ + SPHQ  +  +++ +Q+DNQ++   FP+VF P  PP+S+ALD+  KP I++S +   +  +  M++KYF VL+QEM + +DQGF+ +I   F S +    D++ M +  +D + ++A L+E+S    I        F++FHISPIK+HLS SL       +    +  + LNL L+S+G  +TD+ D+IFKL +FE +       +++ ++  HY  Q L+QMYVLVLGLDVLGNPFG+IRG+++GVE  FYEP +GAV GPEEF EG   GV+SL GH VGGAAG VSRI G++GKG+AA+T+D +YQ+KRRE++ + P + G  LA+GGKGL+ G V GVTG+VTKP++GAKK+G  GFFKG+GKGLVGVV RP  G+VD ASS+F+GI+RVA++  EV ++RP R I +DGIIR Y  +E+EG +++
Sbjct: 2578 KKNIFSKN-KLQLCVSTSSWSEGFSLDTVGSYGCVRCPDKTMDYLVGVSIQMSSFNLTRIVTMSPFYTLVNKSSFELEVGEVQNDMGNGNVSGKWHYISSKECLPLWPESGTGK---LCVRVVGSESASKSFFFNKQDNGTLLSMEQ-FGGIIVDVNISDHSTVISFTDYYDGAAPALLVNHT-PWVTISFRQSGCEASRELNPGEAQRFAWDDPAGVRKLCWTCQG----HSGELDLIKDECGQFACDSLAQVHWVSFLDGRQRVLLFTEDVAVVTKARQAEELEQIQQEIIISLQNLGLSLINNHNRHEIAYIGITSSGVVW-EMRPKNRWKSFNRKNISLLEKSYQ---NHLSGKTAP--GWITLETGLEVNFARVPMQMRLPYSSPIRRNFLSGIHMELKQSPHQRSLRAQLHWLQVDNQLTGAIFPIVFHPVHPPKSIALDSEPKPFIDVSIITRFNEHSQVMQFKYFMVLVQEMAVKIDQGFLGAIFSLFTSPAQSQPDKQKMKLIDRDLEALQAQLMESS----ITDASGLSFFEHFHISPIKLHLSLSLGSSGDESEDGDMVAIQSLNLLLKSIGATLTDVDDLIFKLAFFEVKYQFYRREKLMWAVIGHYTEQFLKQMYVLVLGLDVLGNPFGLIRGLSEGVEAFFYEPFQGAVQGPEEFAEGFVIGVRSLLGHTVGGAAGMVSRITGSVGKGLAAITMDKEYQQKRREEMNRPPRDFGESLAKGGKGLLKGVVGGVTGIVTKPVEGAKKEGAAGFFKGIGKGLVGVVARPTGGIVDMASSTFQGIQRVAESTEEVTKLRPVRLIREDGIIRPYDQQESEGYDLF 3391          

HSP 2 Score: 434.876 bits (1117), Expect = 1.757e-121
Identity = 273/811 (33.66%), Postives = 442/811 (54.50%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIP----------NSEMKYDPEKERSYLFETKQKELNRIEE---------------------NKLKRNDPKKET---ETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILI--VSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVI 2348
            MV ESLV +L+N+++GDYV  LDKSQLK+G+ GGN  LENL +KENA   +    +     + KLTLKIP K+LY+E V+A LDGLY+L++P          N  +KYD  KE  Y  E KQKEL RIEE                      + K+++ K E    E KD+F EKLA Q++KNLQ+ +++IHIRYED  + P+R  ++G+TL+ LS QT D S  + I+ E + +  +K  +++ L  YWN N   F   +   +   +K  IS+ +  L    ++ +PI  SA M ++   E      P+++L L+++ I     R QY  +   L+S+D       +RK+RP+VP+  +   WW +  N +LE  +RR  RMWSW  I  HR   + Y   ++ KL   K+ +     I+  E+ LD+ NITL RQQA+M+V +       KK+  +       G + S +  K   +              + + +  T EEK+KLY AIGYSE + +  +P  YV++K+N +L +    + + +    +++K+ +  +S  + QR  A AI V   + +  VTG +   G+VP+L+++   S   +LL V FE NP + SA+Q + + ++P+EIIYD+ TVN +V+F    + + L  I++  L+ +EE+KE TA+GL H+ + R   D+++D+KPSY ++P+ G Y  +  ++++D GS+ +  V +     GS  + L          + + + AY++F + L ++Q L  + G     ++S  S +N I      E +  +C++
Sbjct:    1 MVLESLVSDLLNRFIGDYVENLDKSQLKIGIWGGNVVLENLRVKENALRVY----RCFLWFLGKLTLKIPLKNLYTEAVVATLDGLYLLVVPGASEYCFSVFNLSIKYDAVKEERYQQEAKQKELQRIEEALQIAARKDKGRKHKKHKKTFRRCKKHEQKSEKAQEEKKDTFAEKLATQVIKNLQVKVTSIHIRYEDDVSDPSRPVSMGVTLSELSLQTTDESWRACILNE-AAKIIYKLGRLECLCAYWNVNSPIFYRGSWEEIVDKLKAGISTRDEDLKGYQYIFRPIFASAKMCINPNSEI-ELKSPKINLQLEVQNIAIEMTRPQYLSMVDLLESVDSMVKNAPYRKFRPDVPVHKHAKQWWLYGINSVLEVHIRRFNRMWSWSNIWKHRQTLKAYKAAYKSKLTQGKVREDTDKQIQELEKSLDVFNITLARQQAQMEVVRSGQKVVGKKVAAQKQGGGGGGFFSSFFGRKEGKKKEQEEEH----RESESIDAIMTTEEKSKLYTAIGYSESSHNLALPKSYVAVKINFKLLRTSVTVREEA-NVPEILKIQMIDLSTTISQRPGAQAIKVEASLEHWYVTGLQ-QQGAVPSLIASVGASD-SSLLSVLFEINPEESSADQLLRVHSQPVEIIYDALTVNSLVEFFKAGKGVDLEVITSATLSKLEEIKEKTASGLSHIIETRKVLDLRIDLKPSYLLIPKSGFYHSNSDLMIIDFGSLHLSSVDQAAHQLGSSFSSL----------EEIMDRAYERFSLELRSVQVLYSKSGAHQITVQSLRSVENRIKTKVLPELSTDRCLV 788          

HSP 3 Score: 199.904 bits (507), Expect = 3.386e-50
Identity = 223/1050 (21.24%), Postives = 450/1050 (42.86%), Query Frame = 3
Query: 2862 EIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI----DQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSD-FISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXX----------XMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQ-RRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDF--EDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAF 5957
            ++G    + ++DM    YI ++ +   +F D +   P+C+  +     G  LL +  +   K  P +VT+  +    L  QF S+++ LH EALL  ++F+++ +   +    E+          ETR+                                 + + RT   ++  VS  SD +              +T   I   L    V+V +++  NI DI I G+   +      T +   + D  I +  P  ++KK I I  DE +FS  ++L  + T   GY  D S+VD  V + VG I++++L+ FV+ +  F N FQ + + ++    + +  A + + +  ++  S R  L+I +KAP+I IP++S S NA+  DLG +T  N F++    +     V++   + L+ L++SR    +++++        I I +++ + +                    +V +SQ D  +   +L  N  EA +  P  P S +    +  +P               I  + G   E +                      CL + +   +   G M  N  +EVS  LS   + D +    +  + ++     DS+D  I + + Q     S + V +  +Y+C  V++LM + +FF++A P    P             +++P +   +  +K       +P +  +    + + V  PE++ V +++  D+ A++       ++   +E+ ++  ++ DF+ + CPF    R K+   ++ P S+ L      ++ + GS+T+E +II ++P ++ ++  I   +T ++ +E  T             + + W  R      + F+               GVE+  +V +   +V+  +  +     +  ++V LES    + +P+L+ E S+    +N  + + L   +++ V+YFN+   VWEPL+E   E   R+++  ++     ++ + ++     +D + +      I + S+D + +T+SK  L+VL NL +  
Sbjct: 1321 QLGVHTKVHKYDMQATTYIKTISMKCLEFTD-ACGDPLCILSSSAEA-GAELLKVEYV---KVCPPYVTLSPSNNQSL-VQFSSLDLMLHTEALLSTMDFLSAALSSSSSPSPER----------ETRR---------------------------------SDDSRTSSARSTVVSSPSDGD--------------VTDLKIDMQLGAFNVLVCDQR-CNIADIRIQGLHGSLLMQGTQTCILARLRDFIIINVDPKTIHKKAISIVGDE-VFSFSMSLTPKATEGVGYT-DTSKVDGRVKLNVGCIQVVYLHKFVMSLLNFSNHFQTAKEALSAATAQAAVKAVSSVRDFAQK--SFRLSLNIRLKAPLIIIPQSSTSNNAVEADLGLITVSNSFSLLPVDNCPLPAVIDNMDVQLTQLKLSR---YQSSLE--------IPILLELKKKMD----------------CYCNVALSQDDLTVLLKILMENIGEAGSVQP--PSSSDSAYRQTAVP---------------IRTRLGVHSESV----------------------CLGEFRLCEMRAAGKMFSNGNLEVSTVLSACTLDDRRSGIQRVTSRMLGKRDEDSADAMIDVTYSQSGGERSVIAV-LQKLYLCGSVEFLMAVGEFFLQALPKTQPPAPALPPAPAPDKPSLLPFKHVSE--QKINSGAKTAPGQKMV----LRMVVVDPEVVFVANLMKADAPALVASFQCDFRFDSQEETQLMKANVKDFKVLACPF---IRTKDNQPVLRPCSVVLETRMSDSSPLTGSVTVEEVIIKVSPIILNTVLTITAAMTPRAPEERGTAAAP-------ETLSSLWSVRNIYTCNYWFL---------------GVETAAEVTESFCEVDGGKEGESFRAEVKVVQVTLESGQGHRTIPLLLAESSITACARNWSSTLSLAADITLEVNYFNEAHAVWEPLIERV-ESGKRRWNLTVQM---KNNPVREKSPVPGDDFVMLPDPRTGINICSKDTMNITLSKCCLNVLHNLAQVL 2200          

HSP 4 Score: 127.487 bits (319), Expect = 2.808e-28
Identity = 87/299 (29.10%), Postives = 165/299 (55.18%), Query Frame = 3
Query: 3453 MTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTS----VVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEA 4337
            +  + + A L    VIV +++ ++I +I I G+ A V      TEV   + D+ + D  P  ++KK++ I  +E +FS +++L+   T   GY  D +RVD  V + +G I+I +L+ F+  + TF+++FQ + + ++    + +E AA+ + +  ++  S R  L+I +KAP+I IP++S S NA +VDLG +T  N F++  +       V+E   I L++L++ R        ++E  +L PIN+ + + RNL+ +   +IP + +   + S+++ + Q D  +   +L  N  E 
Sbjct:  984 VVSFKLYAMLGSFGVIVCDDR-SSIANIQIKGVDASVVVQTKETEVFARLRDIVVMDVDPKTIHKKVVSIVGEE-VFSFKMSLYPGATEGDGY-CDTARVDSRVTLRLGCIQITYLHKFLTSLMTFVDNFQTAKEALSAATAQAAEKAASSVRDFAQK--SFRLSLNIRLKAPLIIIPQSSTSHNAFVVDLGLITVSNSFSLLPAEGFPLPAVMETMDINLTHLKLCR--YCHQRPQSEVELLQPINLELLVKRNLAASWFTSIPGVEVTGVLKSMNISLGQEDLVVLMSILAENIGEG 1275          

HSP 5 Score: 55.4546 bits (132), Expect = 1.715e-6
Identity = 34/143 (23.78%), Postives = 70/143 (48.95%), Query Frame = 3
Query: 6744 TYKLDINVPLALHNQLPIKISY--QSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAV 7166
             Y + ++ P+ + N LP  I Y  +      +++ G    V  A +  +    V   YQ + W   + + P + E   + F + +   +  +D+ +H++   G+  ++++SPYW++NKT   L Y+A +D  V+H +   D +
Sbjct: 2432 AYVIHLHPPVTVRNLLPYSIRYLLEGSADFQELQEGGTADVLNASISGEIMELVLVKYQGRNWNSHVKISPDVPEFFPVCFTS-DSSEQLTVDVCLHVSRAAGRMVLSVFSPYWIINKTSRVLQYRA-EDTYVKHPSDFRDVI 2572          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003418.1 (pep scaffold:Pmarinus_7.0:GL489749:646:4444:-1 gene:ENSPMAG00000003128.1 transcript:ENSPMAT00000003418.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.62 bits (283), Expect = 1.255e-29
Identity = 53/91 (58.24%), Postives = 69/91 (75.82%), Query Frame = 3
Query:  123 GNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLK 395
            G+A LENL +KENA  + D+P KV+ GHI KLTLKIPWK+LY E VIA L+G+Y+L++P++ +KYD EKE     E KQ+EL RIEE  +K
Sbjct:    1 GDAVLENLVLKENALSELDVPFKVKVGHIGKLTLKIPWKNLYKEAVIASLEGVYLLVVPSASIKYDAEKEEKQQLELKQRELRRIEEAMMK 91          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003332.1 (pep scaffold:Pmarinus_7.0:GL487813:5059:8070:-1 gene:ENSPMAG00000003052.1 transcript:ENSPMAT00000003332.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 4.850e-28
Identity = 83/142 (58.45%), Postives = 109/142 (76.76%), Query Frame = 3
Query: 9375 SRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRR-VADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNI 9797
            SRI GTMGKG+A +T+D +YQRKRRE++ ++P +L  GLA+GGKGL+ G + GVTG++TKPI+GA+  G  GF KGVGKGLVGVV RP  GV+D ASS+ EGI+R  A+ +  V ++RPPR I +DGIIR Y  RE EG+ +
Sbjct:    8 SRITGTMGKGLATITMDEEYQRKRREEMNQQPTDLKEGLARGGKGLLKGVIGGVTGIITKPIEGARSGGATGFLKGVGKGLVGVVARPAGGVIDMASSTMEGIKRWQAEASETVEKMRPPRVIQEDGIIRPYSRREGEGSQL 149          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Yeast
Match: VPS13 (Protein involved in prospore membrane morphogenesis; peripheral membrane protein that localizes to the prospore membrane and at numerous membrane contact sites; involved in sporulation, vacuolar protein sorting, prospore membrane formation during sporulation, and protein-Golgi retention; required for mitochondrial integrity; contains a PH-like domain; homologous to human CHAC and COH1 which are involved in Chorea-acanthocytosis and Cohen syndrome, respectively [Source:SGD;Acc:S000003963])

HSP 1 Score: 182.57 bits (462), Expect = 8.034e-46
Identity = 193/849 (22.73%), Postives = 366/849 (43.11%), Query Frame = 3
Query:   69 GDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKR---------NDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDT----STCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREF-FKSVKMDSLAVYWNSNPKPFSS---ENRATLKAI--MKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCE-----EELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDP---DIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLV--------STQAQSKLMN------------LLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQ--LYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKD-GKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWR----KLRSQESSKN-HILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELI 2450
            G YV   D +QL +G+  G+  L+NL ++++  D  +LP+ V+ G +  L L +PW  L ++PV   ++  Y+L  P SE   + E+     F  K ++++  E     R                +    F + L  +I+ NLQ++I NIH+RYED     +T P+   +VG+TL  LS  + DS+     I  D T+    K + ++SL +YWN++  P  S   ++R+    +   K+ I+S         ++++P+S    + ++    T     P + L +  ++ G   +  +Y DI   L S+       +F+K RP+  +  N + W+ +    ++ E +  + +MW+W+ ++    + RLYT +W +KL  K L    +D I+  +     ++L    I L R  A+ + ++ K            +               + +  SS      ++E+ + +    T+E++ +LY AI + E         +P E V L++   L+K  F I     +   L  ++  +      QR  +        +++ Q+      DGS   L         S++ QS + N            LL   FE NPLD  A+  +NI+   + + Y    +  + KF     +    +  I     A++E     T  G+  L +     ++ +D++    ILP    +  D    ++D G + I+S+        +   +  ++  K++ + +    +D+F I+    Q  +   G D +    K+ +  S+ +  IL     E  +   ++     LP I V G LP L + I+D   ++++ LI
Sbjct:   15 GSYVENFDPNQLNVGIWSGDVKLKNLKLRKDCLDSLNLPIDVKSGILGDLVLTVPWSSLKNKPVKIIIEDCYLLCSPRSEDHENDEEMIKRAFRLKMRKVSEWELTNQARILSTQSENKTSSSSSEKNNAGFMQSLTTKIIDNLQVTIKNIHLRYEDMDGIFTTGPS---SVGLTLNELSAVSTDSNWAPSFI--DITQNITHKLLTLNSLCLYWNTDSPPLISDDDQDRSLENFVRGFKDMIASKNSTAPKHQYILKPVSGLGKLSINKLGSTEE--QPHIDLQMFYDEFGLELDDTEYNDILHVLSSIQLRQITKKFKKARPSFAVSENPTEWFKYIAACVINE-IHEKNKMWTWESMKEKCEQRRLYTKLWVEKLKLKNLEAPLRDPIQEAQLSELHKDLTYDEIILFRSVAKRQYAQYKLGMTEDSPTPTASSNIEPQTSNKSATKNNGSWLSSWWNGKPTEEVDEDLI--MTEEQRQELYDAIEFDENEDKGPVLQVPRERVELRVTSLLKKGSFTIRKKK-QNLNLGSIIFENCKVDFAQRPDS-------FLSSFQLNKFSLEDGSPNALYKHIISVRNSSKDQSSIDNHATGEEEEEDEPLLRASFELNPLDGLADSNLNIKLLGMTVFYHVHFITEVHKFFKASNQHMETIGNIVNAAEATVEGWTTQTRMGIESLLEDHKTVNVSLDLQAPLIILP-LDPHDWDTPCAIIDAGHMSILSDLVPKEKIKEIKELSPEEYDKIDGNEINRLMFDRFQILSQDTQIFV---GPDIQSTIGKINTASSTNDFRILDKMKLELTVDLSILPKAYKLPTIRVFGHLPRLSLSINDIQYKTIMNLI 841          

HSP 2 Score: 116.316 bits (290), Expect = 9.231e-26
Identity = 134/500 (26.80%), Postives = 234/500 (46.80%), Query Frame = 3
Query: 8505 GVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSV---GIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLG--PEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEV---FRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDG 9980
            G+ L+Y  S        ++  +QIDNQ+   N+  +  P   P +   +    P+I  S   +         +K+  +LIQE  + LD+  + +++DF+      +  ++   K  + I+  L + S +KT         F+ FHI P  +HLSF  S     G      E  +  L  V    + + ++ +   K+      N  +P+  ++  I  HY +Q + Q++ ++   D  GNP G+   ++ GV DLFYEP +G ++   P+E    +A G  S     V G + ++S+  G+M KG+ ++T D ++QR RR Q      N    LA   +        G++G+   P    +K+G  GF KG+GKG+VG+ T+   G +D  S+  +G++    T +++    R+R PR++  D II+ Y LREA+G   W+K T       N+ Y+ HV    K+  + ++ Q I  +     +    + W   Y  + G
Sbjct: 2611 GIELRYNESKAYQTFSWKMKWMQIDNQLFSGNYSNILYPTEIPYTEK-EIENHPVISGSISKVNDSLQAVPYFKHVTLLIQEFSIQLDEDMLYAMMDFIKFPGSPWIMDSRDYKYDEEIQ--LPDVSELKT----AGDIYFEIFHIQPTVLHLSFIRSDEISPGLAEETEESFSSSLYYVHMFAMTLGNINEAPVKVNSLFMDNVRVPLPILMDHIERHYTTQFVYQIHKILGSADCFGNPVGLFNTISSGVWDLFYEPYQGYMMNDRPQEIGIHLAKGGLSFAKKTVFGLSDSMSKFTGSMAKGL-SVTQDLEFQRVRRLQQRINKNNRN-ALANSAQSFASTLGSGLSGIALDPYKAMQKEGAAGFLKGLGKGIVGLPTKTAIGFLDLTSNLSQGVKSTT-TVLDMQKGCRVRLPRYVDHDQIIKPYDLREAQG-QYWLK-TVNGGVFMNDEYLSHVILPGKELAVIVSMQHIAEVQ----MATQELMWSTGYPSIQG 3094          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Nematostella
Match: EDO34505 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP53])

HSP 1 Score: 533.102 bits (1372), Expect = 1.015e-151
Identity = 355/935 (37.97%), Postives = 532/935 (56.90%), Query Frame = 3
Query: 7377 KAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG--WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQ--YNTPQ--------------ELILPAYQTVMYAWQDGRQKREFIWRVEGD--KKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAM---------------FVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSL----SRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNI 10064
            K  ++++ S WS KFSLDTVGS G +  KK    +E+GV+I LS   LTK+V F P+++I N +   +   E  +N+   W  V  GE +PFWP     K +++R     RE   +  F F    SIL+++E K   + VE+   + A ++    Y  G A +++ N    D+EI +KQ  Y                  E +L     ++Y W     K+ F+W  +G+  K +   +L   G   F + +   +W +F+    R+LL  +D  +A  A++    E I QEI+++L +IGLSLV+N    E+AYI IT S + W + ++K R K LK+  SE LE A+     +  TS         K+  +EVD     +I P +  + R F PGV ++   S H++ +  ++  +QID+Q+    F  V  P PPPRSVA+D   KP  E+S +  +   +     KYF+VL+QEM+ M+D GF+ ++++  S + P  D+  +               +++D + +   L   + ++  LS  +   FD FH+SP+KIH+SFS     +  +++G   + S  +NL +QSVG+A+T++QDV FKL YFE  N +    Q+  +I  HY  QA++QMYVLVLGLDVLGNPFG+I G+  G +DLFYEP +G + GP EF EG+A GV+SL GH VGGAAGAVSRI GT+GKG AAL++D  YQ++RR+ + K+P N+G GLA+GGKGL+ G  +GVTG+VTKP+ GAK+ G  GFFKG+GKG+VGVV RP  G+VDFASS+FEGI+  ADT  EV ++RPPR    D +++ Y   EA GN I   + +    +  + Y  H     KK ++ +TN+ I    + E+ G W   W   Y  L   P  +++K  +V  + +K R +F +  +
Sbjct: 2644 KTRVRMSGSEWSGKFSLDTVGSGGSIKIKKDDKDFEIGVQITLSYFSLTKVVEFTPFHLIDNHTEFPVSLCEAPDNSNLIWTTVKSGECIPFWPSRVPPKDLVVRLGDSTRE---SSRFNFEPDVSILLRMEGKVGALSVEMISKDSAAIMTFCPYYAGAAPIRIENCT--DLEICYKQDRYGVTNKVRGIPCHVSEGSTEHVLRPGNCILYTWGRPMDKKVFMWYAKGEDQKNRRITDLIGVGHGAFEVKDKSYFWATFLDGLQRVLLIIDDFTLAYRAQVEVP-ERISQEISLNLQAIGLSLVNNEKSIEVAYIGITPSQIIWEETKKKGRWKALKMRISEQLEVAYTRV--QQVTSVGGEPNFRQKLSDIEVDFELMEIIHPRRRAIRRTFTPGVAVKLIMSAHELELFTKVNSVQIDSQIPGSTFQTVLHPVPPPRSVAMDNAPKPFFEMSVLTRQVEHSHVNEIKYFKVLVQEMETMIDMGFIMALIELFSMT-PLIDDSGIHSSSTLGIVSDVLTQYIEDKKRVLEGLGAANAVQAALSDTRN-YFDYFHLSPLKIHVSFSQLGGPASDDKSGGIEIGSSFVNLLMQSVGVAVTEVQDVEFKLAYFEILNQVYNQQQLTGAIIKHYTGQAIKQMYVLVLGLDVLGNPFGLITGLKDGAKDLFYEPYQGLIQGPGEFAEGLALGVRSLVGHTVGGAAGAVSRITGTIGKGFAALSMDEKYQQERRQAMGKKPVNVGEGLARGGKGLLEGVFEGVTGIVTKPVQGAKEQGAAGFFKGLGKGVVGVVARPAGGIVDFASSTFEGIKGSADTATEVKKLRPPRVFYADKVMKPYNSYEAAGNAILSGVKKDKSALEEDKYYAHSILNIKKALV-VTNKHIIVAGKAEVFGNWECDWSCDYNDLTAEPEADKNK--LVLRVPDKGRVIFKRSEV 3565          

HSP 2 Score: 358.607 bits (919), Expect = 1.166e-98
Identity = 185/416 (44.47%), Postives = 270/416 (64.90%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKEL------NRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLT---DVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAE 1244
            MVFES VV+L+NK+ G Y+  LD SQL+LG+ GG+A LENL +KE+A DD DLPVKV +GH+ KL LKIPWK+LYSEPV+A++DGLY+L+ PN+ + Y+ EKE     E K+++L       ++EE K K    K+  E KDSF EKLA Q+VKNLQI ISNIH+RYEDT T P+  F++GITL NLS Q+ D +    I+   S +   K ++++SL++YWN+         +     I K  I+ + +  +      +++ PIS ++ + +  K   ++ + P++ L L LE+I    ++ Q+ D+   L+S D       FRKY+P V +  + S WWH+  + +LEE V+RR R WSWK+I+ HR  CR Y  ++++KLL++KLS+ +   I+  EE LD+LNIT+CRQQAE
Sbjct:    1 MVFESYVVDLVNKFAGQYLENLDPSQLRLGIWGGDAQLENLSLKESALDDLDLPVKVLRGHLGKLVLKIPWKNLYSEPVVAQIDGLYLLVRPNTGIHYNAEKEEKAQQEKKKRQLEAIELARKLEEEKKKAVSDKESKEDKDSFVEKLAMQVVKNLQIYISNIHVRYEDTVTHPDAPFSLGITLENLSAQSTDENWIPSIVGT-SVKIVHKLMELNSLSMYWNTGDDIGKLPTKEEWPTIAKEGIARTMKGFSKPEGFKYVLPPISATSKVKLDTK-AGSDLSNPKVYLSLVLEEIFLVLSKTQFHDLMMLLESFDYMARNVPFRKYKPVVQLMKSPSKWWHYAMDCVLEEDVKRRSRNWSWKHIKRHRTTCREYKMLYKKKLLNEKLSKEQLKNIENLEENLDVLNITICRQQAE 414          

HSP 3 Score: 204.912 bits (520), Expect = 4.147e-52
Identity = 119/368 (32.34%), Postives = 201/368 (54.62%), Query Frame = 3
Query: 1404 KKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDN--SLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSK--LMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVP 2495
            K +  E  +EE AKLY AIGYSE       P EYV  K+ + L+++   + D+  S K  +++K  I  + A + QR SA AI V   ++ M++ G+ G  G +P +V++Q + +   M L    FETNPLD+  +Q++ + + PL+I+YD++T++ ++KF  PP+++ L E+S   ++ +E +K  +   L +  +    TDI +D+   Y ++PE+G       +L++DLG + I S+        D + +      L+   ++   YDKF I L  +Q L+ ++GDDW   R Q  SK HI+ P   +  L+K +  +D  L +I + G L  + V I+D+ L   ++L L IP P    P+  P
Sbjct:  498 KILTEEQKKEELAKLYAAIGYSENEVITSFPKEYVENKVIVHLKQIGVQLRDDCGSGKPQEIVKFSIKDLYADLAQRPSAQAIRVTAKVDKMKMYGSPGEGGHLPLMVTSQQEKEKGHMALFHAAFETNPLDEKCDQRVEVTSRPLKIVYDANTIDEVMKFFQPPQDVHLQELSAAAMSGLEALKTASKASLAYAVEHHKVTDINLDVMSPYILIPEKGCMQGSKSVLVLDLGHLKIKSDP-------DQERVITTK-NLSMAELESKCYDKFDIRLEQLQVLLAKEGDDWNAARQQTQSKLHIVNPISIDLKLQKALNPDDVRLAQIKLAGSLHSIDVHITDKKLDLAVQLALSIPVPGGDTPQDKP 857          

HSP 4 Score: 135.191 bits (339), Expect = 5.100e-31
Identity = 139/679 (20.47%), Postives = 310/679 (45.66%), Query Frame = 3
Query: 3468 ITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAI-------DQSTSVVLEESKITLSNLRVSRSILLE-NTVKNEKGILHPINIFMDMTRNLS-WNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEA---INQVPSVPESKEEVKSRKILPK-DDKS----GSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDK-CLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPV-RGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDN--FWEKREFDENEFLFIS 5441
            + A L  + ++V + K  +++ + + G+ + +      T +   +TD+ + D  P  +Y  I+ I   E +FS+Q+ ++N   +  G   ++  VD    + +G I++IFL   V+ +  FL++FQ++ + +    +  +E AA KI ++  +  ++R KL ++++AP I IP NS S +AL+ DLG L   N F +       D S +V+++   + LS++++SR+++ E + +     IL P+N+ + + R+LS W   H IP I +   + ++ +   + D +    V+  N  E    I   PSV  S E      I+P+  D S     S+  A++   TV+F FK+E +   L+        W       + CLT       +V G       ++ ++R++    +   +     ++  I   +  +++ + +KF Q  + + ++ +D+  +++   +++L++L + F  A       P    V   +   K            P +    +  +   V  PEI+L+ D  +  ++A+ ++        + +    +   I +       F  ++R      ++  + ++L+ + P    +   +      ++++PA I++++  + +L                ++++ +I D+   W ++E D+    +++
Sbjct: 1045 LKAKLGGISLVVTSVK-GDLVRVLVGGLSSHISVMEDRTSIDAKMTDLSVVDAKPDVLYPNIVSIVNQE-VFSVQIVVYNDAMAG-GNFTNMDAVDTSFEMSIGCIRVIFLNKIVMELLAFLDNFQKAKEAMEYARKSATEKAAEKIQDIQSQ--AARIKLTVSIQAPFIIIPVNSHSRDALVADLGQLVVSNSFKLHSPATKPDGSDAVIVDNMVVELSSVKLSRALIGEGDQIVASSVILEPLNLTIYLARSLSAWY--HKIPGIDVTGELCAVKMCTGELDLSTILAVIFQNLGEGQSDIQDEPSVESSGEGA----IVPEVGDGSVAVVPSSTPATEVYDTVKFDFKIESVSAVLY--------WKESTELLRICLTN------TVLGQAK-GVILQCNLRMAQ-KTIKGHVGYFIMMDRFI-GAEGKAANMVDVKFDQSASLSKQITIDVNSVHVVANLEFLLVLANVFTTALTEAPPKPPSVSVETSQALTKVKPSALAPAPPPPPDKEPPEMRLAFSVKHPEIVLLADAKDKATHALFLKNTLEFNLIMAEGQQKMFGYIKNLNITSAAFDLKNRAATKSQVLYLSQLALHGSAPEGECLHIDVRTSIAQVHVSPATIKTMTACLMSLAPAQGQ----------SDKNNVIDDDVTLWSEKEIDKKSKWYLT 1685          

HSP 5 Score: 119.398 bits (298), Expect = 3.018e-26
Identity = 146/609 (23.97%), Postives = 256/609 (42.04%), Query Frame = 3
Query: 5526 VEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLE-VYPEEHNRQYSFEIEY-----------ISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFG-APYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYL--SIYRTEVRALLFS--PKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYY---------YSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHD-----------IKPGCLELVR---------------------------------TACL-------KVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFK--AKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYK 7115
            +++ R + +   M    + +E     + VP+L  +  +  ++K+  +++     +S+  +Y+N++++ WEPL+E V  +E NR +    E+                +G  D       ++ EP A+S++L S D L++T++KS LDV + LG AF +A SL      +I   +P+VV+N  G  +  ++     LKP    EE  + +     + LY A  EK++     K  +      A  +   +   +I   + R   +S  PK      RG        + +V   +  G + + +RS LQ+ N+    + L         SE +K   +         Y+VP+  +L+    +++         + S  LWN     + + T   L ++N    +Y         Y+V++ +E    V    T   Y      P+ +HN LP  I + SQ+  +D           ++PG L L +                                  A L       KVQ +IK+   Y   +W G ++L   M+EL+       AK+ +    ++LGV  +  +G  NVT+YSPYWM+NKTG  L YK
Sbjct: 2076 IDEERGEMLLFSMEGFSIKMEGAYGGQTVPLLSMDGHIQAEVKDWSSKLTASAGLSLIANYYNENVSEWEPLIEPVECQEKNRPWELSAEFKMGDEVGGGENGEEPSAGGLD-------VNSEP-AMSLVLESHDDLQITITKSGLDVFNKLGAAFSEAVSLRGGDMVAIEDMSPFVVRNEIGLGIKVHLGS--GLKPPPDHEEKALPVPVGKSLSLYLADPEKRASFKGVKGDEASDISIAVEVDGYHPIKNIPLKQARVAFYSIVPKQL---LRGTTM-----SAVVQIESGEGQRVITVRSPLQIHNHFPVPMDLCC----KQGSEVSKVTCIAPH----SVYDVPL--ILSYRAGLFLKPSGFGYNETTSPLLWNDLSQTKKA-TFTCLSQTNGEPPFYIEVHCEKAVYTVSVGMEANSPVF---TFHAYP-----PVVVHNYLPYSIHFSSQVSRNDGARQGDGGAVLVEPGKLALYKQFSRYSSKLTIKLLTPSVVHLLGTPFVNLEGGHNAPLYSVDMGKKVQLHIKLN-AYMGMDWKGDIELSRDMDELTTFTLSPTAKDTHLRP-VELGV-FSQNDGTMNVTLYSPYWMVNKTGMFLEYK 2644          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Nematostella
Match: EDO31907 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWL5])

HSP 1 Score: 259.225 bits (661), Expect = 2.735e-72
Identity = 166/524 (31.68%), Postives = 271/524 (51.72%), Query Frame = 3
Query:   27 VFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKR----NDPKKETETKDSFGEKLAAQIVKNLQI--------------------SISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFS-SENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHM-KPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDT----IKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDE--LQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIE 1502
            +FE LVV ++N  LG Y+  LD S L+L +L G A L +L+++++A D FDLPV+V  G + +++L IPW +LYS P    ++ +Y++  P  E  YD EK R+     ++K L +IEE+  K+     D     E  DSF EKL AQ++KNL+I                    S+ NIH+RYED  T     FAVG TL NLS +T D +  + ++   + +  FK V +D+LAVYWN +   +    N    K  M++ IS+  ++  D  +++QP+  SA  HV M +       VP++ +++  +++  A ++ Q+ ++   +DS +      +++KY+P V +  N S WW + Y  I EE +R     WSW+ I+AHR R R Y  ++++KL  K    SE+++    ++  E++L + ++ + +QQAE++V        +                         T + S  +  G +E  L K       ++EK KLY+AI YSE       P+E
Sbjct:    1 MFEQLVVSVLNSVLGRYIRDLDSSNLELAVLQGQAVLRDLELRDDALDGFDLPVQVTHGFVGEISLTIPWTNLYSSPCDICIEDVYLIASPVKEQPYDAEKARASELAVQRKRLRQIEESLAKKATESTDGIAHAENGDSFVEKLMAQVIKNLKISPVQFIEERTENTLAALTTVSVKNIHMRYEDQVTSCESPFAVGFTLQNLSAETTDDNWKTSVVNA-AAKTVFKLVSLDNLAVYWNPDQHAYDLYGNHWNWKGKMEDGISTKAKQPKDYEYILQPL--SAECHVIMDQTSKVEMDVPKLLVEVIQQELSLAMSQKQFHNLMDVIDSFELMSVNQQYKKYQPTVKVHGNASKWWKYAYTAICEEGIRS----WSWERIKAHRARYRAYKSLYKRKL--KGFHDSERESSLRHLQALEDDLGIPSVLIAKQQAELEVPPEMREVLSPAK----------------------TSSGSWWSWLGGEEDLLSKLTVEALPKDEKEKLYKAIDYSEGARPIKYPLE 493          

HSP 2 Score: 62.7734 bits (151), Expect = 2.744e-9
Identity = 50/163 (30.67%), Postives = 76/163 (46.63%), Query Frame = 3
Query: 1386 GSDELQKKVRSE-FTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEY--KLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDG--SVPTLVSTQAQ--SKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDT 1853
            G ++L  K+  E   ++EK KLY+AI YSE       PIE  +             +     +E+  K+ ++     +A ++QR   DA+     +N  QV GT  P    S P L+S++    S    LL    ETNPL   A   + ++ EP+EI YD+ T
Sbjct:  518 GEEDLLSKLTVEALPKDEKEKLYKAIDYSEGARPIKYPIEVGTTGR----------VQGRDYREFARKIAEVATEGFAAAIEQRPGGDAMRFQAEVNGFQVLGTPNPSDCQSRPCLMSSKTSLGSDGKALLSFTAETNPLHVCAEYAVALKVEPVEIRYDNVT 670          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Nematostella
Match: EDO31906 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWL4])

HSP 1 Score: 181.03 bits (458), Expect = 2.991e-48
Identity = 108/309 (34.95%), Postives = 163/309 (52.75%), Query Frame = 3
Query:   27 VFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKR----NDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSS-GTSII--------------------------------------IKEDSTREFFKSVKMDSLAVYWNSNPKPFS-SENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHM 821
            +FE LVV ++N  LG Y+  LD S L+L +L G A L +L+++++A D FDLPV+V  G + +++L IPW +LYS P    ++ +Y++  P  E  YD EK R+     ++K L +IEE+  K+     D     E  DSF EKL AQ++KNL++S+ NIH+RYED  T     FAVG TL NLS +T D +  TS++                                      +   + +  FK V +D+LAVYWN +   +    N    K  M++ IS+  ++  D  +++QP+  SA  HV M
Sbjct:    1 MFEQLVVSVLNSVLGRYIRDLDSSNLELAVLQGQAVLRDLELRDDALDGFDLPVQVTHGFVGEISLTIPWTNLYSSPCDICIEDVYLIASPVKEQPYDAEKARASELAVQRKRLRQIEESLAKKATESTDGIAHAENGDSFVEKLMAQVIKNLKVSVKNIHMRYEDQVTSCESPFAVGFTLQNLSAETTDDNWKTSVVAAAAKTVFKVTSCESPFAVGFTLQNLSAETTDDNWKTSVVAAAAKTVFKLVSLDNLAVYWNPDQHAYDLYGNHWNWKGKMEDGISTKAKQPKDYEYILQPL--SAECHVIM 307          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Nematostella
Match: EDO42077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2Q1])

HSP 1 Score: 166.777 bits (421), Expect = 4.596e-46
Identity = 94/187 (50.27%), Postives = 130/187 (69.52%), Query Frame = 3
Query: 9021 LNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDG 9581
            ++ F+ S+G  + DM D   KL +FE+    +    +   IT HY  Q +RQ+Y LVLGLDVLGNP+ +I G+ +GV DLFYEP +G + GP+EF EG+A GVKSL GH VGG AGA SRI G++G+ +A LT D+DY+ KRR+++   P+ +G GL  GGK L++G V G+ GVV KPI+G K++G
Sbjct:    1 MDFFMDSIGATLIDMNDAQLKLAFFERVGVFITQENLQGQITRHYTMQGVRQVYALVLGLDVLGNPYALISGIGEGVRDLFYEPYQGIIYGPQEFAEGLARGVKSLLGHVVGGTAGAFSRITGSIGQAVATLTFDSDYRMKRRQRMHVEPKGVGQGLIMGGKSLVMGLVFGIGGVVMKPIEGRKEEG 187          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Nematostella
Match: EDO41450 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4C6])

HSP 1 Score: 171.4 bits (433), Expect = 5.437e-42
Identity = 118/416 (28.37%), Postives = 208/416 (50.00%), Query Frame = 3
Query:   27 VFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIP---NSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETK------DSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQ-TCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEE-QVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQA 1241
            + E L   ++  Y+G+YV  L+  QL +G+  G   L NL +K+ A    DLP++V+ G I  L L IP +   SEP I  +D LY++  P   N+E     E ER ++ + +Q +L    E++ + +  K +T          S     +  IV+NLQ+ IS++HIRYED S   +  FA GIT+  L+ Q T D   T  +I+ D + + +K + + + A+YW+S+           L+  ++  I  S   +   S++++ IS SA +  +          PR  +D+ +E+I  +    QY      +   +R + + R+ K+RP VP+++N  +WW F    IL   Q R R    S+   +AH     +Y  ++ + L+  +L  ++++ ++  E+EL    + + R+ A
Sbjct:    1 MLEGLAAWILRTYVGEYVENLNTEQLSIGV--GTVDLHNLPLKKTALQGLDLPLEVKSGFIGHLQLSIPLRRPKSEPWIINIDKLYLVAGPPLHNNEYNEQQEAEREWIRKKRQLDL---LESQWQESQQKGQTGGFWSGSWWPSLYSSFSTTIVENLQLVISDVHIRYEDASIDQHTPFACGITIDRLAAQSTNDKWETEEVIQNDHSIK-YKLIDLQNFAIYWDSDAPLVGDLPSTKLEVALQRTIDKSSGSIGKHSYILESISASAKLQRNATALPLRDKNPRFVVDVHVERIPLSLAEVQYRMGMKLMGEFERFFRQARYHKWRPKVPVKNNAKLWWQFASTCILHFIQERNRHHTLSFATKRAH--DLVVYVKLYTEHLMSNQLESAKKEELERIEQELSFEELAVLRRLA 408          

HSP 2 Score: 79.337 bits (194), Expect = 3.767e-14
Identity = 115/447 (25.73%), Postives = 203/447 (45.41%), Query Frame = 3
Query: 8514 LQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLK-PLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVS--------GSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFR---IRPPR-FIAKDGIIRSYGLREAEGNNIWIKITE 9815
            + Y  +P    +   I +IQ+DNQ+ +   PV+  P    +    +   + P + +SA    +       YK   V ++ M L +++  +  +L F           +    D+E ++  D Q  RA++  +          ++  F+   I+P+++ +S     V   G+    SE L     S+G+ + +++D    L  F + +    +N  + S++ HY  +   Q   +V  +D LGNP G++  ++ G+E L     RG V G       VA+GV             + ++I G++  G+   ++D  ++  R    A+R  +       G +GL +G V G+T +VT+PI+GA   G+ GF  G+ KG+VG V +P +GV+DFAS +   +R  A  +   F     RP R     +G I  Y    AEG  I +K+ E
Sbjct: 4368 VDYVRTPKIETLEANIGRIQVDNQLFNSTLPVLLYPTAAEKGSREEHATQQPTLHISASKEPTRIQNVEIYKGVEVTLRRMTLHVEERLLLKLLQFFGYVQKDDDLATTDEEDDECLY--DNQ--RAAVTSSG------PASRRYYFERLQINPMQLKVS-----VASAGRL---SEDLASLKSSLGLILFNLEDATLDLESFIRDHPFESLNSHLDSMSKHYTEELRSQTAAIVGSIDFLGNPMGLLNDVSSGLEGLVK---RGNVGG---LFLNVAHGVSD-----------SAAKITGSLSDGLWNASMDTKFKESRETMRAERYGSSRDHFMAGMRGLGMGLVGGLTSIVTQPIEGAHNAGLSGFMTGLAKGIVGTVAKPTAGVLDFASGTAAAVRGQATRSSRYFPPKCTRPRRNCFGPNGSIPRYSRTHAEGQEIMLKLNE 4779          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Medaka
Match: vps13a (vacuolar protein sorting 13 homolog A [Source:NCBI gene;Acc:110014158])

HSP 1 Score: 555.444 bits (1430), Expect = 2.558e-158
Identity = 361/1064 (33.93%), Postives = 587/1064 (55.17%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLK---RNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPET-TNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQE-EKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQ--AQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSE-RTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQV-LRAINVLPDSETASLTSTIXXXXXXXXXFKD---ALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIP 3179
            MVFESLVV+++N++LGDYVV LD SQLKLG+ GG+A L++L+IKENA  + D+P KV+ GHI +L LKIPWK+LY++ V A LDG+Y+LI+P + +KYD EKE   L E +Q+EL RIE+ K K   ++DP++E +  DSF EKL  Q++KNLQ+ I+NIH+RYED                N+S QT D +    ++ E++ R FFK VK+++L  YWN N   FS+++       ++N+++  +    +  F+I+PIS  A +   M P +  +F+ P++ L + L ++    N+ QY  I   LDS+D       +RKY+P V +  N   WW +    ILE  V+    MWSW++I+ HR   + Y + ++ K+  KK S +    ++  E+ LD+ NITL R+QAE++ SK                             + +++   S   +   E QK+ ++ F     KAKLY AIGYSE   +P++P ++  +K+N  +++L   I D   K  ++M+L +  + + + QR  A AI +   ++  +VTG    +   PTL+S++  A      LLI+ FETNPLD+SA+Q+ ++ ++PLEIIYD+ TVN + +F   P+++QL E +   L  +E+ K+ TATGL ++ + +   D+KV++  SY I+P+ G Y     +LL+DLG   + S+ + ++P               N + +   AYD F + LS++Q L  + G DW+K R Q+ S  HIL P     +  + ++  D+ +PK  V G LP L + ISD  L++VLEL+  IP      P+  P+  +     + K   + P L+     +     ++  D    + +S + +D      F D    L  +D+    +++   K    KNM +    F+IN F +Q+ +      + +     ++ L +  +GT L L+ FDM    Y+  + L  P++VD   K  V L  T  +++  +LL +  +  +K  P+F ++H NT   ++  F S++V LH EALL  +NF+++L+P
Sbjct:    1 MVFESLVVDVLNRFLGDYVVNLDSSQLKLGIWGGDAVLKSLEIKENALSELDIPFKVKAGHIGRLELKIPWKNLYTQSVEATLDGVYLLIVPTASIKYDAEKEEKQLQEARQRELQRIEDTKRKAAEQDDPQQEKQ--DSFMEKLVTQVIKNLQVKIANIHVRYED----------------NVSIQTSDKNWKPSLLDENA-RLFFKLVKLENLFAYWNVNSVLFSTQSAEEALRSLENSMTIQKSPAANHDFIIRPISADAKLK--MNPRSDVDFSSPKVDLMVNLSEVAIELNKPQYISILELLDSVDMMSRNLPYRKYKPVVQVHQNAGTWWKYCITSILEVNVKPHLHMWSWQHIRRHRATVQCYKEFYKTKITCKKPSDNLLKDLENTEKALDIFNITLARRQAEVEASKA----------------GLRIYRPGVKMEEEESQGWFSWVWNWGGE-QKETKNNFGNIISKAKLYTAIGYSETAANPNLPKKFEDMKVNFHMERLCVSIKDEKDKN-EVMRLTVGELKSTLTQRPGAQAIKITAELSLFEVTGL-ASNRPAPTLLSSRRAATKTGTPLLIILFETNPLDESADQRFHVSSQPLEIIYDALTVNSVSEFFRLPDDVQLNEFTKATLMKLEQFKDRTATGLLYVIETQKVLDLKVNLMASYVIVPQSGFYDGTQNILLLDLGHFKMASQSKENLPQLTPC--------PSNIEAIMSRAYDTFDVQLSSLQFLYSKPGGDWKKARKQKQSPLHILEPVDVNVDFSRAMVVKDSRMPKYKVLGELPLLSLRISDIKLRNVLELVDSIPL-----PESKPSAHNTAPSSTQK---VRPALSQNRKSLKFSEFDLTEDLFYDAPSSPVGDDSF----FPDNPLPLRYVDSR---NRRSLIKEDVQKNMTEFLMTFLINEFSVQLCR------MSEGQEVTVLHLDIEGLGTELQLRTFDMTSNTYLREICLTCPEYVDMEQKQ-VQLITTLDNSE-DDLLTLEYIKADKNGPEFKSLHNNTEQMIKVTFSSLDVHLHTEALLNTINFLSNLLP 993          

HSP 2 Score: 521.546 bits (1342), Expect = 6.625e-148
Identity = 369/930 (39.68%), Postives = 534/930 (57.42%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLY-CNELVENAGWIKVPPGE-AVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPF---YESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELI----LPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNL-TSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKW-NQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVE---EHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSG-SVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTG-KTALHSEV-----LNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEI 10076
            K + F +  K  L I++S  SD+FSLDTVGS GKV CK     Y VGVKIN SS  LT+IVTF+P+Y ++N++   ++ C +  E   W ++ P + A PFWP +   K   ++ KV+     +T P       + +S+L+ L     GI V+V ++E    I    Y++G A   +INH  D   ++F Q  + Q+ I    L A + V Y W D    RE  W        +S  L T + + D   +E K + +SF     R+++FT D  +      S  +++ +QEI + L ++G+SLV+N+  QE+++I IT S V W +Q R+K R K L + + + LE  F E++N     +A VE    + V+     VD+    M++P    L R F PG+ ++Y  SP Q    ++I++IQI NQM    FP VF P   P+S+ +D+  KPLI++  V   +G +   R KYF+VLIQEM L LD GF+ SI D V+  +  +     +F KD + I+  L + S   T        +++ FHISPIK+H SFSLS     G K    +EV     LNL L+S+G  +TD+QDV+FKL  FE +       Q+   +  HY  QA++Q YVLVLGLDVLGNPF +IRG+++GVE  FYEP +GA+ GPEEFVEG+A G K     AVGG AGA  ++ G M KGIAA+T+D DYQ+KRRE + ++P  L  GLA+GGKGL+ GFV G+TG+VTKPI GA+K+G  GFFKG G+GLVG + RP  G+VD ASS+F+GI+R A+ +  V  +RPPRFI +DG+IR Y  REA G+ +  KI  +        Y  H    ++ + + +T + IF + R    G  + +WQ  +E+    P I+  +  +    KE+ + +F      K I
Sbjct: 2228 KPRHFLRNNKVRLMISESELSDEFSLDTVGSHGKVKCKGIHKDYLVGVKINASSFSLTRIVTFVPFYTLVNKTKYKIFICED--EGDTWTEINPEQPATPFWPENGTKK---LKIKVDG---CLTPPLKVDFTRQENSLLLHLNDSLGGIIVDVNLSEHLVTIQFSEYRDGSAPFLIINHTNDQT-LYFNQ--SSQKEIEKEELEAGKAVYYTWTDPTGSRELCWTC----GPYSGTLKTEEDLHDDMKDERKLFVISFFEGLQRVVVFTEDQDIYNLLGESEKIQAAEQEIILLLQNVGVSLVNNTTSQEVSFIGITCSDVVWESQPRKKKRWKILNIKEGDMLEKHFKEYINSSPIEDAIVELENNYKVRFTSNGVDMR---MLQPFDAPLRRHFLPGIKVEYSISPRQSTYRVKIHRIQIQNQMQSAIFPYVFYPVKLPKSITMDSEPKPLIDICIVTRAAGHSEIPRIKYFKVLIQEMDLKLDLGFLYSIFDLVNPENTTSMSPVELFEKDIEYIKTDLNDVSAADT----SPISLYEFFHISPIKLHFSFSLSSGGEDGSKEKRATEVIPVQSLNLLLKSIGATLTDVQDVVFKLPAFELKFQFCTTQQLQWKVIRHYSKQAIKQAYVLVLGLDVLGNPFALIRGLSEGVEAFFYEPYQGAIRGPEEFVEGMALGAKVFVDKAVGGLAGAAFKMTGAMAKGIAAITMDEDYQQKRREAINRQPSGLKEGLARGGKGLVSGFVSGITGIVTKPIKGAQKEGAVGFFKGCGQGLVGAIARPTGGIVDMASSTFQGIKRAAEASQNVESLRPPRFIHEDGVIRPYKAREANGSQMLQKI--ENGRFAKYRYFAHANI-NESDFLMITKRGIFFVTRG-TFGQLTCEWQYLFEEFTMDPRIDGGRR-LRIEAKERVKSVFHAKEFGKII 3130          

HSP 3 Score: 264.618 bits (675), Expect = 8.120e-70
Identity = 227/887 (25.59%), Postives = 421/887 (47.46%), Query Frame = 3
Query: 3468 ITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFA-----IDQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNE---AINQVPSVPESKEEVKSRKILPKDDKSGSARTASDE-----SITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIK--NDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHN---RQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDL 6074
            I A L+ L+V +  +K   I +I + G+ ++V       EVS  + ++ + D +  A YKK + I  D+ +F+ ++  +   T   GY L++S VD  V + VG I++IFL  F+  I  F+N+FQ + + +A    + +E AA+ +  + E   S+R  L+++  APVI++P++S S N ++ DLG L+ KN F       D +   V+++  + LS+L++ R+  +    K E  +L P+++ +++ RNLS N  H IP I I+A +  +S+ + Q D  +    L  N +E   A++ +P +P +KE   S       +   +A     +       T++  FK + + V L   + N  E          L +     +S    M  +S+M+  V+L+    LD +  S K +   +  ++   + +  + + + Q  +  +   V +  +Y+C  +++L+ + D F+KA               +G+ + P+  +     SPV    +  E++V V  PEI+ V D+   D+ A+++ T   L      +  ++   I D Q + CPF +  R  N   ++ P  +    ++  +      +++  L + ++P +I ++  I + LT  +      R          L+    WEK+ + E +  F+ +                S  D   ++  + +  + Q+ +    I + LE+ V    VPML+ + S DG++KN  T I L     + V Y+N+ + VWEPLLE   +E     R ++ E++ ++  D  + DE DF    ++      I+  S+D L +T++   L +LSNLGKAF +A     +  +    AP+VVKN  G  V   ++K F L
Sbjct: 1028 IRADLRCLKVFLRGQK-ARISEIRVEGLVSEVLQRKKMMEVSANLKNIVVLDCNKEASYKKAVSIA-DKEVFAFRMLNYTDATEGDGY-LNMSNVDTSVTLTVGCIQVIFLNKFLDSILAFINNFQMAKEAIAEVTVQAAEKAASGVKELSER--STRISLEVHFNAPVIFLPQSSSSSNVIVADLGKLSVKNRFVKQPFKSDSTIPPVVDKMTVKLSDLKMYRTTYISGIFKGESQLLKPVSLDLEIQRNLSSNWYHNIPDIEISAHLKPMSLILCQDDMIVVLRTLGENLSEKSDAVSPLPDLPSAKESQNSGASGSDSNIVVTAAVVETQKYVKLKTTLKLEFKFDSMTVVLHSPNKNEMEMLDLHHEQLKLAEFTLGTISTSVQMFSDSSMKAFVQLTACQ-LDDKRPSIKMVTSRMVAMRPGAEQNTMMEVNYRQGHDGTTIDTV-VQDLYLCASMEFLLTVADVFLKATQ-------------QGFAQGPQA-KSTAGTSPV----SKTEMNVVVRNPEIVFVADLSRADAPALVMTTQCELDMKNGADGQMMTAIIKDLQVMACPFLTSKRGNNMTTVLQPCQVFFQSSQHPDAPQVMEVSINALSLKVSPIIINTVITIQSALTPTTETHEEER---------SLVPVKLWEKQSWKELKMWFLEEN---------------SDEDTKSLVPLIPKGESLQVTIN--SICLTLEAGVGHHTVPMLLAKSSFDGNVKNWTTLINLKSKFDLEVHYYNEMMGVWEPLLEPLEDETGEDFRPWTLELKPMNLSD--IADEVDF----NLPDYKTVIVFNSKDQLNITLTNCGLSMLSNLGKAFSEAAKQTADSFQKD-EAPFVVKNMLGLPVSLQLSKRFHL 1856          

HSP 4 Score: 65.0846 bits (157), Expect = 2.059e-9
Identity = 44/138 (31.88%), Postives = 73/138 (52.90%), Query Frame = 3
Query: 6777 LHNQLPIKISY---QSQIFSHD--IKPGCLELVRTACLKVQSNIKVTY-HYQKKEWFGSLDLGPKMEELSVINFKA----KEGYSESF------MDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEH 7142
            LHNQLP +I+Y   ++ + + +  +KPG    + TA +  QS +++    Y  ++W     +    EE+S I F++    ++ Y E        +D+ VH+   +G   + I+SPYWM+NKTG  L Y A DD   +H
Sbjct: 2078 LHNQLPYQITYRLKETGVSAPEAILKPGHSTQLHTAVIN-QSQLELRLIDYLSQDWSSEYSISSNQEEISFIVFQSLKEEEDEYVEGTERKKAELDIAVHVKDDSGHTAIAIHSPYWMMNKTGRLLQYNA-DDIHHKH 2213          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Medaka
Match: ENSORLT00000000640.3 (pep primary_assembly:ASM223467v1:3:5428377:5447491:1 gene:ENSORLG00000000514.3 transcript:ENSORLT00000000640.3 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 412.149 bits (1058), Expect = 1.393e-122
Identity = 324/834 (38.85%), Postives = 468/834 (56.12%), Query Frame = 3
Query: 7350 KNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAG--WIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFY-ESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSN--NLTSDGIEDF-YINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKK--LMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFR------VLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRT---GKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIW 9800
            + +K     +  L I+ S WSD FSLDTVGS G   C +     +VGV I +SS  LT+IVT  PYY ++N+SS  L   E+V  +   W  +   E +P WP +  GK  +     E      ++ F F+ E    L+KL+    GI + V  +  + +I+   Y EG A   L+NH      I + Q  +     L   +   + W D  + R   W       +HS   NL  D +  F Y N+ + +W+SF+    R+LLFT D  V   AR + +LE   QE+ +SL S+GLSLV+NS + E+AYI I +SGV W +++ KNR KP      E LE A+     +L +++       V     +V+LS+   +M KP  C + R F+PG++++ + S HQ  +  +++ +Q+DNQ+                                        GAM    F        +++    ++    V ++  F SG +           D Q ++A L+E S  +T  SG     F+ FHISPIK+HLS SL   + +      AL S  LNL L+S+G  +TD+ DVIFKL +FE +       +++     HY  Q L+QMYVLVLGLDVLGNPFG+IRG+++GVE  FYEP +GAV GPEEF EG A GV+SL GH VGGAAG VS+I G+MGKG+AA+T+D ++Q+KRRE++ ++P++    LA+GGKGL+ G V GVTG+VTKP++GAKK+G  GFFKG+G+GLVG+V RP  G+VD ASS+F+GI+R A+   EV ++RPPR I +DGIIR Y L E++G +++
Sbjct:  107 RRKKLFTENQVKLCISTSSWSDGFSLDTVGSYG---CSRSGSILQVGVSIQVSSFNLTRIVTMSPYYTLVNKSSYELEVGEVVNASSTKWHYISSTECLPLWPENAQGKLCVRVVGSESS----SECFFFHREDRGTLLKLDCG--GIILNVNGSNHSTVISFSDYYEGAAPALLVNHTAW-ATIAYSQSGSAVVHELKPSEARKFVWDDPTRPRMLRW----SYMEHSGELNLLKDEMGQFSYDNKSQIHWISFLDGRQRVLLFTEDTGVVTKARQAEELEQSQQEVRLSLQSLGLSLVNNSSRHEVAYIGINNSGVVW-EMKPKNRWKPFSQKNIELLEKAY-----QLNSTDLTCCLWFV----YQVNLSRAGMMMRKPYSCPIRRTFQPGIYMELKQSLHQRSLRAQLHWLQVDNQLP---------------------------------------GAMFPIVFHPVPPPNTMLKRHPFLVTNSEVTTMFVFQSGLIEA---------DLQGLQAELMEASLSET--SG--LSFFEYFHISPIKLHLSLSLDSSSNSMDQETAALQS--LNLLLKSIGATLTDVDDVIFKLAFFEVKYQFYRREELMKEAARHYGEQFLKQMYVLVLGLDVLGNPFGLIRGLSEGVEAFFYEPFQGAVQGPEEFAEGFAIGVRSLLGHTVGGAAGMVSKITGSMGKGLAAITMDKEFQQKRREEMNRQPKDFSDSLAKGGKGLLKGVVGGVTGIVTKPVEGAKKEGAAGFFKGIGRGLVGIVARPTGGLVDMASSTFQGIQRAAEATEEVTKLRPPRLIKEDGIIRPYDLTESQGFDLF 862          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Medaka
Match: ENSORLT00000031398.1 (pep primary_assembly:ASM223467v1:3:5374961:5398684:1 gene:ENSORLG00000029522.1 transcript:ENSORLT00000031398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 369.007 bits (946), Expect = 6.852e-110
Identity = 242/724 (33.43%), Postives = 392/724 (54.14%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFD------DFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKET--------------ETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDT---IKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDN-SLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSM 2123
            MVFE+LV + +N+++GDYV  LDKSQLK+G+ GG+            FD      +FD+P KV+ G I++LTLKIPWK+LY+E V+A ++GLY+L++P + +KYD  KE  Y  E KQKEL RIEE  L+    + E+              E KD+F EKLA Q++KNLQ+ IS+IH+RYED  +          +  N     C +      I  ++ +  +K   ++ L  YWN N   F  E+   +  ++   + S +       F  +P+   A + ++   E    + P+++L L+++ I F   + QY ++   L+S DR      +R +RP+VP+ +N  IWW +  N I+E  +R    MW+W  I +HR   + Y  +++ K+L +  S++  DT   I+  E+ LD+ NITL RQQA+M+V +      AKK   +        GWF     K D E   +L                T EEK KLY AIGYS  + +  +P +YV++ +  +L +    + +   + E  ++K+ + ++S  V QR  A A  V + + +  VTG +   G VP+L+++   S   +LL V FE NP + + +Q + + ++P+EIIYD+ TVN +V F    + + L  +++  L+ +EE+KE TA GL H+ + R   D+ +D+KPSY +LP+ G Y+   ++++VD GS  + S  + +
Sbjct:    1 MVFEALVSDTLNRFIGDYVENLDKSQLKIGIWGGDG-----------FDVFVFQSEFDIPFKVKAGQIARLTLKIPWKNLYNEAVVASMEGLYLLVVPGATVKYDAAKEERYQQEAKQKELRRIEE-VLQVATSRSESLLLKFLVVSDTPKAEKKDTFVEKLATQVIKNLQVKISSIHLRYEDDVSTDQG------SDCNTCLMICFNENWKSCILNEAAKIIYKLGSLECLCAYWNVNSVMFYKESWENI--VVSLIVESPQWPFLFTVF--RPVFAFAKICINPNAE-LELSSPKVNLHLEVQNIAFEMTKLQYLNMVELLESFDRMVKNAPYRMFRPDVPVLNNARIWWKYSINSIMEVHIRHLSHMWAWSNILSHRRNLKAYKTVYKNKILAQ--SKTGPDTERQIQDLEKVLDVFNITLARQQAQMEVIRSGQKLAAKKAAGQKQGGGFFSGWFGKKTKKEDQEFEENL---------------MTPEEKEKLYTAIGYSGSSHNLTLPKQYVAVVVTFQLLRTSLTLREQPDIPE--IIKVQMINLSTKVSQRPGAQAFRVEMALEHWFVTGLQ-QQGDVPSLIASVGDSS-SSLLSVVFELNPEESTGDQLLRVHSQPVEIIYDALTVNSMVDFFKTEKFVNLEVLTSATLSKLEEIKEKTAAGLSHIIETRKVLDLMIDLKPSYLLLPKSGFYSATSELVVVDFGSFQVSSRASCL 680          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Medaka
Match: vps13d (vacuolar protein sorting 13 homolog D [Source:NCBI gene;Acc:101163959])

HSP 1 Score: 162.155 bits (409), Expect = 8.895e-39
Identity = 115/393 (29.26%), Postives = 198/393 (50.38%), Query Frame = 3
Query:   27 VFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETT-NFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEE 1202
            + E LV  ++N YLG YV  L+  QL + LL G   LENL ++++A  +FDLP +V+ G I K+TL+IP+   +S+P +  +  L ++I P    +YD EKER    E K K L +  E+K K    +K      S    L  +IV+N+++ I ++H+R+ED S+     F+ G+ + N+S Q         ++++       K +++   +VYW++  +         ++  M   + + E +     ++ +P+  SA++  +   E   + + PR+   ++LE +    ++ QY  I  FL  +DR      +RK+RP VP+ +N   WW F     L   +R +RR  SW +        R YT ++  +L    LS  E+  +K  EEE
Sbjct:    1 MLEGLVAWVLNTYLGKYVSNLNTDQLSIALLKGAVELENLPLRKDALREFDLPYEVKAGFIGKITLQIPFYRPHSDPWVISMSQLNLIIGPAPPQEYDEEKEREDENERK-KHLLKALEDKFKCECEQKGESYWYSVTASLVTRIVENIELKIQDVHLRFEDDSSNLENPFSFGVCINNVSAQNPAKEMVQKLLRQ-------KQLEIQDFSVYWDTECEMLGKLPANQIQDAMTQCMLNREHQ-----YIFEPVCASALVRRNASKEPLRSRSTPRIEGLVQLEPMSLRLSQVQYLQIMTFLKELDRRERGMFYRKWRPKVPIHTNCRQWWMFAIEANL-NVIREQRRRCSWIFSLQRARDARTYTSLYFTRLRGIPLSPLEESELKRVEEE 379          

HSP 2 Score: 57.7658 bits (138), Expect = 3.265e-7
Identity = 134/525 (25.52%), Postives = 244/525 (46.48%), Query Frame = 3
Query: 8295 QIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQY-RTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKD-GIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTN---IEVFRIRPPRFI--AKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYV 9848
            QI   N+ + ++ + S   E + ++  +R    E EV  ++   EGL + L  K    PE+   + +F  GV + + RT  ++V + L +  IQ+DNQ+     PV+    P      L+    P +++++V + S       +K+  V  Q   +++++  +  +L F       Y E      + +M+  SL E  + +      K+  F+N  IS  +I LS   S+       AL          ++G  +   +D +  +  F + +       + + I  H+  + + Q   ++  +D LGNP G++  + +GV +L      G V G    +  V +GV +           + ++  GT+  G+   T+D  +Q + RE +       G  L  G  GL  G + G+T ++T  ++G K + G+ GFF G+GKGLVG VT+PV+G +DFAS + + +R +A  +   + V R+R PR     +D ++R Y   +AEG     ++T   D I +E ++
Sbjct: 3665 QISDFNQRRIIRSSASNEHEESAEDTKSRPHRQELEVTVNLE--EGLGISLVNK---SPEELVFATLF--GVDIHFTRTVTNEV-LELSVQNIQVDNQLLGSTQPVMLCVTPNSSDCNLNES-GPALQVNSVKVPSTLMLTELFKHLMVTAQRFTIIIEEKLLLKLLSFFG-----YGEAE---AELEMLDESLPERPSEEA--GPPKRYYFENLKISLPQIKLSVFTSQKLPPDLKALKG--------TLGFPLIRFEDAVINMYPFTRVHPYETQEIIFNDILKHFREELMSQAAQILGSVDFLGNPMGLLNDVTEGVSELIK---YGNVGG---LIRNVTHGVSN-----------SAAKFAGTLSDGLGK-TMDNRHQSE-RECIRYHGATSGEHLVAGIHGLAHGIIGGMTSIITSTVEGVKMEGGVSGFFSGLGKGLVGTVTKPVAGALDFASETAQTVRDMASLSSHRLGVQRVRKPRCCKGPQDLLLR-YSAVQAEGQEQLFRLT---DNIHSEFFI 4139          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Medaka
Match: vps13d (vacuolar protein sorting 13 homolog D [Source:NCBI gene;Acc:101163959])

HSP 1 Score: 162.155 bits (409), Expect = 9.595e-39
Identity = 115/393 (29.26%), Postives = 198/393 (50.38%), Query Frame = 3
Query:   27 VFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETT-NFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEE 1202
            + E LV  ++N YLG YV  L+  QL + LL G   LENL ++++A  +FDLP +V+ G I K+TL+IP+   +S+P +  +  L ++I P    +YD EKER    E K K L +  E+K K    +K      S    L  +IV+N+++ I ++H+R+ED S+     F+ G+ + N+S Q         ++++       K +++   +VYW++  +         ++  M   + + E +     ++ +P+  SA++  +   E   + + PR+   ++LE +    ++ QY  I  FL  +DR      +RK+RP VP+ +N   WW F     L   +R +RR  SW +        R YT ++  +L    LS  E+  +K  EEE
Sbjct:    1 MLEGLVAWVLNTYLGKYVSNLNTDQLSIALLKGAVELENLPLRKDALREFDLPYEVKAGFIGKITLQIPFYRPHSDPWVISMSQLNLIIGPAPPQEYDEEKEREDENERK-KHLLKALEDKFKCECEQKGESYWYSVTASLVTRIVENIELKIQDVHLRFEDDSSNLENPFSFGVCINNVSAQNPAKEMVQKLLRQ-------KQLEIQDFSVYWDTECEMLGKLPANQIQDAMTQCMLNREHQ-----YIFEPVCASALVRRNASKEPLRSRSTPRIEGLVQLEPMSLRLSQVQYLQIMTFLKELDRRERGMFYRKWRPKVPIHTNCRQWWMFAIEANL-NVIREQRRRCSWIFSLQRARDARTYTSLYFTRLRGIPLSPLEESELKRVEEE 379          

HSP 2 Score: 57.7658 bits (138), Expect = 3.462e-7
Identity = 134/526 (25.48%), Postives = 244/526 (46.39%), Query Frame = 3
Query: 8295 QIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQY-RTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLF-YEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKD-GIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTN---IEVFRIRPPRFI--AKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYV 9848
            QI   N+ + ++ + S   E + ++  +R    E EV  ++   EGL + L  K    PE+   + +F  GV + + RT  ++V + L +  IQ+DNQ+     PV+    P      L+    P +++++V + S       +K+  V  Q   +++++  +  +L F       Y E      + +M+  SL E  + +      K+  F+N  IS  +I LS   S+       AL          ++G  +   +D +  +  F + +       + + I  H+  + + Q   ++  +D LGNP G++  + +GV +L  Y  V G        +  V +GV +           + ++  GT+  G+   T+D  +Q + RE +       G  L  G  GL  G + G+T ++T  ++G K + G+ GFF G+GKGLVG VT+PV+G +DFAS + + +R +A  +   + V R+R PR     +D ++R Y   +AEG     ++T   D I +E ++
Sbjct: 3671 QISDFNQRRIIRSSASNEHEESAEDTKSRPHRQELEVTVNLE--EGLGISLVNK---SPEELVFATLF--GVDIHFTRTVTNEV-LELSVQNIQVDNQLLGSTQPVMLCVTPNSSDCNLNES-GPALQVNSVKVPSTLMLTELFKHLMVTAQRFTIIIEEKLLLKLLSFFG-----YGEAE---AELEMLDESLPERPSEEA--GPPKRYYFENLKISLPQIKLSVFTSQKLPPDLKALKG--------TLGFPLIRFEDAVINMYPFTRVHPYETQEIIFNDILKHFREELMSQAAQILGSVDFLGNPMGLLNDVTEGVSELIKYGNVGG-------LIRNVTHGVSN-----------SAAKFAGTLSDGLGK-TMDNRHQSE-RECIRYHGATSGEHLVAGIHGLAHGIIGGMTSIITSTVEGVKMEGGVSGFFSGLGKGLVGTVTKPVAGALDFASETAQTVRDMASLSSHRLGVQRVRKPRCCKGPQDLLLR-YSAVQAEGQEQLFRLT---DNIHSEFFI 4145          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Planmine SMEST
Match: SMESG000037244.1 (SMESG000037244.1)

HSP 1 Score: 6622.72 bits (17181), Expect = 0.000e+0
Identity = 3378/3382 (99.88%), Postives = 3381/3382 (99.97%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKKSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS 10169
            MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEMKVSKLKANKKAKKMRKKLNQKTSSGGWFSGWFGKSDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIDEDDNEDEEFKDALEIMDNNVIIDKKKTSKLSKIKNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQ+TSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGD+NPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVKAQPPPIQPPKKAMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDD+GLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVLFSFLSKSIFSKKKETISQAIVKKSDSGYSLQSLDTVESPAEDLHD LDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNFPVVFAPFPPPRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFGHAVGGAAGAVSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIVGFVQGVTGVVTKPIDGAKKDGIEGFFKGVGKGLVGVVTRPVSGVVDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS
Sbjct:    1 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEMKVSKLKANKKAKKMRKKLNQKTSSGGWFSGWFGKSDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIDEDDNEDEEFKDALEIMDNNVIIDKKKTSKLSKIKNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQNTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDSNPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVKAQPPPIQPPKKAMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDNGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVLFSFLSKSIFSKKKETISQAIVKKSDSGYSLQSLDTVESPAEDLHDQLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNFPVVFAPFPPPRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFGHAVGGAAGAVSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIVGFVQGVTGVVTKPIDGAKKDGIEGFFKGVGKGLVGVVTRPVSGVVDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS 3382          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Planmine SMEST
Match: SMESG000037244.1 (SMESG000037244.1)

HSP 1 Score: 6452.85 bits (16740), Expect = 0.000e+0
Identity = 3319/3402 (97.56%), Postives = 3325/3402 (97.74%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQ---------------IYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKK----SDSGYSLQ-SLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS 10169
            MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEMKVSKLKANKKAKKMRKKLNQKTSSGGWFSGWFGKSDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIDEDDNEDEEFKDALEIMDNNVIIDKKKTSKLSKIKNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQ+TSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGD+NPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVKAQPPPIQPPKKAMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQ               IYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDD+GLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVLFSFLSKSIFSKKKETISQAIVK     +DS +S + SLDTV S                                                     SGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNFPVVFAPFPPPRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFGHAVGGAAGAVSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIVGFVQGVTGVVTKPIDGAKKDGIEGFFKGVGKGLVGVVTRPVSGVVDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS
Sbjct:    1 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEMKVSKLKANKKAKKMRKKLNQKTSSGGWFSGWFGKSDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIDEDDNEDEEFKDALEIMDNNVIIDKKKTSKLSKIKNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQNTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDSNPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVKAQPPPIQPPKKAMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQKFDNGDNLDEHKESKIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDNGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVLFSFLSKSIFSKKKETISQAIVKAHLKINDSLWSDKFSLDTVGS-----------------------------------------------------SGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNFPVVFAPFPPPRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFGHAVGGAAGAVSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIVGFVQGVTGVVTKPIDGAKKDGIEGFFKGVGKGLVGVVTRPVSGVVDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS 3349          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Planmine SMEST
Match: SMESG000037244.1 (SMESG000037244.1)

HSP 1 Score: 6451.69 bits (16737), Expect = 0.000e+0
Identity = 3301/3387 (97.46%), Postives = 3309/3387 (97.70%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKK----SDSGYSLQ-SLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS 10169
            MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEMK  K++     K         TSSGGWFSGWFGKSDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIDEDDNEDEEFKDALEIMDNNVIIDKKKTSKLSKIKNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQ+TSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGD+NPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVKAQPPPIQPPKKAMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDD+GLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVLFSFLSKSIFSKKKETISQAIVK     +DS +S + SLDTV S                                                     SGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNFPVVFAPFPPPRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFGHAVGGAAGAVSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIVGFVQGVTGVVTKPIDGAKKDGIEGFFKGVGKGLVGVVTRPVSGVVDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS
Sbjct:    1 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEMKAKKMRKKLNQK---------TSSGGWFSGWFGKSDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIDEDDNEDEEFKDALEIMDNNVIIDKKKTSKLSKIKNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQNTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDSNPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVKAQPPPIQPPKKAMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDNGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVLFSFLSKSIFSKKKETISQAIVKAHLKINDSLWSDKFSLDTVGS-----------------------------------------------------SGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNFPVVFAPFPPPRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFGHAVGGAAGAVSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIVGFVQGVTGVVTKPIDGAKKDGIEGFFKGVGKGLVGVVTRPVSGVVDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS 3325          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Planmine SMEST
Match: SMESG000037244.1 (SMESG000037244.1)

HSP 1 Score: 6442.83 bits (16714), Expect = 0.000e+0
Identity = 3312/3387 (97.79%), Postives = 3318/3387 (97.96%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKK----SDSGYSLQ-SLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS 10169
            MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEMKVSKLKANKKAKKMRKKLNQKTSSGGWFSGWFGKSDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIDEDDNEDEEFKDALEIMDNNVIIDKKKTSKLSKIKNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQS       GKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQ+TSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGD+NPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVKAQPPPIQPPKKAMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDD+GLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVLFSFLSKSIFSKKKETISQAIVK     +DS +S + SLDTV S                                                     SGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNFPVVFAPFPPPRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFGHAVGGAAGAVSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIVGFVQGVTGVVTKPIDGAKKDGIEGFFKGVGKGLVGVVTRPVSGVVDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS
Sbjct:    1 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEMKVSKLKANKKAKKMRKKLNQKTSSGGWFSGWFGKSDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIDEDDNEDEEFKDALEIMDNNVIIDKKKTSKLSKIKNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQS-------GKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQNTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDSNPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVKAQPPPIQPPKKAMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDNGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVLFSFLSKSIFSKKKETISQAIVKAHLKINDSLWSDKFSLDTVGS-----------------------------------------------------SGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNFPVVFAPFPPPRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFGHAVGGAAGAVSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIVGFVQGVTGVVTKPIDGAKKDGIEGFFKGVGKGLVGVVTRPVSGVVDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS 3327          
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Planmine SMEST
Match: SMESG000037244.1 (SMESG000037244.1)

HSP 1 Score: 6441.29 bits (16710), Expect = 0.000e+0
Identity = 3301/3402 (97.03%), Postives = 3309/3402 (97.27%), Query Frame = 3
Query:   24 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEXXXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIXXXXXXXXXFKDALEIMDNNVXXXXXXXXXXXXXXNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVXXXXXXXXXXXXXMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQ---------------IYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVXXXXXXXXXXXXXXETISQAIVKK----SDSGYSLQ-SLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKTVKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNXXXXXXXXXXXRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFXXXXXXXXXXXSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIXXXXXXXXXXXXKPIDGAKKDGIEXXXXXXXXXXXXXXXXXXXXXXDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS 10169
            MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEMK  K++     K         TSSGGWFSGWFGKSDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIDEDDNEDEEFKDALEIMDNNVIIDKKKTSKLSKIKNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQ+TSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGD+NPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVKAQPPPIQPPKKAMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQ               IYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDD+GLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVLFSFLSKSIFSKKKETISQAIVK     +DS +S + SLDTV S                                                     SGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNFPVVFAPFPPPRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFGHAVGGAAGAVSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIVGFVQGVTGVVTKPIDGAKKDGIEGFFKGVGKGLVGVVTRPVSGVVDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS
Sbjct:    1 MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDDFDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDPEKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNLQISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDSTREFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVSFLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDITGFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRMWSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNITLCRQQAEMKAKKMRKKLNQK---------TSSGGWFSGWFGKSDTETSSSLASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLNLELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNMQVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAEPLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRHLADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSMPGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKLRSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDRVLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQVLRAINVLPDSETASLTSTIDEDDNEDEEFKDALEIMDNNVIIDKKKTSKLSKIKNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGTTLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLFINLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSLIPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMGLITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAITASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQDPSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIEVGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLEEPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQNTSVVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQDHTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKEEVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDSNPNEWASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAKKINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMMLTDFFVKAQPPPIQPPKKAMVPVRGYEKNPRKYRKKPLASPVEPRLADFEIDVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQAVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINITPAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDENEFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQKFDNGDNLDEHKESKIYLRMPDIKVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHINVWEPLLEVYPEEHNRQYSFEIEYISCDDNGLFDEEDFEDLISIEPSAISILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVKNTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLITEEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSEREINTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKNYLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKNAQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPLALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKEWFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSPYWMLNKTGYTLTYKAGDDCQVEHDAANTDAVLFSFLSKSIFSKKKETISQAIVKAHLKINDSLWSDKFSLDTVGS-----------------------------------------------------SGKVMCKKKPVTYEVGVKINLSSSGLTKIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKSMMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLINLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDGRQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILLFTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISITSSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVKVEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQIDNQMSDCNFPVVFAPFPPPRSVALDTGLKPLIELSAVIIKSGETGAMRYKYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASLIETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVLNLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALRQMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAYGVKSLFGHAVGGAAGAVSRIVGTMGKGIAALTLDADYQRKRREQLAKRPENLGVGLAQGGKGLIVGFVQGVTGVVTKPIDGAKKDGIEGFFKGVGKGLVGVVTRPVSGVVDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGLREAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRNEILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKEIEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS 3340          
The following BLAST results are available for this feature:
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VPS13A0.000e+029.86vacuolar protein sorting 13 homolog A [Source:HGNC... [more]
VPS13A0.000e+030.16vacuolar protein sorting 13 homolog A [Source:HGNC... [more]
VPS13A0.000e+030.14vacuolar protein sorting 13 homolog A [Source:HGNC... [more]
VPS13A4.271e-15229.07vacuolar protein sorting 13 homolog A [Source:HGNC... [more]
VPS13C1.550e-15630.29vacuolar protein sorting 13 homolog C [Source:HGNC... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T08G11.12.850e-12827.04pep chromosome:WBcel235:I:8905644:8916805:-1 gene:... [more]
T08G11.18.223e-13738.51pep chromosome:WBcel235:I:8905644:8916805:-1 gene:... [more]
C25H3.113.444e-4129.16pep chromosome:WBcel235:II:5669788:5689030:-1 gene... [more]
C25H3.113.470e-4129.16pep chromosome:WBcel235:II:5669788:5689030:-1 gene... [more]
C25H3.113.532e-4129.16pep chromosome:WBcel235:II:5669788:5689030:-1 gene... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Vps131.277e-14838.92gene:FBgn0033194 transcript:FBtr0310024[more]
Vps131.277e-14838.92gene:FBgn0033194 transcript:FBtr0088910[more]
Vps13D2.127e-2926.51gene:FBgn0052113 transcript:FBtr0273390[more]
Vps13B3.264e-1130.71gene:FBgn0039727 transcript:FBtr0085505[more]
back to top
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps13a1.223e-13929.37vacuolar protein sorting 13 homolog A [Source:ZFIN... [more]
vps13c2.093e-16729.84vacuolar protein sorting 13 homolog C [Source:ZFIN... [more]
vps13c8.066e-16229.24vacuolar protein sorting 13 homolog C [Source:ZFIN... [more]
vps13c1.359e-14839.26vacuolar protein sorting 13 homolog C [Source:ZFIN... [more]
vps13d2.513e-4629.14vacuolar protein sorting 13 homolog D [Source:ZFIN... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
git21.781e-15739.72G protein-coupled receptor kinase interacting ArfG... [more]
git26.942e-15639.25G protein-coupled receptor kinase interacting ArfG... [more]
VPS13A3.045e-15540.60vacuolar protein sorting 13 homolog A [Source:NCBI... [more]
VPS13A3.850e-15540.60vacuolar protein sorting 13 homolog A [Source:NCBI... [more]
git28.513e-15439.42G protein-coupled receptor kinase interacting ArfG... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vps13a5.738e-15328.24vacuolar protein sorting 13A [Source:MGI Symbol;Ac... [more]
Vps13a5.697e-2128.19vacuolar protein sorting 13A [Source:MGI Symbol;Ac... [more]
Vps13c8.443e-15928.85vacuolar protein sorting 13C [Source:MGI Symbol;Ac... [more]
Vps13a2.896e-15439.35vacuolar protein sorting 13A [Source:MGI Symbol;Ac... [more]
Vps13c1.219e-14042.23vacuolar protein sorting 13C [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96RL7|VP13A_HUMAN0.000e+029.86Vacuolar protein sorting-associated protein 13A OS... [more]
sp|Q5H8C4|VP13A_MOUSE4.013e-15228.24Vacuolar protein sorting-associated protein 13A OS... [more]
sp|Q8BX70|VP13C_MOUSE1.254e-18028.85Vacuolar protein sorting-associated protein 13C OS... [more]
sp|Q709C8|VP13C_HUMAN6.987e-17629.38Vacuolar protein sorting-associated protein 13C OS... [more]
sp|A1Z713|VPS13_DROME1.280e-14738.92Vacuolar protein sorting-associated protein 13 OS=... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4EAP50.000e+038.64VPS13C protein, putative OS=Schistosoma mansoni OX... [more]
G4VDJ90.000e+038.62VPS13C protein, putative OS=Schistosoma mansoni OX... [more]
W6V2890.000e+034.57Vacuolar protein sorting-associated protein OS=Ech... [more]
A0A068Y6L90.000e+034.03Vacuolar protein sorting associated protein 13A OS... [more]
A0A068WCF90.000e+034.19Vacuolar protein sorting associated protein 13A OS... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps13a3.871e-16329.69vacuolar protein sorting 13 homolog A [Source:ZFIN... [more]
vps13a4.566e-16333.71vacuolar protein sorting 13 homolog A [Source:ZFIN... [more]
vps13c5.045e-14740.49vacuolar protein sorting 13 homolog C [Source:ZFIN... [more]
vps13c6.220e-14740.49vacuolar protein sorting 13 homolog C [Source:ZFIN... [more]
vps13c1.279e-14242.21vacuolar protein sorting 13 homolog C [Source:ZFIN... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003418.11.255e-2958.24pep scaffold:Pmarinus_7.0:GL489749:646:4444:-1 gen... [more]
ENSPMAT00000003332.14.850e-2858.45pep scaffold:Pmarinus_7.0:GL487813:5059:8070:-1 ge... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VPS138.034e-4622.73Protein involved in prospore membrane morphogenesi... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO345051.015e-15137.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319072.735e-7231.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319062.991e-4834.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420774.596e-4650.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414505.437e-4228.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps13a2.558e-15833.93vacuolar protein sorting 13 homolog A [Source:NCBI... [more]
ENSORLT00000000640.31.393e-12238.85pep primary_assembly:ASM223467v1:3:5428377:5447491... [more]
ENSORLT00000031398.16.852e-11033.43pep primary_assembly:ASM223467v1:3:5374961:5398684... [more]
vps13d8.895e-3929.26vacuolar protein sorting 13 homolog D [Source:NCBI... [more]
vps13d9.595e-3929.26vacuolar protein sorting 13 homolog D [Source:NCBI... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 13A/C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037244.10.000e+099.88SMESG000037244.1[more]
SMESG000037244.10.000e+097.56SMESG000037244.1[more]
SMESG000037244.10.000e+097.46SMESG000037244.1[more]
SMESG000037244.10.000e+097.79SMESG000037244.1[more]
SMESG000037244.10.000e+097.03SMESG000037244.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035556 ID=SMED30035556|Name=Vacuolar protein sorting-associated protein 13A/C|organism=Schmidtea mediterranea sexual|type=transcript|length=11003bp
TAATTAGATGAAATAACTATCAAATGGTTTTTGAATCGTTAGTCGTAGAG
TTAATAAACAAATATCTAGGAGATTATGTTGTAAAACTTGATAAATCTCA
ATTGAAATTGGGTCTTTTAGGAGGTAATGCAACGCTGGAAAACCTTGATA
TAAAAGAAAATGCTTTTGACGATTTTGATCTTCCTGTTAAGGTTCGACAA
GGACATATAAGTAAACTCACGTTAAAGATTCCCTGGAAGCATCTGTATTC
AGAGCCGGTTATTGCAGAACTGGACGGATTATATGTTCTAATAATACCAA
ATTCTGAAATGAAATATGATCCTGAAAAAGAACGATCTTATCTTTTTGAA
ACCAAACAGAAGGAATTAAATCGCATTGAAGAAAATAAACTGAAAAGAAA
TGACCCAAAGAAAGAAACAGAAACCAAAGACTCGTTTGGTGAAAAATTAG
CGGCACAAATAGTTAAAAATCTACAAATCAGCATTAGTAATATACACATC
AGATATGAGGACACGTCCACCTGTCCAAACAGACATTTTGCCGTTGGAAT
CACTTTGGCAAATCTATCGTTCCAGACATGTGACTCAAGTGGAACTAGTA
TAATTATCAAAGAAGATTCAACTAGAGAGTTTTTCAAATCTGTCAAAATG
GATTCATTAGCTGTTTATTGGAACAGTAATCCGAAACCTTTTTCCAGTGA
AAACAGAGCAACTTTAAAAGCAATTATGAAAAATAATATAAGTTCGTCGG
AACGCAAATTAACAGATGTCAGTTTTTTAATTCAACCTATCTCCTGTTCC
GCGATGATGCACGTTCACATGAAACCAGAAACGACAAATTTCACAGTGCC
CAGAATGTCATTAGATTTGAAATTAGAACAAATCGGATTCGCGTTTAATC
GCAATCAGTATTGCGATATTACGGGATTCCTTGATTCGATGGATCGGGCA
TGGACGAAAAATCGGTTTAGAAAATATCGACCAAACGTTCCCATGAGATC
AAACATCAGCATTTGGTGGCATTTTCCATATAACGTGATTCTCGAAGAGC
AAGTACGAAGAAGAAGACGTATGTGGTCATGGAAATACATTCAAGCCCAT
CGCAATCGCTGTCGTCTTTACACTGATATCTGGGAACAGAAACTATTGGA
TAAGAAATTGTCTCAATCTGAACAAGATACTATTAAAGTTTGTGAAGAGG
AATTGGATTTACTTAACATAACATTATGTCGTCAGCAAGCAGAGATGAAG
GTCTCCAAGTTAAAGGCAAACAAAAAGGCGAAAAAGATGAGGAAAAAGTT
AAATCAGAAAACTTCAAGTGGAGGTTGGTTTTCCGGATGGTTTGGCAAAT
CCGATACAGAGACATCATCATCCCTGGCATCAGATGGCAGTGATGAATTG
CAAAAGAAAGTGCGTAGTGAATTCACACAAGAAGAAAAAGCTAAACTCTA
TCAAGCCATTGGTTATTCGGAACTGACTACAGATCCTGATATTCCGATAG
AATACGTTTCCTTGAAATTGAATTTAGAATTGCAAAAGTTGAAGTTCATA
ATCTCGGACAATTCCTTGAAAGAATATAAATTAATGAAATTGGTCATACA
TTCCATGTCTGCCCATGTACAACAACGCAGCTCGGCTGATGCAATCAGTG
TGAATCTAATTATGAATAATATGCAAGTCACCGGCACCAAGGGTCCCGAT
GGCTCCGTGCCCACCCTCGTCAGCACTCAAGCTCAATCAAAGCTGATGAA
TTTACTAATTGTTGATTTTGAAACGAATCCTCTCGATAAATCTGCAAATC
AAAAGATTAATATTCGAGCTGAACCACTAGAAATTATTTATGATTCTGAT
ACAGTTAATCACATTGTCAAATTCTTGACTCCACCAGAAGAACTGCAACT
ATACGAGATATCTACCCAAGTATTAGCATCTATTGAGGAGGTGAAGGAAA
TGACTGCCACTGGGCTACGACATTTGGCTGATCGGAGAATTTATACTGAT
ATTAAAGTCGACATAAAACCAAGTTATTTCATTTTACCCGAGCGTGGGAA
ATATACAAAAGATTGTAAAATGCTTCTTGTTGATTTGGGCAGTATTTTGA
TTGTTTCTGAAAGAACAAGCATGCCAGGTTCCGGTGATACTGATCTTATT
TTTGGAAAAGATGGCAAACTCAATTATGACGTGATGAAAGAAACTGCCTA
TGATAAATTTCACATTATTTTATCAACCATACAAGCTCTCATGATCGAAC
AAGGGGACGATTGGCGCAAGTTGCGATCCCAGGAGTCATCCAAAAATCAT
ATTTTAAGACCTTTTGGTTTTGAGTTTAATTTAAAAAAATGTGTCATTAC
CAACGATGCAAATCTTCCAAAGATATTTGTCAAAGGTTGTCTTCCGCATT
TGGGAGTTATTATATCAGATAGAGTTTTACAATCGGTTCTTGAGCTAATT
CTGCATATCCCTTTTCCTCAAACCGCTCCTCCGAAACCAGTTCCAACTAC
AGAAAGTATTTTAAGGGAATACAGTGGGAAACAGCTTGGCATTGCACCTA
AATTAAATTTAACAAGTAACCAAGTGTTGAGGGCTATTAACGTACTTCCT
GATTCGGAAACCGCCAGTTTAACTAGCACCATTGACGAGGACGATAATGA
AGATGAAGAGTTCAAGGATGCTCTGGAAATCATGGATAACAATGTAATCA
TAGACAAAAAGAAAACCAGCAAACTATCCAAAATAAAAAATATGATTGAT
TTGGACGCACTATTTGTGATAAATACGTTTGAGCTGCAAGTTCTTCAAGA
TATTAAAAATACACTTGTGGAAAAGAATGGTGCAAAAGAAATCGTGAAAT
TAATTGTCCATGAAATTGGAACAACATTGACATTGAAGCGATTTGACATG
GCGGTCCAAGCCTACATCGGGTCACTAATTTTGGCTGTTCCACAATTTGT
TGATCCAAGTACAAAATCACCGGTTTGTTTGGCACAAACGAAAAAACATA
CCAAAGGACAAAATCTGTTGTTTATTAATTTGTTAATTGTTGAGAAAACC
TCCCCCGATTTTGTAACAGTTCATGCCAATACCCGACACAAATTAGAATG
CCAGTTCAAATCCATTGAGGTTTGTCTTCACCAAGAAGCTCTTTTAGTTG
TGCTAAATTTCATAAACTCATTGATACCAGTTTTGAACATCGTTGAAGAA
GAAAAAACTGAAACCTGGTCTTCGCCAAATAAAGAGGAGACACGCAAACA
GACAACTCTTGAAAAAGAAAATGAGGCCATTGAAGACCTAAAAAGGCAGA
AGGCTGATACATCTATAATGGGTTTGATTACTGATCGAATAGATTTAGCG
ACGGAAAAACGAACCGTTCGATTGAAAGCCGAGGCCGTTTCAGAGCAGTC
AGATTACAACGGCTACGATTCAGGGAAAAAGATTTTCATCCCAGAGATTA
CTATGACCCAATGGGCAATAACTGCCAGCCTTCAAAAGTTGCGAGTCATT
GTTGCTAATGAAAAAGACAATAATATTCTTGACATTTCAATTCATGGTAT
GAGAGCAGATGTGAAAACGAGTTATTACACAACTGAAGTCAGCATAACTA
TCACAGATATGAGAATTCAAGATCCAAGTCCTTTGGCTGTCTATAAAAAA
ATAATCTGGATTGAGCGCGATGAAAGCATATTTTCCATGCAAGTAGCCTT
ATTTAATCAAGGCACATCAACTCCGGGCTATGAATTAGATTTGTCAAGGG
TCGATCATATGGTCAACATAGAAGTCGGGAAAATTAAAATCATTTTTCTA
TACAATTTCGTTTTGAGAATTCAAACTTTTCTTAACAGTTTCCAAGAGTC
CTTACAAACGGTTGCTAACAAAGCTCAAGAGTATTCTGAAGCTGCAGCCA
ATAAAATTACCAATGTTCTAGAGGAACCTCCTTCTAGTCGAACGAAACTT
GACATTAATGTTAAGGCACCTGTGATTTATATTCCAGAAAATTCCAAGTC
TGTAAATGCTTTGATGGTCGATCTAGGAGCCTTAACTTTCAAAAATGATT
TTGCCATTGATCAGAGCACATCTGTCGTACTTGAAGAATCCAAAATTACA
CTTAGTAACCTACGAGTATCTCGATCCATTTTATTGGAAAATACAGTAAA
AAACGAAAAGGGTATTTTGCATCCAATTAATATATTCATGGATATGACTC
GCAATCTGTCATGGAATCAAGATCATACAATACCGCAGATCAGCATTGCT
GCCAGAATGACATCTATCAGTGTTGGAATGTCGCAAGGAGATTATAATAT
GTTTCAACTAGTTCTTCAATCCAACTTCAATGAGGCCATCAACCAAGTTC
CTAGTGTTCCTGAATCAAAAGAAGAAGTCAAATCAAGGAAAATTTTACCA
AAAGATGATAAATCTGGATCGGCTCGCACTGCTAGTGATGAATCGATAAC
GGTTCAGTTTGGATTCAAAATGGAATTCTTAGATGTTGAACTGTTTAAAG
GAGATGCGAATCCAAATGAGTGGGCCAGTGAAATGCCTCCCGATAAATGT
CTGACGAAGATGAAATGTGAAAACTTGTCAGTTGAAGGTTCAATGCACCT
CAATTCAGCAATGGAAGTTAGTGTCCGGTTAAGTAATATTAACGTTTTGG
ATACGCAACTCGATTCGGCTAAAAAAATTAATGAATTAATTAGAAATATA
AAAAATGACTCCAGTGATTTTATTTCAATCAAATTTATTCAAGATAAGAA
TTCTAATAGTAAACTGATTGTCGACATTGCGGGAATATATATGTGCATCT
GCGTCGATTATTTGATGATGTTGACAGATTTCTTTGTGAAAGCTCAACCT
CCGCCAATACAGCCCCCGAAGAAAGCCATGGTTCCTGTTAGAGGATATGA
GAAAAATCCTCGTAAATATAGAAAAAAACCACTTGCGAGTCCAGTTGAAC
CTCGGCTGGCTGATTTTGAAATAGATGTCAAAGTTGCACGACCTGAAATC
TTACTCGTAGAAGATATGCTCAATCCTGATTCAAATGCAATAATGGTTCA
GACAAATTTTGTTCTTAAATATTCAATAATGAAAGAAAGCGACATTATTA
ATGTTGATATCAGTGATTTCCAGGCCGTTTTCTGTCCGTTTCGATCAGAA
AGTCGTAAGAAAAATACTATGGATATAATTTCTCCTACAAGCATTTCTCT
ATATTGCAACAAACCGATAAATAACGGAATGCAGGGCAGCCTCACCATGG
AACACCTAATCATTAATATTACTCCGGCTGTTATCCAAAGCATCTCGAAG
ATCATGAACACCCTTACTGCTCAATCTACCGATGAGACATCTACTAGAGA
TGGATCATTTATAAATAATCAAGATCAATTGATTGTCGACAATTTCTGGG
AGAAACGAGAATTCGATGAAAATGAATTTTTATTTATTTCTAAAGGATTG
ATGGAGAAAGAGAAAATTAATACCCGTAATGATGGAGTGGAAAGTGGATT
TGATGTGGCACAAATTTTGTTGGATGTTGAGCAACGAAGAGCCGATCAAA
TTTATCTTCGAATGCCTGATATCAAAGTAATTTTGGAATCTGAAGTTGCA
AAGAAATGTGTACCGATGCTGATTTTTGAATGTTCAATGGATGGAGATTT
AAAAAATCCTTTAACTCAAATTTGTCTCGGTGTTACTGTTTCGGTTTCAG
TTAGCTATTTTAATGACCACATTAACGTTTGGGAACCCTTATTAGAGGTG
TATCCAGAAGAGCATAATCGGCAATATTCATTTGAAATCGAATACATTTC
TTGTGATGATAGTGGATTATTTGATGAAGAAGACTTCGAAGATCTTATAA
GTATTGAACCGTCTGCTATCTCAATTTTACTTTTATCCCGTGACGCCCTT
GAATTAACAGTCAGTAAAAGCGCATTAGATGTATTAAGCAATTTAGGAAA
GGCTTTTGAAGATGCTTATTCACTTCATTTGGAACAGCATAAATCTATTT
TCGGAGCCCCGTATGTTGTAAAAAATACTTGTGGAAAAGATGTTGTATTT
TATATTAACAAAGAATTTGATTTAAAGCCTTGCAACTCTGATGAAGAATT
TAAAGTTTACTTAAAAGCTGATGGCGAAGTTCAATTATACGATGCGGTCG
ATGAAAAGCAATCCTTAATTACCGAAGAAAAACAAGCTAAAATTGTTAAA
TTTGGTTTTGCCGATTCCATTAGTCGAGAATATTTGTCAATTTATAGAAC
TGAAGTGCGAGCTTTGTTATTCAGCCCCAAGGATAATGAAGGTCCCAGTC
GCGGAAATGTCAGTGAAAGAGAGATTAATACGTTAATTGTATCGACTACC
GCATATCTGGGTATGAAGCAACTTGAACTTCGATCAGTTTTACAAGTCTT
CAATAATACTGATGATGTTATAACTTTATATTATCTTCGGAAGAAGAGTG
ACAAAAGTGAAACTGCTAAAAATTATCTCCTACTCGAAGAAGTATTAGGA
GGGAAATGTTACAATGTTCCTATACCAACACTTTTGACCAGTAATGGTAA
AATTTACATTAGTGTGAAACAATTGAATACTGAAATATCTAACTCTGGAG
CGTTGTGGAATATAGGAAAAAATGCCCAGCCGTCCGACACTCAAATTTTG
TTATGTAAAAGCAATACGGGTGTTATGTATTACTATTCAGTGGCTTTGAG
CATTGAAGAAGTTCAAATTGTCAATTCCTCTGAAACCTTACGCACTTATA
AACTTGATATTAACGTTCCATTGGCATTACACAATCAGCTGCCGATTAAA
ATCAGTTATCAATCACAGATTTTCAGTCATGACATTAAACCCGGATGCCT
TGAGCTTGTTAGAACGGCTTGTCTAAAAGTACAGTCAAATATCAAAGTCA
CATACCACTATCAAAAGAAAGAATGGTTTGGTTCTTTGGATCTAGGGCCC
AAAATGGAAGAACTCAGTGTTATAAATTTTAAAGCTAAAGAAGGCTACTC
TGAGTCATTTATGGATCTCGGTGTACATTTGGCCATCAAAAATGGTCAGG
CTAATGTGACAATCTACTCACCTTATTGGATGTTAAATAAAACCGGTTAT
ACATTGACGTATAAGGCAGGAGATGATTGCCAGGTTGAACACGATGCCGC
TAATACCGATGCGGTTCTCTTTTCGTTTCTTTCCAAGTCGATTTTCTCAA
AAAAGAAAGAAACCATCTCACAAGCCATCGTAAAGAAATCAGATTCAGGG
TACAGTTTACAGTCTCTTGATACCGTTGAGAGTCCTGCTGAGGATTTGCA
TGATCATTTAGATCAAACGTCAACTGCCTCAATAAATAATGTTAATAATA
AAAATCAGAAATTTGCAAAAACTGTGAAGGCTCATCTTAAAATTAATGAT
TCGTTATGGTCAGACAAATTCTCTCTTGATACTGTTGGTAGTTCGGGCAA
AGTCATGTGTAAAAAGAAACCAGTAACCTATGAAGTTGGGGTAAAGATTA
ATTTATCTAGCTCGGGTTTAACGAAAATTGTGACATTTTTACCTTATTAT
ATGATTTTAAATCAGTCTTCGATTGTCCTTTATTGCAATGAATTGGTGGA
AAATGCGGGCTGGATAAAGGTGCCTCCAGGAGAAGCAGTTCCATTTTGGC
CACGATCTGAAGTCGGGAAGTCAATGATGATGCGTTGCAAAGTTGAAGAC
CGAGAAGTCTTAGTAACTCAGCCGTTTCCATTTTATGAATCACATTCAAT
TTTAATGAAATTGGAGAAAAAGTTTGTCGGAATATTTGTTGAAGTTCAAA
TTACTGAAGAAGCAAATTTAATAAATCTTCAACTTTATCAAGAAGGAATG
GCATTAGTTAAGCTGATCAATCATTTAGGGGATGACGTTGAAATACACTT
CAAACAATATAATACACCTCAGGAATTAATTTTGCCAGCATATCAAACGG
TAATGTATGCTTGGCAAGATGGACGCCAGAAGCGAGAATTTATTTGGCGT
GTTGAAGGTGACAAGAAGCAACATTCCAATAATCTGACTTCCGACGGGAT
AGAAGATTTTTACATTAATGAAATGAAAGCTTATTGGGTTTCATTTGTCT
GGGATTCCAATCGAATATTACTGTTTACTAACGATATTCACGTGGCTAAG
CATGCAAGATTGAGTGCTGATTTGGAGAGCATCGACCAGGAGATTACTAT
TTCTCTACACTCAATAGGTTTGAGCCTTGTCGACAATTCGTTGCAGCAGG
AACTGGCATATATTTCTATCACCAGCTCGGGAGTTAAATGGAATCAAATT
CGCCGTAAAAACCGACACAAACCGCTTAAATTGGCTCAAAGTGAAGCTTT
GGAAGCAGCTTTTGATGAATTTGTGAACAGGCTTAAAACGAGTGAAGCAG
AAGTTGAAGAACATATTGTCAAAGTAGAAGGTTTGGAAGTCGATTTGAGT
AAGAAACTCATGATAAAACCGGAGAAGTGTGAATTGAGTCGAGTTTTCGA
ACCGGGTGTATTTTTACAATATCGCACGTCTCCACATCAAGTTCATGTTC
ATTTAAGAATTTACAAAATTCAGATTGATAATCAAATGAGTGATTGCAAC
TTCCCTGTGGTGTTTGCTCCTTTCCCCCCACCGAGATCTGTTGCTCTTGA
TACTGGCTTGAAGCCTCTTATTGAGTTGTCTGCTGTGATAATTAAATCGG
GAGAAACTGGTGCTATGAGATACAAATACTTCCGAGTTCTTATTCAAGAG
ATGCAATTAATGTTGGATCAAGGTTTCGTAAATTCAATTCTCGACTTTGT
TTCTGGAAGTGTCCCGACATATGACGAGGAAGCAATGTTTGTCAAAGATT
GTCAGATGATCCGCGCTAGTCTCATAGAGACATCAACAATCAAAACTATT
CTTTCCGGTGGTAAAAAATGTGTTTTCGACAACTTTCATATTTCTCCAAT
TAAGATCCATTTGAGCTTTTCTTTATCGCGTGTTAATCGGACAGGAAAAA
CTGCTTTACACAGTGAAGTTCTCAATTTGTTTCTGCAATCAGTTGGAATA
GCAATCACTGATATGCAAGATGTTATATTTAAATTGGGATATTTTGAAAA
GCAAAATAGTATTATGCCTATGAATCAAATGGTTTCATCTATAACTAGTC
ATTATGTTAGTCAAGCGCTTCGTCAAATGTATGTCTTAGTTTTGGGTTTG
GATGTACTTGGCAACCCATTCGGAGTCATTAGAGGCATGGCTCAGGGTGT
TGAAGATTTATTCTATGAGCCTGTCAGGGGAGCAGTTTTGGGCCCAGAGG
AATTTGTTGAGGGAGTAGCATACGGTGTTAAAAGTTTGTTTGGGCATGCA
GTTGGTGGAGCAGCTGGTGCTGTGTCGCGGATTGTTGGAACAATGGGTAA
AGGTATAGCTGCATTGACATTGGATGCCGACTACCAACGTAAACGTCGAG
AACAACTTGCTAAACGACCGGAAAATCTTGGCGTTGGATTAGCACAAGGT
GGCAAAGGTCTCATTGTTGGATTCGTTCAAGGCGTAACTGGAGTTGTGAC
TAAACCGATTGACGGGGCGAAAAAAGATGGAATCGAAGGATTCTTTAAAG
GTGTAGGTAAAGGCTTGGTTGGGGTAGTTACTCGCCCGGTTTCGGGAGTA
GTAGATTTTGCCAGTAGTTCTTTTGAAGGAATCAGAAGGGTTGCCGACAC
AAATATTGAGGTATTCCGAATCAGACCTCCTCGATTTATTGCAAAAGATG
GTATTATTCGTTCGTATGGACTCCGAGAAGCCGAAGGAAACAATATTTGG
ATTAAAATAACAGAGAAATGTGATCCTATACCAAACGAATTGTATGTTTT
CCATGTTTACTGCAAATCCAAGAAAAATGTTATTTTCTTAACTAACCAGC
GGATTTTCCACTTAGATCGCAATGAAATCCTCGGTATTTGGTCTATTCAG
TGGCAAATAGCCTATGAGAAGTTGGATGGACCGCCCACTATCAATGAGTC
TAAACATACTATTGTTTTTACTTTGAAAGAAAAACAGAGAAAATTATTTT
CTAAAGACAATATTACCAAAGAAATCGAAGCTGATTTAATAGTTTTGAAG
GCCGTTGTGAGCAAAATAATTAAAATTCAAAAGTATTTTGAAGACAAAAA
GCAATATTCGAACATATCTTGATCTTGCAAGTATTATTTGTCATTTATAC
TGTTGATTGTCGAATTTTGCCTTATGATGTGAACTGTTATTATATCTGTC
ATTATAAAAATGACTATGTTTATCTTTTTATTTGTGATTTTCGGATAGAT
GGCATCCATTTCAATAACAAATTTTTATATAGAATATTCTGTGAATGGAT
TGAAATAAAATAAATAAATAATGATAGGGCTTTGTTAGCTTGGGATTTTT
ACTCATTTTTGTCGCGCTGTGTTGGATAGGATTTTTATCGCATTGGCTTA
CAAATTAATATATTTTATTTCTGAAAATGTGATTTTTTAAAATTAAAAAA
GATTTTCTGAAATATGAATATTACTAAATCTGTGCGACAAACGTCAAAGG
GTTCATTTGGGTCACTAGAGGCGATTTATCAATAAATTTCTCCTTTTAAA
CTTATTGATTTAAAAAACGAAATATTAAAAAAAAAATTTGGTAAAACGTT
TGATTTGGTTCAAAATTATTCGAAAGTAATGTTTTTTCTCCTTATGATAA
TTAATTAATAGATTTGTTAATATTCCTAACTAATTTTGACAAAAGGTAGA
ACAGAACACTTTTTAATGAAATCTCCAACACTGTTCACTGCTGGTTGAGT
GAGAGTTATTTCTATTTGTCCAGGTGACAATTCATAAATAAATTTCTGTT
TTGGAATTTATTGGTTCCCATATATAAAGACATTTTTAAATTTTCGTTGA
ATTCTTTAATTTGATTAACTATTGAATGAGAATAATTTTTTTATGTAACA
ACTTATCAATAAATTTGTGTAGATCTTTTATTTTTTAAATATTATTACTG
TAG
back to top

protein sequence of SMED30035556-orf-1

>SMED30035556-orf-1 ID=SMED30035556-orf-1|Name=SMED30035556-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=3383bp
MVFESLVVELINKYLGDYVVKLDKSQLKLGLLGGNATLENLDIKENAFDD
FDLPVKVRQGHISKLTLKIPWKHLYSEPVIAELDGLYVLIIPNSEMKYDP
EKERSYLFETKQKELNRIEENKLKRNDPKKETETKDSFGEKLAAQIVKNL
QISISNIHIRYEDTSTCPNRHFAVGITLANLSFQTCDSSGTSIIIKEDST
REFFKSVKMDSLAVYWNSNPKPFSSENRATLKAIMKNNISSSERKLTDVS
FLIQPISCSAMMHVHMKPETTNFTVPRMSLDLKLEQIGFAFNRNQYCDIT
GFLDSMDRAWTKNRFRKYRPNVPMRSNISIWWHFPYNVILEEQVRRRRRM
WSWKYIQAHRNRCRLYTDIWEQKLLDKKLSQSEQDTIKVCEEELDLLNIT
LCRQQAEMKVSKLKANKKAKKMRKKLNQKTSSGGWFSGWFGKSDTETSSS
LASDGSDELQKKVRSEFTQEEKAKLYQAIGYSELTTDPDIPIEYVSLKLN
LELQKLKFIISDNSLKEYKLMKLVIHSMSAHVQQRSSADAISVNLIMNNM
QVTGTKGPDGSVPTLVSTQAQSKLMNLLIVDFETNPLDKSANQKINIRAE
PLEIIYDSDTVNHIVKFLTPPEELQLYEISTQVLASIEEVKEMTATGLRH
LADRRIYTDIKVDIKPSYFILPERGKYTKDCKMLLVDLGSILIVSERTSM
PGSGDTDLIFGKDGKLNYDVMKETAYDKFHIILSTIQALMIEQGDDWRKL
RSQESSKNHILRPFGFEFNLKKCVITNDANLPKIFVKGCLPHLGVIISDR
VLQSVLELILHIPFPQTAPPKPVPTTESILREYSGKQLGIAPKLNLTSNQ
VLRAINVLPDSETASLTSTIDEDDNEDEEFKDALEIMDNNVIIDKKKTSK
LSKIKNMIDLDALFVINTFELQVLQDIKNTLVEKNGAKEIVKLIVHEIGT
TLTLKRFDMAVQAYIGSLILAVPQFVDPSTKSPVCLAQTKKHTKGQNLLF
INLLIVEKTSPDFVTVHANTRHKLECQFKSIEVCLHQEALLVVLNFINSL
IPVLNIVEEEKTETWSSPNKEETRKQTTLEKENEAIEDLKRQKADTSIMG
LITDRIDLATEKRTVRLKAEAVSEQSDYNGYDSGKKIFIPEITMTQWAIT
ASLQKLRVIVANEKDNNILDISIHGMRADVKTSYYTTEVSITITDMRIQD
PSPLAVYKKIIWIERDESIFSMQVALFNQGTSTPGYELDLSRVDHMVNIE
VGKIKIIFLYNFVLRIQTFLNSFQESLQTVANKAQEYSEAAANKITNVLE
EPPSSRTKLDINVKAPVIYIPENSKSVNALMVDLGALTFKNDFAIDQSTS
VVLEESKITLSNLRVSRSILLENTVKNEKGILHPINIFMDMTRNLSWNQD
HTIPQISIAARMTSISVGMSQGDYNMFQLVLQSNFNEAINQVPSVPESKE
EVKSRKILPKDDKSGSARTASDESITVQFGFKMEFLDVELFKGDANPNEW
ASEMPPDKCLTKMKCENLSVEGSMHLNSAMEVSVRLSNINVLDTQLDSAK
KINELIRNIKNDSSDFISIKFIQDKNSNSKLIVDIAGIYMCICVDYLMML
TDFFVKAQPPPIQPPKKAMVPVRGYEKNPRKYRKKPLASPVEPRLADFEI
DVKVARPEILLVEDMLNPDSNAIMVQTNFVLKYSIMKESDIINVDISDFQ
AVFCPFRSESRKKNTMDIISPTSISLYCNKPINNGMQGSLTMEHLIINIT
PAVIQSISKIMNTLTAQSTDETSTRDGSFINNQDQLIVDNFWEKREFDEN
EFLFISKGLMEKEKINTRNDGVESGFDVAQILLDVEQRRADQIYLRMPDI
KVILESEVAKKCVPMLIFECSMDGDLKNPLTQICLGVTVSVSVSYFNDHI
NVWEPLLEVYPEEHNRQYSFEIEYISCDDSGLFDEEDFEDLISIEPSAIS
ILLLSRDALELTVSKSALDVLSNLGKAFEDAYSLHLEQHKSIFGAPYVVK
NTCGKDVVFYINKEFDLKPCNSDEEFKVYLKADGEVQLYDAVDEKQSLIT
EEKQAKIVKFGFADSISREYLSIYRTEVRALLFSPKDNEGPSRGNVSERE
INTLIVSTTAYLGMKQLELRSVLQVFNNTDDVITLYYLRKKSDKSETAKN
YLLLEEVLGGKCYNVPIPTLLTSNGKIYISVKQLNTEISNSGALWNIGKN
AQPSDTQILLCKSNTGVMYYYSVALSIEEVQIVNSSETLRTYKLDINVPL
ALHNQLPIKISYQSQIFSHDIKPGCLELVRTACLKVQSNIKVTYHYQKKE
WFGSLDLGPKMEELSVINFKAKEGYSESFMDLGVHLAIKNGQANVTIYSP
YWMLNKTGYTLTYKAGDDCQVEHDAANTDAVLFSFLSKSIFSKKKETISQ
AIVKKSDSGYSLQSLDTVESPAEDLHDHLDQTSTASINNVNNKNQKFAKT
VKAHLKINDSLWSDKFSLDTVGSSGKVMCKKKPVTYEVGVKINLSSSGLT
KIVTFLPYYMILNQSSIVLYCNELVENAGWIKVPPGEAVPFWPRSEVGKS
MMMRCKVEDREVLVTQPFPFYESHSILMKLEKKFVGIFVEVQITEEANLI
NLQLYQEGMALVKLINHLGDDVEIHFKQYNTPQELILPAYQTVMYAWQDG
RQKREFIWRVEGDKKQHSNNLTSDGIEDFYINEMKAYWVSFVWDSNRILL
FTNDIHVAKHARLSADLESIDQEITISLHSIGLSLVDNSLQQELAYISIT
SSGVKWNQIRRKNRHKPLKLAQSEALEAAFDEFVNRLKTSEAEVEEHIVK
VEGLEVDLSKKLMIKPEKCELSRVFEPGVFLQYRTSPHQVHVHLRIYKIQ
IDNQMSDCNFPVVFAPFPPPRSVALDTGLKPLIELSAVIIKSGETGAMRY
KYFRVLIQEMQLMLDQGFVNSILDFVSGSVPTYDEEAMFVKDCQMIRASL
IETSTIKTILSGGKKCVFDNFHISPIKIHLSFSLSRVNRTGKTALHSEVL
NLFLQSVGIAITDMQDVIFKLGYFEKQNSIMPMNQMVSSITSHYVSQALR
QMYVLVLGLDVLGNPFGVIRGMAQGVEDLFYEPVRGAVLGPEEFVEGVAY
GVKSLFGHAVGGAAGAVSRIVGTMGKGIAALTLDADYQRKRREQLAKRPE
NLGVGLAQGGKGLIVGFVQGVTGVVTKPIDGAKKDGIEGFFKGVGKGLVG
VVTRPVSGVVDFASSSFEGIRRVADTNIEVFRIRPPRFIAKDGIIRSYGL
REAEGNNIWIKITEKCDPIPNELYVFHVYCKSKKNVIFLTNQRIFHLDRN
EILGIWSIQWQIAYEKLDGPPTINESKHTIVFTLKEKQRKLFSKDNITKE
IEADLIVLKAVVSKIIKIQKYFEDKKQYSNIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005622intracellular
GO:0005829cytosol
GO:0031045dense core granule
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000484secretory system
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR026847VPS13
IPR009543SHR-BD
IPR031642VPS13_mid_rpt
IPR015412Autophagy-rel_C
IPR026854VPS13_N
IPR031646VPS13_N2
IPR031645VPS13_C
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006895Golgi to endosome transport
GO:0006914autophagy
GO:0007399nervous system development
GO:0007626locomotory behavior
GO:0008104protein localization
GO:0015031protein transport
GO:0035176social behavior
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 403..423
NoneNo IPR availableCOILSCoilCoilcoord: 1069..1099
NoneNo IPR availableCOILSCoilCoilcoord: 2787..2807
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1443..1471
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1448..1468
NoneNo IPR availablePANTHERPTHR16166:SF69VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 13Ccoord: 121..832
NoneNo IPR availablePANTHERPTHR16166:SF69VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 13Ccoord: 1146..2420
coord: 1..112
NoneNo IPR availablePANTHERPTHR16166:SF69VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 13Ccoord: 863..1081
coord: 2445..3351
IPR026854Vacuolar protein sorting-associated protein 13, N-terminal domainPFAMPF12624Chorein_Ncoord: 3..116
e-value: 6.1E-35
score: 119.8
IPR031646Vacuolar protein sorting-associated protein 13, second N-terminal domainPFAMPF16908VPS13coord: 138..371
e-value: 4.5E-64
score: 216.5
IPR009543Vacuolar protein sorting-associated protein 13, SHR-binding domainPFAMPF06650SHR-BDcoord: 2344..2649
e-value: 1.7E-23
score: 83.4
IPR031645Vacuolar protein sorting-associated protein 13, C-terminalPFAMPF16909VPS13_Ccoord: 2968..3139
e-value: 3.0E-57
score: 193.3
IPR015412Autophagy-related, C-terminalPFAMPF09333ATG_Ccoord: 3144..3225
e-value: 4.8E-8
score: 33.2
IPR031642VPS13, repeated coiled regionPFAMPF16910VPS13_mid_rptcoord: 582..813
e-value: 3.0E-61
score: 206.9
coord: 1242..1354
e-value: 4.5E-8
score: 32.8
IPR026847Vacuolar protein sorting-associated protein 13PANTHERPTHR16166VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN VPS13coord: 1..112
coord: 1146..2420
coord: 2445..3351
IPR026847Vacuolar protein sorting-associated protein 13PANTHERPTHR16166VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN VPS13coord: 863..1081
IPR026847Vacuolar protein sorting-associated protein 13PANTHERPTHR16166VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN VPS13coord: 121..832