Transmembrane 9 superfamily member

Overview
NameTransmembrane 9 superfamily member
Smed IDSMED30035549
Length (bp)2232
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane 9 superfamily member (SMED30035549) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane 9 superfamily member (SMED30035549) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane 9 superfamily member (SMED30035549) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane 9 superfamily member (SMED30035549) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035549

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035549SMESG000068156.1 SMESG000064685.1 SMESG000043474.1 SMESG000076470.1 SMESG000062429.1 SMESG000053533.1 SMESG000015751.1 Contig259GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035549SMESG000060705.1 Contig259GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30035549SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035549SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035549SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035549SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035549SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035549SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035549SMESG000060705.1 Contig49506newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035549SMESG000060705.1 Contig49506uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pigment cellSMED30035549SMESG000066444.1 SMESG000060705.1 dd_Smed_v6_876_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035549SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane 9 superfamily member vs. Ensembl Human
Match: TM9SF2 (transmembrane 9 superfamily member 2 [Source:HGNC Symbol;Acc:HGNC:11865])

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 365/636 (57.39%), Postives = 465/636 (73.11%), Query Frame = 3
Query:  108 SFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY-QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLD-TEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            S  FYLPG+APV +C ++ +  +C+ EI ++VN+LDS +SVLPYEY  FDFC+    K P+ENLGQ+LFGERI+ SPY   F      K +CT+TY    ++DK KL FL   + LNY+HHWIVDN+PV  CY   + +  C  GFPIGCY  D       C   ++ ++ +T+Y+FNH+   I +Y           R+V  ++   S    K    +K   + PPM +        +  YT+SV FE +   +W+SRWDY+L++MP ++IQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D TE+AQEEFGWKLVHGD+FRPPR GM L VF+GSG Q+++MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ +AR YK   GEKWK+NVLLT+FLCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL F+GAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   33 SGAFYLPGLAPVNFCDEEKKSDECKAEIELFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITDKGHAKDACVISSDFHERDTFYIFNHVD--IKIYYHVVETGSMGARLVAAKLEPKSF---KHTHIDKPDCSGPPMDISNKASGEIKIAYTYSVSFEEDDKIRWASRWDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKLVHGDIFRPPRKGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVAARFYKSFGGEKWKTNVLLTSFLCPGIVFADFFIMNLILWGEGSSAAIPFGTLVAILALWFCISVPLTFIGAYFGFKKNAIEHPVRTNQIPRQIPEQSFYTKPLPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLIYAVHYFFSKLQITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 663          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Human
Match: TM9SF2 (transmembrane 9 superfamily member 2 [Source:HGNC Symbol;Acc:HGNC:11865])

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 365/636 (57.39%), Postives = 465/636 (73.11%), Query Frame = 3
Query:  108 SFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY-QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLD-TEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            S  FYLPG+APV +C ++ +  +C+ EI ++VN+LDS +SVLPYEY  FDFC+    K P+ENLGQ+LFGERI+ SPY   F      K +CT+TY    ++DK KL FL   + LNY+HHWIVDN+PV  CY   + +  C  GFPIGCY  D       C   ++ ++ +T+Y+FNH+   I +Y           R+V  ++   S    K    +K   + PPM +        +  YT+SV FE +   +W+SRWDY+L++MP ++IQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D TE+AQEEFGWKLVHGD+FRPPR GM L VF+GSG Q+++MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ +AR YK   GEKWK+NVLLT+FLCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL F+GAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   33 SGAFYLPGLAPVNFCDEEKKSDECKAEIELFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITDKGHAKDACVISSDFHERDTFYIFNHVD--IKIYYHVVETGSMGARLVAAKLEPKSF---KHTHIDKPDCSGPPMDISNKASGEIKIAYTYSVSFEEDDKIRWASRWDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKLVHGDIFRPPRKGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVAARFYKSFGGEKWKTNVLLTSFLCPGIVFADFFIMNLILWGEGSSAAIPFGTLVAILALWFCISVPLTFIGAYFGFKKNAIEHPVRTNQIPRQIPEQSFYTKPLPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLIYAVHYFFSKLQITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 663          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Human
Match: TM9SF4 (transmembrane 9 superfamily member 4 [Source:HGNC Symbol;Acc:HGNC:30797])

HSP 1 Score: 502.671 bits (1293), Expect = 2.159e-169
Identity = 275/637 (43.17%), Postives = 384/637 (60.28%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPE-QVKSGRIVFVRVNIASVAYVKDKAQEKDLATAP------PMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             FY+PG+AP+ +   D  E+   K        L S ++ LPYEY    FC+P  +    ENLG++L G+RI ++P+ V        + +C+++  K V+    +   +   I  +Y  H I DNLPV +  +       Y+       +  K               N  YL NH++  +  + +D  E Q  + R+V   V   S+     KA EK   T P      P  +   ++N   +T+SV +E + D KW+SRWD  L TM    I WFSI+NSV++V FLSG+L+MI+++TL +DI  YNK D  E+  EE GWKLVHGDVFRPP+  M L   +GSG+QL  M +I +F++  G LSP++RGA +T     ++  G+F GF++ RLY+ + G +WK     TA L PG VFGI FVLN  +W   SS AVPF T++ LL MWF IS+PL ++G YFGF+K P   PVRTNQIPRQIP Q  Y      ILM G+LPFG +FI+LFFI ++IW    YY+FG LFLVF+ILV++CS+ +I++ YF LCAEDYRWWWR+FL SG +A Y+  Y+I++F  KLDI     + LYFGYTA+++   +L+TGT+GF  ++ FVRKIY+ VK+D
Sbjct:    6 AFYVPGVAPINFHQNDPVEIKAVK--------LTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLCSQS-NKPVTLTVEQSRLVAERITEDYYVHLIADNLPVATRLE------LYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKADEKSSCTLPEGTNSSPQEIDPTKENQLYFTYSVHWEES-DIKWASRWDTYL-TMSDVQIHWFSIINSVVVVFFLSGILSMIIIRTLRKDIANYNKEDDIEDTMEESGWKLVHGDVFRPPQYPMILSSLLGSGIQLFCMILIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGFSAGRLYRTLKGHRWKKGAFCTATLYPGVVFGICFVLNCFIWGKHSSGAVPFPTMVALLCMWFGISLPLVYLGYYFGFRKQPYDNPVRTNQIPRQIPEQRWYMNRFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRNFLVSGGSAFYVLVYAIFYFVNKLDIVEFIPSLLYFGYTALMVLSFWLLTGTIGFYAAYMFVRKIYAAVKID 625          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Human
Match: TM9SF4 (transmembrane 9 superfamily member 4 [Source:HGNC Symbol;Acc:HGNC:30797])

HSP 1 Score: 502.286 bits (1292), Expect = 5.266e-169
Identity = 275/637 (43.17%), Postives = 384/637 (60.28%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPE-QVKSGRIVFVRVNIASVAYVKDKAQEKDLATAP------PMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             FY+PG+AP+ +   D  E+   K        L S ++ LPYEY    FC+P  +    ENLG++L G+RI ++P+ V        + +C+++  K V+    +   +   I  +Y  H I DNLPV +  +       Y+       +  K               N  YL NH++  +  + +D  E Q  + R+V   V   S+     KA EK   T P      P  +   ++N   +T+SV +E + D KW+SRWD  L TM    I WFSI+NSV++V FLSG+L+MI+++TL +DI  YNK D  E+  EE GWKLVHGDVFRPP+  M L   +GSG+QL  M +I +F++  G LSP++RGA +T     ++  G+F GF++ RLY+ + G +WK     TA L PG VFGI FVLN  +W   SS AVPF T++ LL MWF IS+PL ++G YFGF+K P   PVRTNQIPRQIP Q  Y      ILM G+LPFG +FI+LFFI ++IW    YY+FG LFLVF+ILV++CS+ +I++ YF LCAEDYRWWWR+FL SG +A Y+  Y+I++F  KLDI     + LYFGYTA+++   +L+TGT+GF  ++ FVRKIY+ VK+D
Sbjct:   23 AFYVPGVAPINFHQNDPVEIKAVK--------LTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLCSQS-NKPVTLTVEQSRLVAERITEDYYVHLIADNLPVATRLE------LYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKADEKSSCTLPEGTNSSPQEIDPTKENQLYFTYSVHWEES-DIKWASRWDTYL-TMSDVQIHWFSIINSVVVVFFLSGILSMIIIRTLRKDIANYNKEDDIEDTMEESGWKLVHGDVFRPPQYPMILSSLLGSGIQLFCMILIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGFSAGRLYRTLKGHRWKKGAFCTATLYPGVVFGICFVLNCFIWGKHSSGAVPFPTMVALLCMWFGISLPLVYLGYYFGFRKQPYDNPVRTNQIPRQIPEQRWYMNRFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRNFLVSGGSAFYVLVYAIFYFVNKLDIVEFIPSLLYFGYTALMVLSFWLLTGTIGFYAAYMFVRKIYAAVKID 642          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Human
Match: TM9SF1 (transmembrane 9 superfamily member 1 [Source:HGNC Symbol;Acc:HGNC:11864])

HSP 1 Score: 252.677 bits (644), Expect = 7.451e-74
Identity = 189/620 (30.48%), Postives = 313/620 (50.48%), Query Frame = 3
Query:  189 IAVYVNKL---DSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKF-ETNKDTKWSSRWDYVLKTMPQS-NIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEA---------QEEFGWKLVHGDVFR-PPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKP-PISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            + +YVNK+    +PQ    Y Y +   C P  ++  + +LG++L G+R+  S Y + F  +   + +C       +    +++  L   I   Y   ++VD+LP+              GF +G  ++             +   +   L+ H+   +  + D         RI+F  V++  V     K    D        L+ +E     +T+SV++ ET+ + +   R        P++  I W SI+NS+++V  L G +A+IL++ L  D+ RYN LD E           Q + GWK++H DVFR PP  G+ LC  +G G Q + +    + ++  G  +    GA  +  I+ Y L    +G+ S+  Y+ + GE+W  N++LT  L     F  + V+N V WA+GS+ A+P TTIL LL +W L+  PL  +G  FG     P   P RT  I R+IP Q  Y   +  + +GG LPF  I ++L++I  ++W    Y ++G+LF VF IL+   +  +I L YF L  EDYRWWWRS L+ G T L++F YS++++  + ++ G+  T  +FGY+ +  ++ FL+ GT+ F +S  F+R IY  +K+D
Sbjct:   42 VILYVNKVGPYHNPQET--YHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCH------MQLSSAQVEQLRQAIEELYYFEFVVDDLPI-------------RGF-VGYMEE----------SGFLPHSHKIGLWTHLDFHLEFHGD---------RIIFANVSVRDV-----KPHSLDG-------LRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYN-LDEETTSAGSGDDFDQGDNGWKIIHTDVFRFPPYRGL-LCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYRQIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAPCRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Celegans
Match: tag-123 (Transmembrane 9 superfamily member [Source:UniProtKB/TrEMBL;Acc:O17388])

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 362/654 (55.35%), Postives = 468/654 (71.56%), Query Frame = 3
Query:   69 MLLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEIC-TRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGE-AEICYNGFPIGCYQDPKS-KSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPP------EQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEE-AQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            ML   L +SF   +  FYLPG+APV +C  + E+ +C   I++YVN LDS +SV+PYEY+ FDFC     +SP ENLGQ+LFGERI+ SPY V F      + +C T+ Y +G + D +KL  L   + LNY+HHWIVDN+PV  C+KN +  ++C  GFP+GC+ D +  +   C  +     PN +Y+FNH+   I +Y  D        E    GRI+ + V   S+ +    + +   +  P  I  ++E     Y++S+K+ T  D KWSSRWDY+L++MP +NIQWFSI+NS++IVLFL+GM+ MI+++TLHRDIDRYN+LDTEE AQEEFGWKLVHGDVFR PR  M L VF+G+G Q +LM  +TL  +C GFLSPANRG+ +T  + FYVLFG+ AG+ SARLYK   G  WK+N+++TAFL PG +F IFF  N +LW  GSSAAVPF T+L LL +W  ISVP+ FVGAYFGFKK  I  PVRTN+IPRQ+P Q+ YT+ +P +LMGG+LPFGCIFIQLFFILNSIW+   YYMFG LFLV+LIL+ITCSE TILL YFHLCAEDY WWWRSF+TSG TA+YLF Y I+FF+ KL I G+ ST LYF YT+I +++ FL+TGT+GFL +++FVRKIY  VKVD
Sbjct:    7 MLTKLLLVSFLASASAFYLPGLAPVNFC--EVEKANCPSNISLYVNHLDSDRSVIPYEYHSFDFCTVNEDESPVENLGQVLFGERIRPSPYKVAFLQEEKCRLVCDTKKYARGSADDLAKLRLLQRAMTLNYQHHWIVDNMPVTFCFKNLQNMDVCTTGFPVGCFVDEQGYQHDACVLNQKYKTPNNFYIFNHVD--IEIYYRDMTNDGNFLEHKVGGRIIRIDVKPRSIKHSSSSSLDCSDSAEPIAIDAKSESAEITYSYSIKW-TKTDIKWSSRWDYILQSMPHTNIQWFSIMNSLVIVLFLTGMVGMIIMRTLHRDIDRYNRLDTEEDAQEEFGWKLVHGDVFRTPRYPMLLSVFIGAGCQTLLMVSVTLVFACLGFLSPANRGSLITFALFFYVLFGIVAGYISARLYKTFEGIHWKTNLVMTAFLVPGILFTIFFFSNTLLWTKGSSAAVPFGTLLVLLVLWIFISVPMTFVGAYFGFKKRGIEAPVRTNKIPRQVPEQTFYTKPLPGMLMGGILPFGCIFIQLFFILNSIWAHQTYYMFGFLFLVYLILIITCSEATILLAYFHLCAEDYHWWWRSFMTSGFTAIYLFIYCIHFFNTKLTISGTISTILYFSYTSIFVFMFFLMTGTIGFLATYYFVRKIYGSVKVD 655          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Celegans
Match: ZK858.6 (Transmembrane 9 superfamily member [Source:UniProtKB/TrEMBL;Acc:Q7YTF9])

HSP 1 Score: 429.483 bits (1103), Expect = 5.015e-141
Identity = 256/661 (38.73%), Postives = 380/661 (57.49%), Query Frame = 3
Query:   45 LSKFLKI*MLLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPP--LVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEA-EICYN-GFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENE----DNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEF-GWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            L  +L+   LLV  TL    +  GFY+PG+APV +   D  +V   K I     KL S  +++P+EY    FC+P    ++  +ENLG+++ G+RI     N P+       E C       +S  K  ++     I   Y  H IVDNLPV +     ++ ++ Y+ G+ +G   D          +A V      +L NH+   +  +   P       R+V   V   S++  K+   +    + P    K  E    + +  +++SV FE   D  W+SRWD  L T    +I WFSILNS+++VL LSG +++ +++T+ RDI +YN+ D E+   E  GWKLVHGDVFRPP   M L   VG+G+QL+ M+ I +  +  G LSPA+RG+ ++  +  +   GL +G+++ RLYK M G       + TA L P  + G  F+LN  L    SS AVPF T++ LL MWF I +PL F+G YFG++K P + PVRTNQIPRQ+P Q  + R IPS L+ GVLPFG +FI+LFFI N+IW    YY+FG LF+V +IL I+ ++ +++  YF LCAE+YRWWWRSF+ SG ++ Y+  Y++++++ KL I+G   T LYF Y+++I    F +TGT+GF  S +F+ KIY+ VK+D
Sbjct:   37 LMAYLRTSTLLVLATL--IPLEQGFYVPGVAPVDFKAGDVIDV---KAI-----KLTSSNNIMPFEYYSVPFCKPANGDIQYKSENLGEVMRGDRI----VNTPYAFHMKKNEQCVSVCSNKLS--KENVALFKERIRQEYSAHLIVDNLPVATVINPAQSGDVYYDLGYRLGWIGD----------NAKV------FLNNHLQFVVKYHQHTPGLY----RVVGFEVRPRSISATKN---DDGTCSMPDDGTKHVELGDSEQSVDFSYSVAFE-ESDVPWASRWDVYLTT-KAVDIHWFSILNSIVVVLSLSGFVSVTIVRTVRRDIAQYNRDDEEDDTLEETGWKLVHGDVFRPPPHQMILVNMVGTGIQLLGMSAIVVVCAMLGMLSPASRGSLMSAAVFLFCFMGLISGYHAGRLYKTMKGRNPIRCAVQTATLFPSLILGAGFLLNFFLIGKHSSGAVPFGTMVALLIMWFCIDMPLIFLGFYFGYRKQPYTHPVRTNQIPRQVPEQPWFLRLIPSSLIAGVLPFGAMFIELFFIFNAIWENQFYYLFGFLFIVSIILAISTAQISVVATYFSLCAENYRWWWRSFVISGGSSFYVMAYAVFYYNTKLTIEGFVPTVLYFSYSSLIALTFFFMTGTIGFYASHFFLTKIYAAVKID 656          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Celegans
Match: ZK858.6 (Transmembrane 9 superfamily member [Source:UniProtKB/TrEMBL;Acc:Q7YTF9])

HSP 1 Score: 429.483 bits (1103), Expect = 5.015e-141
Identity = 256/661 (38.73%), Postives = 380/661 (57.49%), Query Frame = 3
Query:   45 LSKFLKI*MLLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPP--LVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEA-EICYN-GFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENE----DNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEF-GWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            L  +L+   LLV  TL    +  GFY+PG+APV +   D  +V   K I     KL S  +++P+EY    FC+P    ++  +ENLG+++ G+RI     N P+       E C       +S  K  ++     I   Y  H IVDNLPV +     ++ ++ Y+ G+ +G   D          +A V      +L NH+   +  +   P       R+V   V   S++  K+   +    + P    K  E    + +  +++SV FE   D  W+SRWD  L T    +I WFSILNS+++VL LSG +++ +++T+ RDI +YN+ D E+   E  GWKLVHGDVFRPP   M L   VG+G+QL+ M+ I +  +  G LSPA+RG+ ++  +  +   GL +G+++ RLYK M G       + TA L P  + G  F+LN  L    SS AVPF T++ LL MWF I +PL F+G YFG++K P + PVRTNQIPRQ+P Q  + R IPS L+ GVLPFG +FI+LFFI N+IW    YY+FG LF+V +IL I+ ++ +++  YF LCAE+YRWWWRSF+ SG ++ Y+  Y++++++ KL I+G   T LYF Y+++I    F +TGT+GF  S +F+ KIY+ VK+D
Sbjct:   37 LMAYLRTSTLLVLATL--IPLEQGFYVPGVAPVDFKAGDVIDV---KAI-----KLTSSNNIMPFEYYSVPFCKPANGDIQYKSENLGEVMRGDRI----VNTPYAFHMKKNEQCVSVCSNKLS--KENVALFKERIRQEYSAHLIVDNLPVATVINPAQSGDVYYDLGYRLGWIGD----------NAKV------FLNNHLQFVVKYHQHTPGLY----RVVGFEVRPRSISATKN---DDGTCSMPDDGTKHVELGDSEQSVDFSYSVAFE-ESDVPWASRWDVYLTT-KAVDIHWFSILNSIVVVLSLSGFVSVTIVRTVRRDIAQYNRDDEEDDTLEETGWKLVHGDVFRPPPHQMILVNMVGTGIQLLGMSAIVVVCAMLGMLSPASRGSLMSAAVFLFCFMGLISGYHAGRLYKTMKGRNPIRCAVQTATLFPSLILGAGFLLNFFLIGKHSSGAVPFGTMVALLIMWFCIDMPLIFLGFYFGYRKQPYTHPVRTNQIPRQVPEQPWFLRLIPSSLIAGVLPFGAMFIELFFIFNAIWENQFYYLFGFLFIVSIILAISTAQISVVATYFSLCAENYRWWWRSFVISGGSSFYVMAYAVFYYNTKLTIEGFVPTVLYFSYSSLIALTFFFMTGTIGFYASHFFLTKIYAAVKID 656          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Celegans
Match: ZK858.6 (Transmembrane 9 superfamily member [Source:UniProtKB/TrEMBL;Acc:Q7YTF9])

HSP 1 Score: 427.943 bits (1099), Expect = 6.084e-141
Identity = 255/658 (38.75%), Postives = 379/658 (57.60%), Query Frame = 3
Query:   54 FLKI*MLLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPP--LVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEA-EICYN-GFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENE----DNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEF-GWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            +L+   LLV  TL    +  GFY+PG+APV +   D  +V   K I     KL S  +++P+EY    FC+P    ++  +ENLG+++ G+RI     N P+       E C       +S  K  ++     I   Y  H IVDNLPV +     ++ ++ Y+ G+ +G   D          +A V      +L NH+   +  +   P       R+V   V   S++  K+   +    + P    K  E    + +  +++SV FE   D  W+SRWD  L T    +I WFSILNS+++VL LSG +++ +++T+ RDI +YN+ D E+   E  GWKLVHGDVFRPP   M L   VG+G+QL+ M+ I +  +  G LSPA+RG+ ++  +  +   GL +G+++ RLYK M G       + TA L P  + G  F+LN  L    SS AVPF T++ LL MWF I +PL F+G YFG++K P + PVRTNQIPRQ+P Q  + R IPS L+ GVLPFG +FI+LFFI N+IW    YY+FG LF+V +IL I+ ++ +++  YF LCAE+YRWWWRSF+ SG ++ Y+  Y++++++ KL I+G   T LYF Y+++I    F +TGT+GF  S +F+ KIY+ VK+D
Sbjct:    3 YLRTSTLLVLATL--IPLEQGFYVPGVAPVDFKAGDVIDV---KAI-----KLTSSNNIMPFEYYSVPFCKPANGDIQYKSENLGEVMRGDRI----VNTPYAFHMKKNEQCVSVCSNKLS--KENVALFKERIRQEYSAHLIVDNLPVATVINPAQSGDVYYDLGYRLGWIGD----------NAKV------FLNNHLQFVVKYHQHTPGLY----RVVGFEVRPRSISATKN---DDGTCSMPDDGTKHVELGDSEQSVDFSYSVAFE-ESDVPWASRWDVYLTT-KAVDIHWFSILNSIVVVLSLSGFVSVTIVRTVRRDIAQYNRDDEEDDTLEETGWKLVHGDVFRPPPHQMILVNMVGTGIQLLGMSAIVVVCAMLGMLSPASRGSLMSAAVFLFCFMGLISGYHAGRLYKTMKGRNPIRCAVQTATLFPSLILGAGFLLNFFLIGKHSSGAVPFGTMVALLIMWFCIDMPLIFLGFYFGYRKQPYTHPVRTNQIPRQVPEQPWFLRLIPSSLIAGVLPFGAMFIELFFIFNAIWENQFYYLFGFLFIVSIILAISTAQISVVATYFSLCAENYRWWWRSFVISGGSSFYVMAYAVFYYNTKLTIEGFVPTVLYFSYSSLIALTFFFMTGTIGFYASHFFLTKIYAAVKID 619          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Celegans
Match: ZK858.6 (Transmembrane 9 superfamily member [Source:UniProtKB/TrEMBL;Acc:Q7YTF9])

HSP 1 Score: 427.943 bits (1099), Expect = 6.084e-141
Identity = 255/658 (38.75%), Postives = 379/658 (57.60%), Query Frame = 3
Query:   54 FLKI*MLLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPP--LVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEA-EICYN-GFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENE----DNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEF-GWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            +L+   LLV  TL    +  GFY+PG+APV +   D  +V   K I     KL S  +++P+EY    FC+P    ++  +ENLG+++ G+RI     N P+       E C       +S  K  ++     I   Y  H IVDNLPV +     ++ ++ Y+ G+ +G   D          +A V      +L NH+   +  +   P       R+V   V   S++  K+   +    + P    K  E    + +  +++SV FE   D  W+SRWD  L T    +I WFSILNS+++VL LSG +++ +++T+ RDI +YN+ D E+   E  GWKLVHGDVFRPP   M L   VG+G+QL+ M+ I +  +  G LSPA+RG+ ++  +  +   GL +G+++ RLYK M G       + TA L P  + G  F+LN  L    SS AVPF T++ LL MWF I +PL F+G YFG++K P + PVRTNQIPRQ+P Q  + R IPS L+ GVLPFG +FI+LFFI N+IW    YY+FG LF+V +IL I+ ++ +++  YF LCAE+YRWWWRSF+ SG ++ Y+  Y++++++ KL I+G   T LYF Y+++I    F +TGT+GF  S +F+ KIY+ VK+D
Sbjct:    3 YLRTSTLLVLATL--IPLEQGFYVPGVAPVDFKAGDVIDV---KAI-----KLTSSNNIMPFEYYSVPFCKPANGDIQYKSENLGEVMRGDRI----VNTPYAFHMKKNEQCVSVCSNKLS--KENVALFKERIRQEYSAHLIVDNLPVATVINPAQSGDVYYDLGYRLGWIGD----------NAKV------FLNNHLQFVVKYHQHTPGLY----RVVGFEVRPRSISATKN---DDGTCSMPDDGTKHVELGDSEQSVDFSYSVAFE-ESDVPWASRWDVYLTT-KAVDIHWFSILNSIVVVLSLSGFVSVTIVRTVRRDIAQYNRDDEEDDTLEETGWKLVHGDVFRPPPHQMILVNMVGTGIQLLGMSAIVVVCAMLGMLSPASRGSLMSAAVFLFCFMGLISGYHAGRLYKTMKGRNPIRCAVQTATLFPSLILGAGFLLNFFLIGKHSSGAVPFGTMVALLIMWFCIDMPLIFLGFYFGYRKQPYTHPVRTNQIPRQVPEQPWFLRLIPSSLIAGVLPFGAMFIELFFIFNAIWENQFYYLFGFLFIVSIILAISTAQISVVATYFSLCAENYRWWWRSFVISGGSSFYVMAYAVFYYNTKLTIEGFVPTVLYFSYSSLIALTFFFMTGTIGFYASHFFLTKIYAAVKID 619          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Fly
Match: TM9SF2 (gene:FBgn0032880 transcript:FBtr0335149)

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 378/640 (59.06%), Postives = 472/640 (73.75%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCY--KNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQV----KSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMI----LKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             FYLPG+APV +C K      C+ EI +YVN+L++ +SV+PYEY+ FDFC      SP ENLGQ++FGERI+  PY + F  +      C +TYK        ++  L  GI+LNY+HHWIVDN+PV  CY  +NG+ + C  GFP+GC    +S    C  ++  N+P  YY FNH+ L I+ +S    +       SGRI+ V+V   S+ +  DK     L+T P  I    LK  E     YT+SVKF  N   KWSSRWDY+L++MP +NIQWFSILNS++IVLFLSGM+AMI+L+TLH+DI RYN++D+ E+AQEEFGWKLVHGDVFRPPR GM L VF+GSGVQ+++M +ITL  +C GFLSPANRGA +TC +V +V  G  AG+ SAR+YK   G KWKSNV+LT+ +CPG VF +FFV+N+VLW   SS AVPF+T++ LLA+WF +SVPL FVGAYFGF+K  +  PVRTNQIPRQIP QS+YT+ IP I+MGGVLPFGCIFIQLFFIL+S+WS+ +YYMFG LFLVF+ILVITCSETTILLCYFHLCAEDY WWWRSFLTSG TA+YLF Y  ++F  KL IK S STFLYFGYTAI+++L FL+TGT+GF   FWF+RKIYSVVKVD
Sbjct:   24 AFYLPGLAPVNFCKKTDVSSTCKSEILLYVNRLNTEESVIPYEYHHFDFCLGEEQNSPVENLGQVVFGERIRPGPYKIQFLENQQCATTCVKTYKGDDPASNRRMMVLKKGISLNYQHHWIVDNMPVTWCYPLENGK-QYCGIGFPMGCLV--RSDGEGCPINSIYNQPMHYYPFNHVDLEITYHSGQSEDWGIQFGNSGRIISVKVTPKSIKHT-DKENPNCLSTEPLAISENSLKAGEQLEIVYTYSVKFVKNDSIKWSSRWDYILESMPHTNIQWFSILNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSGEDAQEEFGWKLVHGDVFRPPRKGMLLSVFLGSGVQVLVMAMITLAFACLGFLSPANRGALMTCSMVLFVSLGTPAGYVSARIYKSFGGLKWKSNVILTSIVCPGVVFSLFFVMNLVLWGENSSGAVPFSTLIALLALWFGVSVPLTFVGAYFGFRKRALEHPVRTNQIPRQIPDQSIYTQPIPGIVMGGVLPFGCIFIQLFFILSSLWSSQIYYMFGFLFLVFVILVITCSETTILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYCCHYFVTKLSIKDSASTFLYFGYTAIMVFLFFLLTGTIGFFACFWFIRKIYSVVKVD 659          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Fly
Match: TM9SF2 (gene:FBgn0032880 transcript:FBtr0081393)

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 378/640 (59.06%), Postives = 472/640 (73.75%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCY--KNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQV----KSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMI----LKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             FYLPG+APV +C K      C+ EI +YVN+L++ +SV+PYEY+ FDFC      SP ENLGQ++FGERI+  PY + F  +      C +TYK        ++  L  GI+LNY+HHWIVDN+PV  CY  +NG+ + C  GFP+GC    +S    C  ++  N+P  YY FNH+ L I+ +S    +       SGRI+ V+V   S+ +  DK     L+T P  I    LK  E     YT+SVKF  N   KWSSRWDY+L++MP +NIQWFSILNS++IVLFLSGM+AMI+L+TLH+DI RYN++D+ E+AQEEFGWKLVHGDVFRPPR GM L VF+GSGVQ+++M +ITL  +C GFLSPANRGA +TC +V +V  G  AG+ SAR+YK   G KWKSNV+LT+ +CPG VF +FFV+N+VLW   SS AVPF+T++ LLA+WF +SVPL FVGAYFGF+K  +  PVRTNQIPRQIP QS+YT+ IP I+MGGVLPFGCIFIQLFFIL+S+WS+ +YYMFG LFLVF+ILVITCSETTILLCYFHLCAEDY WWWRSFLTSG TA+YLF Y  ++F  KL IK S STFLYFGYTAI+++L FL+TGT+GF   FWF+RKIYSVVKVD
Sbjct:   24 AFYLPGLAPVNFCKKTDVSSTCKSEILLYVNRLNTEESVIPYEYHHFDFCLGEEQNSPVENLGQVVFGERIRPGPYKIQFLENQQCATTCVKTYKGDDPASNRRMMVLKKGISLNYQHHWIVDNMPVTWCYPLENGK-QYCGIGFPMGCLV--RSDGEGCPINSIYNQPMHYYPFNHVDLEITYHSGQSEDWGIQFGNSGRIISVKVTPKSIKHT-DKENPNCLSTEPLAISENSLKAGEQLEIVYTYSVKFVKNDSIKWSSRWDYILESMPHTNIQWFSILNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSGEDAQEEFGWKLVHGDVFRPPRKGMLLSVFLGSGVQVLVMAMITLAFACLGFLSPANRGALMTCSMVLFVSLGTPAGYVSARIYKSFGGLKWKSNVILTSIVCPGVVFSLFFVMNLVLWGENSSGAVPFSTLIALLALWFGVSVPLTFVGAYFGFRKRALEHPVRTNQIPRQIPDQSIYTQPIPGIVMGGVLPFGCIFIQLFFILSSLWSSQIYYMFGFLFLVFVILVITCSETTILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYCCHYFVTKLSIKDSASTFLYFGYTAIMVFLFFLLTGTIGFFACFWFIRKIYSVVKVD 659          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Fly
Match: TM9SF4 (gene:FBgn0028541 transcript:FBtr0080532)

HSP 1 Score: 478.404 bits (1230), Expect = 2.616e-160
Identity = 266/637 (41.76%), Postives = 382/637 (59.97%), Query Frame = 3
Query:  117 FYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPP--LVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVS--CYKNGEAEICY-NGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDL---ATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            FY+PG+APV + V+D       ++I V   K+ S ++ LPY+Y    FC P    +   +ENLG++L G+RI ++PY V      N + +C +   + ++  K   + +   I   Y  H +VDNLPV +     N  AE+ Y +G+ +G                 V+  N Y + NH+   +S +     +     R+V   V   SV++ + K          +A P ++  N +    +T+SV+++ +K   W+SRWD  L  M    I WFSI+NS+++V FLSG+L MI+++TL RDI RYN  D  E+  EE GWKLVHGDVFRPP+        +GSG+Q+  M +IT+F +  G LSP++RGA +T GI  YV  G  AG+ +ARLYK M G +WK    LTA L PG VFG  F LN  +W   SS AVPFTT++ LL +WF ISVPL ++G Y G++K P   PVRTN IPRQ+P Q  Y  A+ S LM G+LPFG +FI+LFF+  +IW    YY+FG LFLVF ILV++C++ +I++ YF LC EDYRWWWRSF+ SG +A+Y+  YSI++F  KL+I     T LY GYT +++   +L+TG++GF  ++ F+ +IY  VK+D
Sbjct:   26 FYVPGVAPVEF-VQD-------QKIDVKAVKMTSSRTQLPYQYYSLRFCYPKNGTLIFKSENLGEVLRGDRIVNTPYEVRMNQQVNCRLLCNQK-DRPLTWSKEDSALVAERIQHEYFVHLLVDNLPVATRIVSVNNPAEVTYEHGYRLG----------------QVDGDNIY-INNHLKFILSYHMHSKDKY----RVVGFEVETVSVSHKELKFHGDTCNFPDSARPQLVNPNGETQLYFTYSVEWKESK-VSWASRWDIYLG-MRDVQIHWFSIINSLVVVFFLSGILTMIMIRTLRRDIARYNTDDNIEDTLEETGWKLVHGDVFRPPKNTRLFSAIIGSGIQIFFMALITIFFAMLGMLSPSSRGALMTSGIFMYVFMGTIAGYYAARLYKTMKGREWKRAAFLTATLYPGIVFGTGFFLNFFIWDKSSSGAVPFTTMISLLLLWFGISVPLVYLGFYLGYRKQPYQHPVRTNMIPRQVPTQHWYMNAVLSTLMAGILPFGAVFIELFFVFTAIWQNQFYYLFGFLFLVFCILVVSCAQISIVMTYFQLCGEDYRWWWRSFVVSGGSAVYVLFYSIFYFFTKLEITEFIPTLLYLGYTGLMVLTFWLLTGSIGFFAAYVFILRIYGAVKID 630          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Fly
Match: TM9SF4 (gene:FBgn0028541 transcript:FBtr0343657)

HSP 1 Score: 478.404 bits (1230), Expect = 2.616e-160
Identity = 266/637 (41.76%), Postives = 382/637 (59.97%), Query Frame = 3
Query:  117 FYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPP--LVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVS--CYKNGEAEICY-NGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDL---ATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            FY+PG+APV + V+D       ++I V   K+ S ++ LPY+Y    FC P    +   +ENLG++L G+RI ++PY V      N + +C +   + ++  K   + +   I   Y  H +VDNLPV +     N  AE+ Y +G+ +G                 V+  N Y + NH+   +S +     +     R+V   V   SV++ + K          +A P ++  N +    +T+SV+++ +K   W+SRWD  L  M    I WFSI+NS+++V FLSG+L MI+++TL RDI RYN  D  E+  EE GWKLVHGDVFRPP+        +GSG+Q+  M +IT+F +  G LSP++RGA +T GI  YV  G  AG+ +ARLYK M G +WK    LTA L PG VFG  F LN  +W   SS AVPFTT++ LL +WF ISVPL ++G Y G++K P   PVRTN IPRQ+P Q  Y  A+ S LM G+LPFG +FI+LFF+  +IW    YY+FG LFLVF ILV++C++ +I++ YF LC EDYRWWWRSF+ SG +A+Y+  YSI++F  KL+I     T LY GYT +++   +L+TG++GF  ++ F+ +IY  VK+D
Sbjct:   26 FYVPGVAPVEF-VQD-------QKIDVKAVKMTSSRTQLPYQYYSLRFCYPKNGTLIFKSENLGEVLRGDRIVNTPYEVRMNQQVNCRLLCNQK-DRPLTWSKEDSALVAERIQHEYFVHLLVDNLPVATRIVSVNNPAEVTYEHGYRLG----------------QVDGDNIY-INNHLKFILSYHMHSKDKY----RVVGFEVETVSVSHKELKFHGDTCNFPDSARPQLVNPNGETQLYFTYSVEWKESK-VSWASRWDIYLG-MRDVQIHWFSIINSLVVVFFLSGILTMIMIRTLRRDIARYNTDDNIEDTLEETGWKLVHGDVFRPPKNTRLFSAIIGSGIQIFFMALITIFFAMLGMLSPSSRGALMTSGIFMYVFMGTIAGYYAARLYKTMKGREWKRAAFLTATLYPGIVFGTGFFLNFFIWDKSSSGAVPFTTMISLLLLWFGISVPLVYLGFYLGYRKQPYQHPVRTNMIPRQVPTQHWYMNAVLSTLMAGILPFGAVFIELFFVFTAIWQNQFYYLFGFLFLVFCILVVSCAQISIVMTYFQLCGEDYRWWWRSFVVSGGSAVYVLFYSIFYFFTKLEITEFIPTLLYLGYTGLMVLTFWLLTGSIGFFAAYVFILRIYGAVKID 630          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Fly
Match: TM9SF3 (gene:FBgn0035622 transcript:FBtr0077127)

HSP 1 Score: 233.417 bits (594), Expect = 3.405e-67
Identity = 150/403 (37.22%), Postives = 230/403 (57.07%), Query Frame = 3
Query:  819 YTFSVKFETNKDTKWSSRWD-YVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNK---LDTEEAQ--EEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFK---KPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            +++ V ++ +K  ++ +R+D Y+     Q  I WFSI NS ++V+FL G+++MIL++TL +D  RY+K   +D  E    +E+GWK VHGDVFR P   +     VG+G QLI +    +  +  G L    RG+ ++  I  Y       G+    LY  + G  W   +L++AF  P +V G  F++N +     +S A+PF T++ +  +   + +PL  VG   G     +P    P R N +PR IP +  Y   +  +L+GGVLPFG IFI+++FI  S W+  +YY++G + LVF IL +     TI+  YF L AEDYRW W SF+ +G T++Y++ YS Y+F  K  + G   T  YFGY A+      ++ GTVG++ +  FVRKIYS VK+D
Sbjct:  194 FSYEVNWKPSK-VEFKNRFDKYLDPNFFQHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKDEEIDDMERDLGDEYGWKQVHGDVFRSPPNTLLFSALVGAGYQLISVVFCVIMFAIVGELY-TERGSMLSTAIFVYAATSPINGYFGGSLYARLGGRMWIRQMLVSAFTVPVAVCGTAFLINFIAIGYHASRAIPFGTMVAVTCICLFVILPLTLVGTVVGRNLDGQPDF--PCRVNAVPRPIPEKKWYMEPLIIVLLGGVLPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVFSILTVVTVCVTIVCTYFLLNAEDYRWQWTSFMAAGSTSIYVYAYSFYYFFFKTKMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID 592          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Zebrafish
Match: tm9sf5 (transmembrane 9 superfamily protein member 5 [Source:ZFIN;Acc:ZDB-GENE-101013-1])

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 378/645 (58.60%), Postives = 480/645 (74.42%), Query Frame = 3
Query:   84 LTLSFFQISFGFYLPGIAPVTYCVKDS--EEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCY-KNGEAEICYNGFPIGCYQDPK-SKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            L+L+    SF FYLPG+APV +C K S  +  +CQ EI ++VN+LDS +SVLPYEY+ FDFC+    + PTENLGQ+LFGERI++SPY   F      +++CT++Y    + ++ KL FL  G+ LNY+HHWIVDN+PV  CY   G+ +IC  GFPIGC  + + +    C  +A+ NK NT+Y+FNH+ + I  +S D    + + R+V   +   S+ +      EK     PPM +    ++ F+  YT+SV F  N   +W+SRWDY+L +MP +NIQWFSI NS++IVLFLSGM+AMI+L+TLH+DI RYN+LD EEAQEE GWK VHGDVFR PRMGM L VF+G G Q+  MT ITLF++C GFLSPANRGA +TC +V +VL G  AG+ S+RLYK   GEKWK+NVLLTAFLCPG VF  FF++N++LW  GSSAAVPF T++ +LA+WF ISVPL FVGAYFGFKKP I  PVRTNQIPRQIP QS +T+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE T+LLCYFHLCAEDY WWWRSFLTSG TA+YLF Y++++F +KL I G+ ST LYFGYT I++ + F+ TGT+GF   F+FV KIYSV+KVD
Sbjct:   12 LSLTIVNSSFAFYLPGLAPVNFCKKSSTGDAEECQHEIQLFVNRLDSVESVLPYEYDAFDFCKDTNERRPTENLGQVLFGERIETSPYKFLFMNDLTCQKVCTKSYNTTSAVERLKLDFLKRGMDLNYQHHWIVDNMPVTWCYIVEGDQKICNPGFPIGCLVNQEGTPKDACVINADFNKKNTFYVFNHVDINIVYHSGDETTGM-AARLVGATLEPRSIMH---SDHEKPSCEGPPMEIPYEFNSNFKMTYTYSVTFTQNNAIRWASRWDYILVSMPHTNIQWFSISNSLVIVLFLSGMVAMIMLRTLHKDIARYNQLDQEEAQEESGWKQVHGDVFRAPRMGMLLSVFLGQGTQIFTMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSSRLYKTFGGEKWKTNVLLTAFLCPGIVFVDFFLMNLILWTEGSSAAVPFGTLVAILALWFGISVPLTFVGAYFGFKKPGIEPPVRTNQIPRQIPQQSFFTKPVPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATVLLCYFHLCAEDYNWWWRSFLTSGFTAVYLFVYAVHYFFSKLQIIGAASTILYFGYTLIMVLIFFVFTGTIGFFACFFFVNKIYSVLKVD 652          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Zebrafish
Match: tm9sf2 (transmembrane 9 superfamily member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6302])

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 380/655 (58.02%), Postives = 475/655 (72.52%), Query Frame = 3
Query:   75 LVFLTL---SFFQISFGFYLPGIAPVTYCVKD-----SEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYK-NGEAEICYNGFPIGCY-QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            +VF++L      + +  FYLPG+APV++C K+     SE  DC+  I ++VN+LDS +SVLPYEY  FDFC     K P+ENLGQ+LFGERI+ SPY   F      + +C ++YK   + DK+KL FL  G+ LNY+HHWIVDN+PV  CY      + C  GFPIGCY  D       C  +A+ N  +T+Y+FNH+ +TI  +  +   +V   R+V  ++   S    K    +K   T PPM L    +   R  YT+SVKF  +K  +W+SRWDY+L++MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D+ E+AQEEFGWKLVHGDVFRPPR GM L VF+GSG Q+ +MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ +AR YK   GEKWK+NVLLTAFLCPG VF  FFV+N++LW  GSSAA+PF T++ +LA+WF ISVPL F+GAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y+I++F +KL I G  ST LYFGYT I+  + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:    9 VVFVSLFVCGLLRDALSFYLPGLAPVSFCKKEAGDKNSEVPDCKSTIELFVNRLDSVESVLPYEYTAFDFCAEQHEKRPSENLGQVLFGERIELSPYKFLFQNDLQCQSVCVKSYKTQDAGDKAKLDFLKKGMLLNYQHHWIVDNMPVTWCYDVEDNQKFCNPGFPIGCYVTDTGRAKDACVVNADFNDKDTFYIFNHVDITI--FYHNVENEVAGARLVAAKLEPKSF---KQSNVDKPDCTGPPMSLSNKFNGEIRIPYTYSVKFLEDKTIRWASRWDYILESMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSVEDAQEEFGWKLVHGDVFRPPRKGMLLSVFLGSGTQIFIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVAARYYKSFGGEKWKTNVLLTAFLCPGVVFADFFVMNLILWGEGSSAAMPFGTLVAILALWFCISVPLTFIGAYFGFKKSAIEHPVRTNQIPRQIPEQSFYTKPLPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLVYAIHYFFSKLQISGLASTILYFGYTMIMALIFFLFTGTIGFFACFWFVTKIYSVVKVD 658          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Zebrafish
Match: tm9sf2 (transmembrane 9 superfamily member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6302])

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 380/655 (58.02%), Postives = 475/655 (72.52%), Query Frame = 3
Query:   75 LVFLTL---SFFQISFGFYLPGIAPVTYCVKD-----SEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYK-NGEAEICYNGFPIGCY-QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            +VF++L      + +  FYLPG+APV++C K+     SE  DC+  I ++VN+LDS +SVLPYEY  FDFC     K P+ENLGQ+LFGERI+ SPY   F      + +C ++YK   + DK+KL FL  G+ LNY+HHWIVDN+PV  CY      + C  GFPIGCY  D       C  +A+ N  +T+Y+FNH+ +TI  +  +   +V   R+V  ++   S    K    +K   T PPM L    +   R  YT+SVKF  +K  +W+SRWDY+L++MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D+ E+AQEEFGWKLVHGDVFRPPR GM L VF+GSG Q+ +MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ +AR YK   GEKWK+NVLLTAFLCPG VF  FFV+N++LW  GSSAA+PF T++ +LA+WF ISVPL F+GAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y+I++F +KL I G  ST LYFGYT I+  + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:    9 VVFVSLFVCGLLRDALSFYLPGLAPVSFCKKEAGDKNSEVPDCKSTIELFVNRLDSVESVLPYEYTAFDFCAEQHEKRPSENLGQVLFGERIELSPYKFLFQNDLQCQSVCVKSYKTQDAGDKAKLDFLKKGMLLNYQHHWIVDNMPVTWCYDVEDNQKFCNPGFPIGCYVTDTGRAKDACVVNADFNDKDTFYIFNHVDITI--FYHNVENEVAGARLVAAKLEPKSF---KQSNVDKPDCTGPPMSLSNKFNGEIRIPYTYSVKFLEDKTIRWASRWDYILESMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSVEDAQEEFGWKLVHGDVFRPPRKGMLLSVFLGSGTQIFIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVAARYYKSFGGEKWKTNVLLTAFLCPGVVFADFFVMNLILWGEGSSAAMPFGTLVAILALWFCISVPLTFIGAYFGFKKSAIEHPVRTNQIPRQIPEQSFYTKPLPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLVYAIHYFFSKLQISGLASTILYFGYTMIMALIFFLFTGTIGFFACFWFVTKIYSVVKVD 658          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Zebrafish
Match: tm9sf5 (transmembrane 9 superfamily protein member 5 [Source:ZFIN;Acc:ZDB-GENE-101013-1])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 378/659 (57.36%), Postives = 480/659 (72.84%), Query Frame = 3
Query:   84 LTLSFFQISFGFYLPGIAPVTYCVKDS--EEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCY-KNGEAEICYNGFPIGCYQDPK-SKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT--------------EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            L+L+    SF FYLPG+APV +C K S  +  +CQ EI ++VN+LDS +SVLPYEY+ FDFC+    + PTENLGQ+LFGERI++SPY   F      +++CT++Y    + ++ KL FL  G+ LNY+HHWIVDN+PV  CY   G+ +IC  GFPIGC  + + +    C  +A+ NK NT+Y+FNH+ + I  +S D    + + R+V   +   S+ +      EK     PPM +    ++ F+  YT+SV F  N   +W+SRWDY+L +MP +NIQWFSI NS++IVLFLSGM+AMI+L+TLH+DI RYN+LD               EEAQEE GWK VHGDVFR PRMGM L VF+G G Q+  MT ITLF++C GFLSPANRGA +TC +V +VL G  AG+ S+RLYK   GEKWK+NVLLTAFLCPG VF  FF++N++LW  GSSAAVPF T++ +LA+WF ISVPL FVGAYFGFKKP I  PVRTNQIPRQIP QS +T+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE T+LLCYFHLCAEDY WWWRSFLTSG TA+YLF Y++++F +KL I G+ ST LYFGYT I++ + F+ TGT+GF   F+FV KIYSV+KVD
Sbjct:   12 LSLTIVNSSFAFYLPGLAPVNFCKKSSTGDAEECQHEIQLFVNRLDSVESVLPYEYDAFDFCKDTNERRPTENLGQVLFGERIETSPYKFLFMNDLTCQKVCTKSYNTTSAVERLKLDFLKRGMDLNYQHHWIVDNMPVTWCYIVEGDQKICNPGFPIGCLVNQEGTPKDACVINADFNKKNTFYVFNHVDINIVYHSGDETTGM-AARLVGATLEPRSIMH---SDHEKPSCEGPPMEIPYEFNSNFKMTYTYSVTFTQNNAIRWASRWDYILVSMPHTNIQWFSISNSLVIVLFLSGMVAMIMLRTLHKDIARYNQLDQADWVKIPPGANITYEEAQEESGWKQVHGDVFRAPRMGMLLSVFLGQGTQIFTMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSSRLYKTFGGEKWKTNVLLTAFLCPGIVFVDFFLMNLILWTEGSSAAVPFGTLVAILALWFGISVPLTFVGAYFGFKKPGIEPPVRTNQIPRQIPQQSFFTKPVPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATVLLCYFHLCAEDYNWWWRSFLTSGFTAVYLFVYAVHYFFSKLQIIGAASTILYFGYTLIMVLIFFVFTGTIGFFACFFFVNKIYSVLKVD 666          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Zebrafish
Match: tm9sf4 (transmembrane 9 superfamily protein member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1575])

HSP 1 Score: 490.73 bits (1262), Expect = 1.253e-164
Identity = 274/648 (42.28%), Postives = 387/648 (59.72%), Query Frame = 3
Query:  117 FYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKK-GVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVS---CYKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVN--------KPNTYYLFNHITLTISVYSDDPPEQVKSG-RIVFVRVNIASVAYVKDKAQEKDLATAP------PMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            FY+PG+AP+ +      E+   K        L S ++ LPYEY    FC+P  +    ENLG++L G+RI ++ Y V   +    + +C +      +S ++SKL  L   I   Y  H I DNLPV +    Y N E  I           D + K  T  KD            + N +YL NH++  +  + +   +  +   R+V   V   SV     KA ++   T P      P  +  +++N   +T+SV ++ + + KW+SRWD  L TM    I WFSI+NSV++V FLSG+L+MI+++TL +DI  YN+ D  E+  EE GWK VHGDVFRPP+  M L   +GSG+Q+  M +I +F++  G LSP++RGA +T     ++  GLF G+ + RLY+ + G +WK     TA L P  VFGI FVLN  +W   SS AVPFTT+L LL MWF IS+PL ++G YFGF+K P   PVRTNQIPRQ+P Q  Y      ILM G+LPFG +FI+LFFI ++IW    YY+FG LFLVF+ILV++CS+ +I++ YF LCAEDYRWWWR+FL SG +A Y+  Y+I++F  KLDI     + LYFGYTA+++   +L+TGT+GF  ++ F+RKIY+ VK+D
Sbjct:   28 FYVPGVAPMNFHQNSPVEIKAVK--------LTSSRTQLPYEYYSLPFCKPENIVYKAENLGEVLRGDRIVNTLYTVFMNLDKKCEVLCKKPESPIKLSVEESKL--LAERIQEEYYIHLIADNLPVATRLELYPNKEEAI-----------DEEQKKDTL-KDVQFEHGYRLGFTENNKFYLHNHLSFILYFHKEKLEDAEEHNYRVVRFEVMPKSVKLEDIKADDRGTCTLPETVAPVPQEIDPSKENNILFTYSVHWQES-EVKWASRWDTYL-TMSDVQIHWFSIINSVVVVFFLSGILSMIIIRTLRKDIANYNREDDIEDTMEESGWKNVHGDVFRPPQYPMILSSLLGSGIQMFSMVLIVIFVAMLGMLSPSSRGALMTTACFLFMFMGLFGGYFAGRLYRTLKGHRWKKGAFCTATLYPAVVFGICFVLNCFIWGEHSSGAVPFTTMLALLCMWFGISLPLVYLGYYFGFRKQPYDNPVRTNQIPRQVPEQRWYMNKFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRTFLVSGGSAFYVLIYAIFYFVNKLDIVEFIPSLLYFGYTALMVLSFWLLTGTIGFYAAYVFIRKIYAAVKID 651          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Xenopus
Match: cnih2 (cornichon family AMPA receptor auxiliary protein 2 [Source:Xenbase;Acc:XB-GENE-952875])

HSP 1 Score: 746.503 bits (1926), Expect = 0.000e+0
Identity = 365/634 (57.57%), Postives = 470/634 (74.13%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCYQDPKSK-SSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             FYLPG+APV++C + +   +C+ +I ++VN+LDS +SVLPYEY+ FDFC+    + PTENLGQ+LFGERI+SSPY   F  +   K +C + Y+  V  +   L F+  GI LNY+HHWI+DN+PV  CY   E +  C  GFPIGC   P  +    C  ++  NK +T+YLFNH+ +TI+ +S +  E     R+V  R+   S    K  ++      A PM + +   +     Y++SV F  N   KW+SRWDY+L++MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D+ E+AQEEFGWKLVHGD+FRPP+ GM L VF+G G Q+ +MT ITLF++C GFLSPANRGA +TC +V +VL G  AG+ SARLYK   GEKWK+NVL+TA LCPG +F  FFV+NI+LW  GSSAA+PF T++ +LAMWF ISVPL F+GAYFGFK+ PI  PVRTN IPRQIP QS +T+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+IL+ITCSE T+LLCYFHLCAEDY WWWRSFLTSG TA+YLF Y++++F +KL I G+ ST LYFGYT I+  + FL TGT+GF   +WFV+KIYSVVKVD
Sbjct:   52 AFYLPGLAPVSFCTEGNSTDNCKSKIELFVNRLDSVESVLPYEYDAFDFCKDEKERRPTENLGQVLFGERIESSPYKFTFNKNQTCKTVCHKFYQPKV--NTHLLEFIKKGIQLNYQHHWIIDNMPVTWCYDVEEGQKFCSPGFPIGCAVAPDGRVKDACIINSEFNKKDTFYLFNHVDITITYHSGNG-ENWDGARLVAARLVPKSY---KHPSRNNLNCEAHPMEIPQELSSELEVIYSYSVTFRENNTIKWASRWDYILESMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQIDSSEDAQEEFGWKLVHGDIFRPPKKGMLLSVFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCSVVLWVLLGTPAGYVSARLYKTFGGEKWKTNVLMTALLCPGIIFADFFVMNIILWEKGSSAAIPFGTLVAILAMWFGISVPLTFLGAYFGFKERPIEHPVRTNHIPRQIPEQSFFTKPLPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSEATVLLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYAVHYFFSKLQITGTASTILYFGYTMIMFLIFFLFTGTIGFFACYWFVKKIYSVVKVD 679          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Xenopus
Match: TM9SF2 (transmembrane 9 superfamily member 2 [Source:NCBI gene;Acc:447968])

HSP 1 Score: 743.036 bits (1917), Expect = 0.000e+0
Identity = 365/635 (57.48%), Postives = 466/635 (73.39%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY--QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKE--NEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLD-TEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             FYLPG+APV++C +  E  +C+ EI ++VN+LDS +SVLPYEY  FDFC+    K P+ENLGQ+LFGERI+ SPY   F      + +C +TY     + KSKL FL   + LNY+HHWIVDN+PV  CY   + +  C  GFPIGCY  Q+   K + C  ++  ++ + YY+FNH+   I ++      + +  R+V  ++   S    K    ++   + PPM +K     D T  YT+SV F   K  +W+SRWDY+L++MP ++IQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D TE+AQEEFGWKLVHGD+FR PR GM L VF+GSG Q+++MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ ++R YK   GEKWK+NVLLTAFLCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL FVGAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   25 AFYLPGLAPVSFCEQGKETAECKSEIELFVNRLDSVESVLPYEYAAFDFCQNTGEKRPSENLGQVLFGERIEPSPYKFIFNKEVKCQLVCKKTYSSSNQESKSKLDFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITQNGHPKDA-CVINSEFHEKDAYYIFNHVD--IKMFYHVVENEGQGARLVAAKLEPKSF---KQTHVDQPDCSGPPMEIKNAFGGDVTVPYTYSVTFHEEKTIRWASRWDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKLVHGDIFRAPRKGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVASRFYKSFGGEKWKTNVLLTAFLCPGIVFADFFLMNLILWGEGSSAAIPFGTLVAILALWFCISVPLTFVGAYFGFKKHAIEHPVRTNQIPRQIPEQSFYTKPLPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLVYAVHYFFSKLQITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 653          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Xenopus
Match: TM9SF2 (transmembrane 9 superfamily member 2 [Source:NCBI gene;Acc:447968])

HSP 1 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 365/635 (57.48%), Postives = 466/635 (73.39%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY--QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKE--NEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLD-TEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             FYLPG+APV++C +  E  +C+ EI ++VN+LDS +SVLPYEY  FDFC+    K P+ENLGQ+LFGERI+ SPY   F      + +C +TY     + KSKL FL   + LNY+HHWIVDN+PV  CY   + +  C  GFPIGCY  Q+   K + C  ++  ++ + YY+FNH+   I ++      + +  R+V  ++   S    K    ++   + PPM +K     D T  YT+SV F   K  +W+SRWDY+L++MP ++IQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D TE+AQEEFGWKLVHGD+FR PR GM L VF+GSG Q+++MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ ++R YK   GEKWK+NVLLTAFLCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL FVGAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   72 AFYLPGLAPVSFCEQGKETAECKSEIELFVNRLDSVESVLPYEYAAFDFCQNTGEKRPSENLGQVLFGERIEPSPYKFIFNKEVKCQLVCKKTYSSSNQESKSKLDFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITQNGHPKDA-CVINSEFHEKDAYYIFNHVD--IKMFYHVVENEGQGARLVAAKLEPKSF---KQTHVDQPDCSGPPMEIKNAFGGDVTVPYTYSVTFHEEKTIRWASRWDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKLVHGDIFRAPRKGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVASRFYKSFGGEKWKTNVLLTAFLCPGIVFADFFLMNLILWGEGSSAAIPFGTLVAILALWFCISVPLTFVGAYFGFKKHAIEHPVRTNQIPRQIPEQSFYTKPLPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLVYAVHYFFSKLQITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 700          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Xenopus
Match: TM9SF2 (transmembrane 9 superfamily member 2 [Source:NCBI gene;Acc:447968])

HSP 1 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 365/635 (57.48%), Postives = 466/635 (73.39%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY--QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKE--NEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLD-TEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             FYLPG+APV++C +  E  +C+ EI ++VN+LDS +SVLPYEY  FDFC+    K P+ENLGQ+LFGERI+ SPY   F      + +C +TY     + KSKL FL   + LNY+HHWIVDN+PV  CY   + +  C  GFPIGCY  Q+   K + C  ++  ++ + YY+FNH+   I ++      + +  R+V  ++   S    K    ++   + PPM +K     D T  YT+SV F   K  +W+SRWDY+L++MP ++IQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D TE+AQEEFGWKLVHGD+FR PR GM L VF+GSG Q+++MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ ++R YK   GEKWK+NVLLTAFLCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL FVGAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   60 AFYLPGLAPVSFCEQGKETAECKSEIELFVNRLDSVESVLPYEYAAFDFCQNTGEKRPSENLGQVLFGERIEPSPYKFIFNKEVKCQLVCKKTYSSSNQESKSKLDFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITQNGHPKDA-CVINSEFHEKDAYYIFNHVD--IKMFYHVVENEGQGARLVAAKLEPKSF---KQTHVDQPDCSGPPMEIKNAFGGDVTVPYTYSVTFHEEKTIRWASRWDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKLVHGDIFRAPRKGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVASRFYKSFGGEKWKTNVLLTAFLCPGIVFADFFLMNLILWGEGSSAAIPFGTLVAILALWFCISVPLTFVGAYFGFKKHAIEHPVRTNQIPRQIPEQSFYTKPLPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLVYAVHYFFSKLQITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 688          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Xenopus
Match: TM9SF2 (transmembrane 9 superfamily member 2 [Source:NCBI gene;Acc:447968])

HSP 1 Score: 741.11 bits (1912), Expect = 0.000e+0
Identity = 365/635 (57.48%), Postives = 466/635 (73.39%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY--QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKE--NEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLD-TEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             FYLPG+APV++C +  E  +C+ EI ++VN+LDS +SVLPYEY  FDFC+    K P+ENLGQ+LFGERI+ SPY   F      + +C +TY     + KSKL FL   + LNY+HHWIVDN+PV  CY   + +  C  GFPIGCY  Q+   K + C  ++  ++ + YY+FNH+   I ++      + +  R+V  ++   S    K    ++   + PPM +K     D T  YT+SV F   K  +W+SRWDY+L++MP ++IQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D TE+AQEEFGWKLVHGD+FR PR GM L VF+GSG Q+++MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ ++R YK   GEKWK+NVLLTAFLCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL FVGAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   36 AFYLPGLAPVSFCEQGKETAECKSEIELFVNRLDSVESVLPYEYAAFDFCQNTGEKRPSENLGQVLFGERIEPSPYKFIFNKEVKCQLVCKKTYSSSNQESKSKLDFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITQNGHPKDA-CVINSEFHEKDAYYIFNHVD--IKMFYHVVENEGQGARLVAAKLEPKSF---KQTHVDQPDCSGPPMEIKNAFGGDVTVPYTYSVTFHEEKTIRWASRWDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKLVHGDIFRAPRKGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVASRFYKSFGGEKWKTNVLLTAFLCPGIVFADFFLMNLILWGEGSSAAIPFGTLVAILALWFCISVPLTFVGAYFGFKKHAIEHPVRTNQIPRQIPEQSFYTKPLPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLVYAVHYFFSKLQITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 664          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Mouse
Match: Tm9sf2 (transmembrane 9 superfamily member 2 [Source:MGI Symbol;Acc:MGI:1915309])

HSP 1 Score: 743.036 bits (1917), Expect = 0.000e+0
Identity = 363/634 (57.26%), Postives = 464/634 (73.19%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY-QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLD-TEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             FYLPG+APV +C ++    +C+ +I ++VN+LDS +SVLPYEY  FDFC+    K P+ENLGQ+LFGERI+ SPY   F      K +CT+TY    ++DK KL FL   + LNY+HHWIVDN+PV  CY+  +++  C  GFPIGCY  D       C   +  ++ +T+Y+FNH+   I +Y           R+V  ++   S    K    +K   + P M +        +  YT+S+ FE  K+ +W+SRWDY+L++MP ++IQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D TE+AQEEFGWKLVHGD+FRPPR GM L VF+GSG Q+++MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ +AR YK   GEKWK+NVLLT+FLCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL F+GAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y+I++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   35 AFYLPGLAPVNFCAEEKSN-ECKADIELFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKKETCKLVCTKTYNTEKAEDKQKLDFLKKSMLLNYQHHWIVDNMPVTWCYEVEDSQKFCNPGFPIGCYITDKGHAKDACVISSEFHERDTFYIFNHVD--IKIYYHVVETGSMGARLVAAKLEPKSF---KHTHIDKPDCSGPAMDISNKASGEIKIAYTYSISFEEEKNIRWASRWDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKLVHGDIFRPPRKGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVAARFYKSFGGEKWKTNVLLTSFLCPGIVFADFFIMNLILWGEGSSAAIPFGTLVAILALWFCISVPLTFIGAYFGFKKNAIEHPVRTNQIPRQIPEQSFYTKPLPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLIYAIHYFFSKLQITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 662          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Mouse
Match: Tm9sf2 (transmembrane 9 superfamily member 2 [Source:MGI Symbol;Acc:MGI:1915309])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 265/389 (68.12%), Postives = 325/389 (83.55%), Query Frame = 3
Query:  837 FETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLD-TEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            ++  K+ +W+SRWDY+L++MP ++IQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D TE+AQEEFGWKLVHGD+FRPPR GM L VF+GSG Q+++MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ +AR YK   GEKWK+NVLLT+FLCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL F+GAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y+I++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:  109 YKEEKNIRWASRWDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKLVHGDIFRPPRKGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVAARFYKSFGGEKWKTNVLLTSFLCPGIVFADFFIMNLILWGEGSSAAIPFGTLVAILALWFCISVPLTFIGAYFGFKKNAIEHPVRTNQIPRQIPEQSFYTKPLPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLIYAIHYFFSKLQITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 497          

HSP 2 Score: 101.293 bits (251), Expect = 5.611e-22
Identity = 43/77 (55.84%), Postives = 58/77 (75.32%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYN 344
             FYLPG+APV +C ++    +C+ +I ++VN+LDS +SVLPYEY  FDFC+    K P+ENLGQ+LFGERI+ SPY 
Sbjct:   35 AFYLPGLAPVNFCAEEKSN-ECKADIELFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYK 110          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Mouse
Match: Gm364 (predicted gene 364 [Source:MGI Symbol;Acc:MGI:2685210])

HSP 1 Score: 525.398 bits (1352), Expect = 7.697e-178
Identity = 271/653 (41.50%), Postives = 406/653 (62.17%), Query Frame = 3
Query:   57 LKI*MLLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYK-NGEAEICYNGFPIGCYQDPKSK-SSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEE-FGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            LK  +LL FL  +       F+ PG+ PVTYC +      C+  I VY +KL S  SV+ Y+Y+ FDFC+  L ++P+E LGQILFGE++ S PY   F      +++C ++Y      D +KL+FL  GI  +Y+HHWIVDN  ++ CY    E   C +GFPIGC+  P  +   +C  +   NK N+ YLFNH+ +TI+ Y  +    VK  +++  RV+  S  ++    ++      PPM + E +       YT+SVKFE +K T+WSS  DY L +  ++++QW  ++NS  +VLFL G++ ++LL+++ RDI ++N++         FGW+L+HG++FR P  GM L + +G G Q+ +MT ++LF++  GFL+PA++   V  G+V ++   + AG+ SA++YK   G  WK + LLT  L PG VF   F++N++LW  GS AA+ F T+  L A++F +S PL F+G YFG K+     PV   +     P ++ + ++  +I++G +LPFGCIF+QL +ILN IWS ++YY+F  L L+FLI +I+CSE T+LLCYF LCAED  WWWR+FLTS  T+ Y+F Y I++F  KL +    STF+YFGY  I++   FL TGT+GF + F+FV  IY V+K D
Sbjct:   28 LKWWLLLCFLATT----CDAFFFPGLVPVTYCEEGHPNSYCKSSIQVYADKLYSVDSVMFYDYDSFDFCQDSLKRTPSETLGQILFGEQVTSCPYKFSFNKDETCRKVCVKSYAPDNEDDMNKLAFLKKGIKQDYRHHWIVDNTGIIWCYDTENEEHHCMSGFPIGCFNAPSDQVKGSCLINPEFNKNNSLYLFNHLDITIT-YHIESDTTVKVAKLISSRVDPKSYKHLD---EDHLTCNEPPMEIPEEDTENLNVIYTYSVKFEESKATEWSSEGDYDLDSTAETSLQWIRLVNSFFVVLFLCGLVVILLLRSIWRDIAKFNRIKISVYDRRLFGWRLIHGNLFRLPEHGMLLSILLGQGTQVFIMTFLSLFLAGLGFLTPADQNVLVNYGVVLWLALEIPAGYMSAKMYKTFKGINWKMHFLLTTVLFPGIVFADIFIMNLILWMDGSPAAISFCTLASLFALYFGVSTPLTFLGVYFG-KREKFEFPVYAPKHEHGSPQRTFFPKSTITIILGSLLPFGCIFLQLSYILNRIWSPHMYYLFAFLLLLFLIFMISCSEVTVLLCYFRLCAEDRGWWWRAFLTSSFTSAYIFIYVIHYFFTKLQVTSIGSTFMYFGYAFILVLAFFLFTGTIGFFSCFFFVTTIYGVIKED 671          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Mouse
Match: Tm9sf4 (transmembrane 9 superfamily protein member 4 [Source:MGI Symbol;Acc:MGI:2139220])

HSP 1 Score: 496.123 bits (1276), Expect = 9.293e-167
Identity = 274/637 (43.01%), Postives = 384/637 (60.28%), Query Frame = 3
Query:  117 FYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKK-GVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPE-QVKSGRIVFVRVNIASVAYVKDKAQEKDLATAP------PMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            FY+PG+AP+ +   D  E+   K        L S ++ LPYEY    FC+P  +    ENLG++L G+RI ++P+ V        + +C ++ K   ++ ++S+L  +   I   Y  H I DNLPV +       E+  +       +  K               N  YL NH++  +  + +D  E Q  + R+V   V   S+     K  EK   T P      P  +   ++N   +T+SV +E + D KW+SRWD  L TM    I WFSI+NSV++V FLSG+L+MI+++TL +DI  YNK D  E+  EE GWKLVHGDVFRPP+  M L   +GSG+QL  M +I +F++  G LSP++RGA +T     ++  G+F GF++ RLY+ + G +WK     TA L PG VFGI FVLN  +W   SS AVPF T++ LL MWF IS+PL ++G YFGF+K P   PVRTNQIPRQIP Q  Y      ILM G+LPFG +FI+LFFI ++IW    YY+FG LFLVF+ILV++CS+ +I++ YF LCAEDYRWWWR+FL SG +A Y+  Y+I++F  KLDI     + LYFGYT +++   +L+TGT+GF  ++ FVRKIY+ VK+D
Sbjct:   24 FYVPGVAPINFHQNDPVEIKAVK--------LTSSRTQLPYEYYSLPFCQPIKITYKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLCNQSNKPITLTVEQSRL--VAERITEEYYVHLIADNLPVAT-----RLELYSSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKTGEKSSCTLPEGANSLPQEIDPTKENQLYFTYSVHWEES-DIKWASRWDTYL-TMSDVQIHWFSIINSVVVVFFLSGILSMIIIRTLRKDIANYNKEDDIEDTMEESGWKLVHGDVFRPPQYPMILSSLLGSGIQLFCMILIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGFSAGRLYRTLKGHRWKKGAFCTATLYPGVVFGICFVLNCFIWGKHSSGAVPFPTMVALLCMWFGISLPLVYLGYYFGFRKQPYDNPVRTNQIPRQIPEQRWYMNRFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRNFLVSGGSAFYVLVYAIFYFVNKLDIVEFIPSLLYFGYTTLMVLSFWLLTGTIGFYAAYMFVRKIYAAVKID 643          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Mouse
Match: Tm9sf1 (transmembrane 9 superfamily member 1 [Source:MGI Symbol;Acc:MGI:1921390])

HSP 1 Score: 256.144 bits (653), Expect = 2.341e-75
Identity = 189/620 (30.48%), Postives = 315/620 (50.81%), Query Frame = 3
Query:  189 IAVYVNKL---DSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKF-ETNKDTKWSSRWDYVLKTMPQS-NIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEA---------QEEFGWKLVHGDVFR-PPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKP-PISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            + +YVNK+    +PQ    Y Y +   C P  ++  + +LG++L G+R+  S Y + F  +   + +C       +    +++  L   I   Y   ++VD+LP+              GF +G  ++             +   +   L+ H+   +  + D         RI+F  V++  V     K    D        L+ +E     +T+SV++ ET+ + +   R        P++  I W SI+NS+++V  L G +A+IL++ L  D+ RYN LD E +         Q + GWK++H DVFR PP  G+ LC  +G G Q + +    + ++  G  +    GA  +  I+ Y L    +G+ S+  Y+ + GE+W  N++LT+ L     F  + V+N V WA+GS+ A+P TTIL LL +W L+  PL  +G  FG     P   P RT  I R+IP Q  Y   +  + +GG LPF  I ++L++I  ++W    Y ++G+LF VF IL+   +  +I L YF L  EDYRWWWRS L+ G T L++F YS++++  + ++ G+  T  +FGY+ +  ++ FL+ GT+ F +S  F+R IY  +K+D
Sbjct:   42 VILYVNKVGPYHNPQET--YHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCH------MQLSSAQVEQLRQAIEELYYFEFVVDDLPI-------------RGF-VGYMEE----------SGFLPHSHKIGLWTHLDFHLEFHGD---------RIIFANVSVRDV-----KPHSLDG-------LRSDELLGLTHTYSVRWSETSVEHRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYN-LDEETSSGGSSDDFDQGDNGWKIIHTDVFRFPPYRGL-LCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYRQIGGERWVWNIILTSSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAPCRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606          
BLAST of Transmembrane 9 superfamily member vs. UniProt/SwissProt
Match: sp|Q5R8Y6|TM9S2_PONAB (Transmembrane 9 superfamily member 2 OS=Pongo abelii OX=9601 GN=TM9SF2 PE=2 SV=1)

HSP 1 Score: 750.74 bits (1937), Expect = 0.000e+0
Identity = 367/636 (57.70%), Postives = 467/636 (73.43%), Query Frame = 3
Query:  108 SFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY-QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLD-TEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            S GFYLPG+APV +C ++ +  +C+ EI ++VN+LDS +SVLPYEY  FDFC+    K P+ENLGQ+LFGERI+ SPY   F      K +CT+TY    ++DK KL FL   + LNY+HHWIVDN+PV  CY   + +  C  GFPIGCY  D       C  ++  ++ +T+Y+FNH+   I +Y           R+V  ++   S    K    +K   + PPM +        +  YT+SV FE +K  +W+SRWDY+L++MP ++IQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D TE+AQEEFGWKLVHGD+FRPPR GM L VF+GSG Q+++MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ +AR YK   GEKWK+NVLLT+FLCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL F+GAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   33 SGGFYLPGLAPVNFCDEEKKSDECKAEIELFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKEETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITDKGHAKDACVINSEFHERDTFYIFNHVD--IKIYYHVVETGSMGARLVAAKLEPKSF---KHTHIDKPDCSGPPMDISNKASGEIKIAYTYSVSFEEDKKIRWASRWDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKLVHGDIFRPPRKGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVAARFYKSFGGEKWKTNVLLTSFLCPGIVFADFFIMNLILWGEGSSAAIPFGTLVAILALWFCISVPLTFIGAYFGFKKNAIEHPVRTNQIPRQIPEQSFYTKPLPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLIYAVHYFFSKLQITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 663          
BLAST of Transmembrane 9 superfamily member vs. UniProt/SwissProt
Match: sp|Q66HG5|TM9S2_RAT (Transmembrane 9 superfamily member 2 OS=Rattus norvegicus OX=10116 GN=Tm9sf2 PE=2 SV=1)

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 362/634 (57.10%), Postives = 464/634 (73.19%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYK-NGEAEICYNGFPIGCY-QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLD-TEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             FYLPG+APV +C ++ +  +C+ EI ++VN+LDS +SVLPYEY  FDFC+    K P+ENLGQ+LFGERI+ SPY   F      K +CT+TY    ++DK KL FL   + LNY+HHWIVDN+PV  CY+     + C  GFPIGCY  D       C   +  ++ +T+Y+FNH+ + I  +  +        R+V  ++   S  +      +K   + P M +        +  YT+S+ FE  K+ +W+SRWDY+L++MP ++IQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D TE+AQEEFGWKLVHGD+FRPPR GM L VF+GSG Q+++MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ +AR YK   GEKWK+NVLLT+FLCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL F+GAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y+I++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   35 AFYLPGLAPVNFCTEEKKSNECKAEIELFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKEETCKLVCTKTYHTEKAEDKQKLDFLKKSMLLNYQHHWIVDNMPVTWCYEVEDNQKFCNPGFPIGCYITDKGHAKDACVISSEFHERDTFYIFNHVDIKIQYHVVETGSM--GARLVAAKLEPKSFRHTH---IDKPDCSGPAMDISNKASGEIKIAYTYSISFEEEKNIRWASRWDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKLVHGDIFRPPRKGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVAARFYKSFGGEKWKTNVLLTSFLCPGIVFADFFIMNLILWGEGSSAAIPFGTLVAILALWFCISVPLTFIGAYFGFKKNAIEHPVRTNQIPRQIPEQSFYTKPLPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLVYAIHYFFSKLQITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 663          
BLAST of Transmembrane 9 superfamily member vs. UniProt/SwissProt
Match: sp|Q99805|TM9S2_HUMAN (Transmembrane 9 superfamily member 2 OS=Homo sapiens OX=9606 GN=TM9SF2 PE=1 SV=1)

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 365/636 (57.39%), Postives = 465/636 (73.11%), Query Frame = 3
Query:  108 SFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY-QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLD-TEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            S  FYLPG+APV +C ++ +  +C+ EI ++VN+LDS +SVLPYEY  FDFC+    K P+ENLGQ+LFGERI+ SPY   F      K +CT+TY    ++DK KL FL   + LNY+HHWIVDN+PV  CY   + +  C  GFPIGCY  D       C   ++ ++ +T+Y+FNH+   I +Y           R+V  ++   S    K    +K   + PPM +        +  YT+SV FE +   +W+SRWDY+L++MP ++IQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D TE+AQEEFGWKLVHGD+FRPPR GM L VF+GSG Q+++MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ +AR YK   GEKWK+NVLLT+FLCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL F+GAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   33 SGAFYLPGLAPVNFCDEEKKSDECKAEIELFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITDKGHAKDACVISSDFHERDTFYIFNHVD--IKIYYHVVETGSMGARLVAAKLEPKSF---KHTHIDKPDCSGPPMDISNKASGEIKIAYTYSVSFEEDDKIRWASRWDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKLVHGDIFRPPRKGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVAARFYKSFGGEKWKTNVLLTSFLCPGIVFADFFIMNLILWGEGSSAAIPFGTLVAILALWFCISVPLTFIGAYFGFKKNAIEHPVRTNQIPRQIPEQSFYTKPLPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLIYAVHYFFSKLQITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 663          
BLAST of Transmembrane 9 superfamily member vs. UniProt/SwissProt
Match: sp|P58021|TM9S2_MOUSE (Transmembrane 9 superfamily member 2 OS=Mus musculus OX=10090 GN=Tm9sf2 PE=1 SV=1)

HSP 1 Score: 743.036 bits (1917), Expect = 0.000e+0
Identity = 363/634 (57.26%), Postives = 464/634 (73.19%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY-QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLD-TEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             FYLPG+APV +C ++    +C+ +I ++VN+LDS +SVLPYEY  FDFC+    K P+ENLGQ+LFGERI+ SPY   F      K +CT+TY    ++DK KL FL   + LNY+HHWIVDN+PV  CY+  +++  C  GFPIGCY  D       C   +  ++ +T+Y+FNH+   I +Y           R+V  ++   S    K    +K   + P M +        +  YT+S+ FE  K+ +W+SRWDY+L++MP ++IQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D TE+AQEEFGWKLVHGD+FRPPR GM L VF+GSG Q+++MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ +AR YK   GEKWK+NVLLT+FLCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL F+GAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA+Y   Y+I++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   35 AFYLPGLAPVNFCAEEKSN-ECKADIELFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKKETCKLVCTKTYNTEKAEDKQKLDFLKKSMLLNYQHHWIVDNMPVTWCYEVEDSQKFCNPGFPIGCYITDKGHAKDACVISSEFHERDTFYIFNHVD--IKIYYHVVETGSMGARLVAAKLEPKSF---KHTHIDKPDCSGPAMDISNKASGEIKIAYTYSISFEEEKNIRWASRWDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKLVHGDIFRPPRKGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVAARFYKSFGGEKWKTNVLLTSFLCPGIVFADFFIMNLILWGEGSSAAIPFGTLVAILALWFCISVPLTFIGAYFGFKKNAIEHPVRTNQIPRQIPEQSFYTKPLPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLIYAIHYFFSKLQITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 662          
BLAST of Transmembrane 9 superfamily member vs. UniProt/SwissProt
Match: sp|Q8RWW1|TMN10_ARATH (Transmembrane 9 superfamily member 10 OS=Arabidopsis thaliana OX=3702 GN=TMN10 PE=2 SV=1)

HSP 1 Score: 530.791 bits (1366), Expect = 1.365e-179
Identity = 294/662 (44.41%), Postives = 407/662 (61.48%), Query Frame = 3
Query:   72 LLVFLTLSFFQIS---FGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE---ICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKA--QEKDLATAPPMILKE----------NEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            +L+F  + FF ++    GFYLPG+AP  + + D+        + V VNKL S ++ LPY Y    +C P  +    ENLG++L G+RI++SP    F       ++C    +  V  DK         IA  Y+ + I+DNLP+V   +  + +   +  +GF +G       K     K     K   Y++ NH+T T+  + D    Q  S RIV   V   SV +  +    ++  L T  P   +            E N   +T+ V F+ + + KW+SRWD  L  M    I WFSI+NS++IVLFLSGM+AMI+L+TL+RDI  YN+L++ EEA EE GWKLVHGDVFRPP     LCV+ G+GVQ   M ++T+  +C GFLSP+NRG  +T  ++ +V  GL AG+ S+RLYK + G +WK N L TAF+ P +VF  FFVLN ++W   SS AVPF T+  L+ +WF ISVPL F+G Y GF+KP    PV+TN+IPRQIP Q+ Y   I SIL+GG+LPFG +FI+LFFIL SIW    YY+FG LF+VF+IL+ITC+E T++LCYF LC+EDY+WWWRS+LTSG +A+YLF Y++++F+ KL+I    S  LYFGY  I+ ++ F+ TG +GF   FWF R IYS VK+D
Sbjct:    6 ILIFTLVLFFSLNVHIHGFYLPGVAPQDFQMGDA--------LMVKVNKLTSTKTQLPYSYYSLPYCRPEHIVDSAENLGEVLRGDRIENSP----FVFKMRESQMCAAVCR--VKLDKKTAKAFKEKIADEYRVNMILDNLPLVVPVQRPDQDNVVVYQHGFHVGL------KGIFAGK-----KEEKYFIHNHLTFTVRYHRDI---QTDSSRIVGFEVKPFSVKHEYEGQWNEKARLTTCDPHTKRAVTNSESPQEVEEGNEIIFTYDVDFQES-EVKWASRWDTYL-LMADDQIHWFSIVNSMMIVLFLSGMVAMIMLRTLYRDISNYNQLESHEEALEETGWKLVHGDVFRPPTNPELLCVYAGTGVQCFGMILVTMIFACLGFLSPSNRGGLMTAMLLLWVFMGLLAGYASSRLYKTLRGTEWKRNALKTAFMFPATVFVAFFVLNAIIWGQKSSGAVPFGTMFALVVLWFGISVPLVFIGGYIGFRKPAPEDPVKTNKIPRQIPTQAWYMNPIFSILIGGILPFGAVFIELFFILTSIWLHQFYYIFGFLFIVFIILIITCAEITVVLCYFQLCSEDYQWWWRSYLTSGSSAVYLFLYAVFYFYTKLEITKLVSAVLYFGYMLIVSYVFFVFTGAIGFYACFWFTRLIYSSVKID 637          
BLAST of Transmembrane 9 superfamily member vs. TrEMBL
Match: A0A096M0B5 (Transmembrane 9 superfamily member OS=Poecilia formosa OX=48698 PE=3 SV=1)

HSP 1 Score: 782.326 bits (2019), Expect = 0.000e+0
Identity = 383/645 (59.38%), Postives = 481/645 (74.57%), Query Frame = 3
Query:   75 LVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY--QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            LVFL + +F     FYLPG+APV++C K++EE  CQ ++ ++VN+LDS +SVLPYEY+ FDFC+    K P+ENLGQ+LFGERI+SSPY   F      K +CT+TYK     D  KL FL  G+ LNY+HHWI+DN+PV  CY   + +  C  GFPIGC    D ++K + C  ++  NK NT+Y+FNH+ + I+ Y    PE  +  R+V   +   S+  V +   + +      +  +  ED T  YT++V FE N   KW+SRWDY+L +MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D E+AQEE GWK VHGDVFRPPR GM L VF+G G Q+ +MT ITLF++C GFLSPANRGA +TC +V +VL G  AG+ SARLYK   GEKWK+NVLLTA LCPG VF  FF++N++LW  GSSAA+PF T++ +LAMWF ISVPL F+GAYFGFKKP I QPVRTNQIPRQIP QS +T+ IP I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+IL+ITCSE TILLCYFHLCAEDY WWWRSFLTSG TA+YLF Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   14 LVFLLVVYFSSCSAFYLPGLAPVSFCDKETEE--CQTQVELFVNRLDSVESVLPYEYDMFDFCKDDHEKRPSENLGQVLFGERIESSPYKFKFKEDVKCKRVCTKTYKTANKDDAPKLDFLKMGMQLNYQHHWIIDNMPVTWCYDVEDGQKYCNPGFPIGCLVTSDGRAKDA-CVINSEFNKKNTFYVFNHVDIKIT-YHKGEPEGWQGSRLVAATLEPKSIKQVDENDPKCESGNPMEVPAEFKEDVTIVYTYAVTFEENNTIKWASRWDYILVSMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQVDQEDAQEESGWKQVHGDVFRPPRKGMLLSVFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSARLYKTFGGEKWKTNVLLTALLCPGIVFADFFLMNLILWVEGSSAAIPFGTLVAILAMWFGISVPLTFIGAYFGFKKPAIEQPVRTNQIPRQIPEQSFFTKPIPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSEATILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYAVHYFFSKLQIIGAASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVNKIYSVVKVD 654          
BLAST of Transmembrane 9 superfamily member vs. TrEMBL
Match: A0A3P9P068 (Transmembrane 9 superfamily member OS=Poecilia reticulata OX=8081 PE=3 SV=1)

HSP 1 Score: 782.326 bits (2019), Expect = 0.000e+0
Identity = 387/646 (59.91%), Postives = 484/646 (74.92%), Query Frame = 3
Query:   75 LVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY--QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKE-NEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            LVFL + +F     FYLPG+APV++C K++EE  CQ ++ ++VN+LDS +SVLPYEY+ FDFC+    K P+ENLGQ+LFGERI+SSPY   F      K +CT+TYK     D  KL FL  G+ LNY+HHWI+DN+PV  CY   + +  C  GFPIGC    D ++K + C  ++  NK NT+Y+FNH+ + I+ Y    PE  +  R+V   +   S+  V D+ + K  +  P  +  E  ED T  YT++V FE N   KW+SRWDY+L +MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D E+AQEE GWK VHGDVFRPPR GM L VF+G G Q+ +MT ITLF++C GFLSPANRGA +TC +V +VL G  AG+ SARLYK   GEKWK+NVLLTA LCPG VF  FF++N++LW  GSSAA+PF T++ +LAMWF ISVPL F+GAYFGFKKP I QPVRTNQIPRQIP QS +T+ IP I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+IL+ITCSE TILLCYFHLCAEDY WWWRSFLTSG TA+YLF Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:    9 LVFLLVVYFSSCSAFYLPGLAPVSFCDKETEE--CQTQVELFVNRLDSVESVLPYEYDMFDFCKDDHEKRPSENLGQVLFGERIESSPYKFKFKEDVKCKRVCTKTYKTANKDDAPKLDFLKMGMQLNYQHHWIIDNMPVTWCYDVEDGQKYCNPGFPIGCLVTSDGRAKDA-CVINSEFNKKNTFYVFNHVDIKIT-YHKGEPEGWQGSRLVAATLEPKSIKQV-DENEPKCESGNPMEVPAEFKEDVTIVYTYAVTFEENNTIKWASRWDYILVSMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQVDQEDAQEESGWKQVHGDVFRPPRKGMLLSVFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSARLYKTFGGEKWKTNVLLTALLCPGIVFADFFLMNLILWVEGSSAAIPFGTLVAILAMWFGISVPLTFIGAYFGFKKPAIEQPVRTNQIPRQIPEQSFFTKPIPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSEATILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYAVHYFFSKLQIIGAASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVNKIYSVVKVD 649          
BLAST of Transmembrane 9 superfamily member vs. TrEMBL
Match: H2SS10 (Transmembrane 9 superfamily member OS=Takifugu rubripes OX=31033 GN=tm9sf2 PE=3 SV=2)

HSP 1 Score: 781.941 bits (2018), Expect = 0.000e+0
Identity = 384/642 (59.81%), Postives = 479/642 (74.61%), Query Frame = 3
Query:   90 LSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY--QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDN--TFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            +S+F     FYLPG+APV++C + S   DCQ EI ++VN+LDS +SVLPYEY+ FDFC+    + P+ENLGQ+LFGERI+SSPY   F   F  K++CT+TYKKG  QD +KL FL  G+ LNY+HHWI+DN+PV  CY   + +  C  GFPIGC    D ++K + C  ++  NK NT+Y+FNH+ + I+ Y     E  +  R+V   +   S+    +  Q       PPM +  + DN  +  YT+SV F  +   KW+SRWDY+L +MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D E+AQEE GWK VHGDVFRPPR GM L VF+G G Q+ +MT ITLF++C GFLSPANRGA +TC +V +VL G  AG+ SARLYK   GEKWK+NVLLTA LCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL FVGAYFGFKK  I QPVRTNQIPRQIP QS +T+ IP I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY WWWRSFLTSG TA+YLF Y +++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   16 VSYFHSCTAFYLPGLAPVSFCDESSAGEDCQSEIELFVNRLDSVESVLPYEYDVFDFCQDTKERRPSENLGQVLFGERIESSPYKFKFNEDFKCKKVCTKTYKKGARQDMAKLDFLKMGMQLNYQHHWIIDNMPVTWCYDVEDGQKYCNPGFPIGCLVTMDGRAKDA-CVINSEFNKKNTFYVFNHVDIKIT-YHSGAAEGWRGARLVAATLEPKSI----NTDQTNPTCEGPPMEVPVDFDNDVSILYTYSVTFSEDNSIKWASRWDYILVSMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQVDQEDAQEESGWKQVHGDVFRPPRKGMLLSVFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSARLYKTFGGEKWKTNVLLTALLCPGIVFADFFLMNLILWVEGSSAAIPFGTLVAILALWFGISVPLTFVGAYFGFKKAAIEQPVRTNQIPRQIPEQSFFTKPIPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYGVHYFFSKLQIVGAASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVNKIYSVVKVD 651          
BLAST of Transmembrane 9 superfamily member vs. TrEMBL
Match: A0A3B3WU19 (Transmembrane 9 superfamily member OS=Poecilia mexicana OX=48701 PE=3 SV=1)

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 383/645 (59.38%), Postives = 481/645 (74.57%), Query Frame = 3
Query:   75 LVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY--QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            LVFL + +F     FYLPG+APV++C K++EE  CQ ++ ++VN+LDS +SVLPYEY+ FDFC+    K P+ENLGQ+LFGERI+SSPY   F      K +CT+TYK     D  KL FL  G+ LNY+HHWI+DN+PV  CY   + +  C  GFPIGC    D ++K + C  ++  NK NT+Y+FNH+ + I+ Y    PE  +  R+V   +   S+  V +   + +      +  +  ED T  YT++V FE N   KW+SRWDY+L +MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D E+AQEE GWK VHGDVFRPPR GM L VF+G G Q+ +MT ITLF++C GFLSPANRGA +TC +V +VL G  AG+ SARLYK   GEKWK+NVLLTA LCPG VF  FF++N++LW  GSSAA+PF T++ +LAMWF ISVPL F+GAYFGFKKP I QPVRTNQIPRQIP QS +T+ IP I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+IL+ITCSE TILLCYFHLCAEDY WWWRSFLTSG TA+YLF Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:    9 LVFLLVVYFSSCSAFYLPGLAPVSFCDKETEE--CQTQVELFVNRLDSVESVLPYEYDMFDFCKDDHEKRPSENLGQVLFGERIESSPYKFKFKEDVKCKRVCTKTYKTANKDDAPKLDFLKMGMQLNYQHHWIIDNMPVTWCYDVEDGQKYCNPGFPIGCLVTSDGRAKDA-CVINSEFNKKNTFYVFNHVDIKIT-YHKGEPEGWQGSRLVAATLEPKSIKQVDENDPKCESGNPMEVPAEFKEDVTIVYTYAVTFEENNTIKWASRWDYILVSMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQVDQEDAQEESGWKQVHGDVFRPPRKGMLLSVFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSARLYKTFGGEKWKTNVLLTALLCPGIVFADFFLMNLILWVEGSSAAIPFGTLVAILAMWFGISVPLTFIGAYFGFKKPAIEQPVRTNQIPRQIPEQSFFTKPIPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSEATILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYAVHYFFSKLQIIGAASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVNKIYSVVKVD 649          
BLAST of Transmembrane 9 superfamily member vs. TrEMBL
Match: A0A3B3U3I7 (Transmembrane 9 superfamily member OS=Poecilia latipinna OX=48699 PE=3 SV=1)

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 383/645 (59.38%), Postives = 481/645 (74.57%), Query Frame = 3
Query:   75 LVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY--QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            LVFL + +F     FYLPG+APV++C K++EE  CQ ++ ++VN+LDS +SVLPYEY+ FDFC+    K P+ENLGQ+LFGERI+SSPY   F      K +CT+TYK     D  KL FL  G+ LNY+HHWI+DN+PV  CY   + +  C  GFPIGC    D ++K + C  ++  NK NT+Y+FNH+ + I+ Y    PE  +  R+V   +   S+  V +   + +      +  +  ED T  YT++V FE N   KW+SRWDY+L +MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D E+AQEE GWK VHGDVFRPPR GM L VF+G G Q+ +MT ITLF++C GFLSPANRGA +TC +V +VL G  AG+ SARLYK   GEKWK+NVLLTA LCPG VF  FF++N++LW  GSSAA+PF T++ +LAMWF ISVPL F+GAYFGFKKP I QPVRTNQIPRQIP QS +T+ IP I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+IL+ITCSE TILLCYFHLCAEDY WWWRSFLTSG TA+YLF Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:    9 LVFLLVVYFSSCSAFYLPGLAPVSFCDKETEE--CQTQVELFVNRLDSVESVLPYEYDMFDFCKDDHEKRPSENLGQVLFGERIESSPYKFKFKEDVKCKRVCTKTYKTANKDDAPKLDFLKMGMQLNYQHHWIIDNMPVTWCYDVEDGQKYCNPGFPIGCLVTSDGRAKDA-CVINSEFNKKNTFYVFNHVDIKIT-YHKGEPEGWQGSRLVAATLEPKSIKQVDENDPKCESGNPMEVPAEFKEDVTIVYTYAVTFEENNTIKWASRWDYILVSMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQVDQEDAQEESGWKQVHGDVFRPPRKGMLLSVFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSARLYKTFGGEKWKTNVLLTALLCPGIVFADFFLMNLILWVEGSSAAIPFGTLVAILAMWFGISVPLTFIGAYFGFKKPAIEQPVRTNQIPRQIPEQSFFTKPIPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSEATILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYAVHYFFSKLQIIGAASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVNKIYSVVKVD 649          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Cavefish
Match: tm9sf5 (transmembrane 9 superfamily member 2-like [Source:NCBI gene;Acc:103040173])

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 376/647 (58.11%), Postives = 482/647 (74.50%), Query Frame = 3
Query:   72 LLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCYQDPKSK-SSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            LLVF++++      GFYLPG+APV++C + SE  DCQ EI ++VN+LDS +SVLPYEY+ FDFC+    K P+ENLGQ+LFGERI++SPY   F      +++CT++Y     +DK+ L FL  G+ LNY+HHWIVDN+PV  CY   + +  C  GFPIGC    + +    C  ++  NK NT+Y+FNH+ +TI+ +S +  E  K  R+V  R++  S+ + ++ +Q  +    PPM +           Y++SVKFE     KW+SRWDY+L +MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLHRDI +YN++D EEAQEE GWK VHGDVFRPP+MGM L VF+G G Q+ +MT ITLF++C GFLSPANRGA +TC +V +VL G  AG+ SARLYK   GE WK+NVLLTA LCPG VF  FF++N++LW   SSAA+PF T++ +L +WF ISVPL F+GAYFGFKK  I  PVRTNQIPRQIP QS +T+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+IL+ITCSE TILLCYFHLCAEDY WWWRSFLTSG TA+YLF Y+I++F +KL I+G+ ST LY GYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   14 LLVFISVA------GFYLPGLAPVSFCEEKSE--DCQDEIQLFVNRLDSVESVLPYEYDMFDFCKDNEEKRPSENLGQVLFGERIETSPYKFKFRKDQPCQKVCTKSYDTSKVEDKTNLEFLKRGMQLNYQHHWIVDNMPVTWCYDVEDGQKYCNPGFPIGCLVTSEGRPKDACVINSEFNKKNTFYVFNHVDITITYHSGEN-ESWKGARLVGARLDPKSIKHSEENSQSCE---GPPMEIPGQFSGNLELTYSYSVKFEATDQIKWASRWDYILVSMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHRDIAKYNQVDQEEAQEESGWKQVHGDVFRPPQMGMLLSVFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSARLYKSFGGENWKTNVLLTALLCPGMVFADFFLMNLILWVEASSAAIPFGTLVAILGLWFGISVPLTFLGAYFGFKKSVIEHPVRTNQIPRQIPEQSFFTKPLPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSEATILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFVYAIHYFFSKLQIQGAASTILYLGYTMIMVLIFFLFTGTIGFFACFWFVHKIYSVVKVD 648          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Cavefish
Match: tm9sf5 (transmembrane 9 superfamily member 2-like [Source:NCBI gene;Acc:103040173])

HSP 1 Score: 757.673 bits (1955), Expect = 0.000e+0
Identity = 376/661 (56.88%), Postives = 482/661 (72.92%), Query Frame = 3
Query:   72 LLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCYQDPKSK-SSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT--------------EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            LLVF++++      GFYLPG+APV++C + SE  DCQ EI ++VN+LDS +SVLPYEY+ FDFC+    K P+ENLGQ+LFGERI++SPY   F      +++CT++Y     +DK+ L FL  G+ LNY+HHWIVDN+PV  CY   + +  C  GFPIGC    + +    C  ++  NK NT+Y+FNH+ +TI+ +S +  E  K  R+V  R++  S+ + ++ +Q  +    PPM +           Y++SVKFE     KW+SRWDY+L +MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLHRDI +YN++D               EEAQEE GWK VHGDVFRPP+MGM L VF+G G Q+ +MT ITLF++C GFLSPANRGA +TC +V +VL G  AG+ SARLYK   GE WK+NVLLTA LCPG VF  FF++N++LW   SSAA+PF T++ +L +WF ISVPL F+GAYFGFKK  I  PVRTNQIPRQIP QS +T+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+IL+ITCSE TILLCYFHLCAEDY WWWRSFLTSG TA+YLF Y+I++F +KL I+G+ ST LY GYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   14 LLVFISVA------GFYLPGLAPVSFCEEKSE--DCQDEIQLFVNRLDSVESVLPYEYDMFDFCKDNEEKRPSENLGQVLFGERIETSPYKFKFRKDQPCQKVCTKSYDTSKVEDKTNLEFLKRGMQLNYQHHWIVDNMPVTWCYDVEDGQKYCNPGFPIGCLVTSEGRPKDACVINSEFNKKNTFYVFNHVDITITYHSGEN-ESWKGARLVGARLDPKSIKHSEENSQSCE---GPPMEIPGQFSGNLELTYSYSVKFEATDQIKWASRWDYILVSMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHRDIAKYNQVDQGNLLKIHLQTAITYEEAQEESGWKQVHGDVFRPPQMGMLLSVFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSARLYKSFGGENWKTNVLLTALLCPGMVFADFFLMNLILWVEASSAAIPFGTLVAILGLWFGISVPLTFLGAYFGFKKSVIEHPVRTNQIPRQIPEQSFFTKPLPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSEATILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFVYAIHYFFSKLQIQGAASTILYLGYTMIMVLIFFLFTGTIGFFACFWFVHKIYSVVKVD 662          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Cavefish
Match: tm9sf2 (transmembrane 9 superfamily member 2 [Source:NCBI gene;Acc:103038134])

HSP 1 Score: 748.429 bits (1931), Expect = 0.000e+0
Identity = 372/638 (58.31%), Postives = 462/638 (72.41%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVD----CQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYK-NGEAEICYNGFPIGCYQDPKSK-SSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR--YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            GFYLPG+APV++C K +E  D    CQ +I ++VN+LDS +SVLPYEY  FDFC     K P+ENLGQ+LFGERI+ SPY   F      K +CTR Y    ++DK+ L FL  G+ LNY+HHWIVDN+PV  CY      + C  GFPIGCY     +    C  +++ N  +T+Y+FNH+ +TI  Y      +    R+V  ++   S    K +A +      PPM L        +  YT+SV+F   +  +W+SRWDY+L++MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D+ E+AQEEFGWKLVHGDVFRPPR GM L VF+GSG Q+ +MT +TLF +C GFLSPANRGA +TC +V +VL G  AG+ +AR YK   GEKWK+NVLLTAFLCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL F+GAYFGFKK  I  PVRTNQIPRQIP QS YT+ +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+ILVITCSE TILLCYFHLCAEDY W WRSFLTSG TA Y   Y+I++F +KL I G  ST LYFGYT I+  + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   27 GFYLPGLAPVSFCEKPAEGDDSGRECQDKIELFVNRLDSVESVLPYEYTAFDFCTVETEKRPSENLGQVLFGERIEPSPYKFSFKNKEECKHVCTRAYNTEKAEDKANLDFLKKGMLLNYQHHWIVDNMPVTWCYDVEDNQKFCNPGFPIGCYVTEAGRPKDACVVNSDFNDKDTFYIFNHVDITI--YYHVVEHEAAGARLVAAKMEPKSYKQAKPEAPD---CQGPPMSLSNKYKGEIKIPYTYSVQFVEEQKIRWASRWDYILESMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSVEDAQEEFGWKLVHGDVFRPPRKGMLLSVFLGSGTQIFIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVAARFYKSFGGEKWKTNVLLTAFLCPGVVFADFFLMNLILWGEGSSAAMPFGTLVAILALWFCISVPLTFIGAYFGFKKVGIEHPVRTNQIPRQIPEQSFYTKPLPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAAYFLVYAIHYFFSKLQITGLASTILYFGYTMIMALIFFLFTGTIGFFACFWFVTKIYSVVKVD 659          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Cavefish
Match: tm9sf4 (transmembrane 9 superfamily member 4 [Source:NCBI gene;Acc:103036276])

HSP 1 Score: 483.026 bits (1242), Expect = 1.080e-161
Identity = 274/661 (41.45%), Postives = 386/661 (58.40%), Query Frame = 3
Query:   78 VFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLS-----FLLNGIALNYKHHWIVDNLPVVSC---YKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVN----KPNTYYLFNHITLTISVYSDDPPEQVK-SGRIVFVRVNIASVAYVKDKAQEKDLATAP------PMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            V L LS   +   FY+PG+AP+ +   D  ++   K        L S ++ LPYEY    FC P  V    ENLG++L G+RI ++ Y +        + +C      G   + +KL+      +   I   Y  H I DNLPV +    Y N EA         G  ++ K        +          N +YL NH++  +  + +   +Q + + R+V   V   SV     K       T P      P  +   ++N+  +T+SV +E ++  KW+SRWD  L TM    I WFSI+NSV++V FLSG+L+MI+++TL +DI  YN+ D  E+  EE GWK VHGDVFRPP+  M L   +GSG+QL  M +I +F++  G LSP++RGA +T     ++  G+F G+ + RLY+ + G +WK     TA L P  VFGI FVLN  +W   SS AVPFTT+L LL MWF IS+PL ++G YFGF+K P   PVRTNQIPRQ+P Q  Y      ILM G+LPFG +FI+LFFI ++IW    YY+FG LFLVF+ILV++CS+ +I++ YF LCAEDYRWWWR+FL SG +A Y+  Y+I++F  KLDI     + LYFGYTA+++   +L+TGT+GF  ++ F+RKIY+ VK+D
Sbjct:   15 VLLMLSTLPLVKPFYVPGVAPMDFHQNDPVDIKAVK--------LTSSRTQLPYEYYSLPFCRPENVVYKAENLGEVLRGDRIVNTLYQMKMNQDKKCELVC------GKPDNPTKLTIVNSKLIAERIQEEYYIHLIADNLPVATRLEFYPNREA---------GTDEEKKDAMKDVQFEHGYRLGFTDNNKFYLHNHLSFILYYHKEKVEDQDEPTFRVVRFEVVPQSVKLEDLKPDGTGSCTLPDASGSAPQEIDPTKENSVLFTYSVHWEESQ-VKWASRWDTYL-TMSDVQIHWFSIVNSVVVVFFLSGILSMIIIRTLRKDIANYNREDDIEDTMEESGWKNVHGDVFRPPQYPMILSSLLGSGIQLFCMILIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGYFAGRLYRTLKGHRWKKGAFCTATLYPAVVFGICFVLNCFIWGEHSSGAVPFTTMLALLCMWFGISMPLVYLGYYFGFRKQPYDNPVRTNQIPRQVPEQRWYMNKFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRTFLVSGGSAFYVLVYAIFYFVNKLDIVEFIPSLLYFGYTALMVLSFWLLTGTIGFYAAYMFIRKIYAAVKID 650          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Cavefish
Match: tm9sf3 (transmembrane 9 superfamily member 3 [Source:NCBI gene;Acc:103034528])

HSP 1 Score: 236.498 bits (602), Expect = 2.845e-68
Identity = 171/529 (32.33%), Postives = 276/529 (52.17%), Query Frame = 3
Query:  483 NLPVVSCYKN--GEA----EICYNGFPIGCYQDPKSKSSTCSKDANVNKPNT--YYLFNHITLTISVYSDDPP------EQVKSGRIVFV-RVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWD-YVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-----EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFG--FKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            N   +S Y    GEA    E+ ++G  I  ++D   +++ C  D +  K +   Y + NH      +Y DD P      E  ++G   ++       + +  ++  + +L +   + L  N      Y  SVK++ + D K+  R+D Y+  +  Q  I WFSI NS ++V+FL G+++MIL++TL +D  RY+K +       +  +E+GWK VHGDVFRP    +     +GSG Q+  +++I + ++    L    RG+ ++  I  Y       G+    LY    G +W   + + AFL P  V G  F +N +     +S A+PF T++ +  + F + +PL  VG   G      P + P R N +PR IP +  +      + +GG+LPFG IFI+++FI  S W+  +YY++G + LV +IL I     TI+  YF L AEDYRW W SFL++  TA+Y++ YS Y++  K  + G   T  YFGY A+      ++ G VG++ +  FVRKIY+ VK+D
Sbjct:   67 NKKTISHYHETLGEALQGVELEFSGLDIK-FKDEVMQTTYCEIDLDKPKKDAFVYAIKNHYWY--QMYIDDLPIWGIVGEADENGEDHYLWTYKKLEIGFNGNRIVDVNLTSEGKVKLVPNTRIAMSY--SVKWKKS-DVKFEDRFDKYLDPSFFQHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKEEEMDDMDRDLGDEYGWKQVHGDVFRPSSHPLIFSSLIGSGCQIFSVSLIVIIVAMLEDLY-TERGSMLSTAIFVYAATSPVNGYFGGSLYAKQGGRRWIKQMFIGAFLIPAMVCGTAFFINFIAIYYHASRAIPFGTMVAVCCICFFVILPLNLVGTILGRNLSGQP-NFPCRVNAVPRPIPEKKWFMEPAVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID 587          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Sea Lamprey
Match: tm9sf2 (transmembrane 9 superfamily member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6302])

HSP 1 Score: 652.514 bits (1682), Expect = 0.000e+0
Identity = 323/571 (56.57%), Postives = 423/571 (74.08%), Query Frame = 3
Query:   69 MLLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEIC-TRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYK-NGEAEICYNGFPIGCYQDPK-SKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKE--NEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAE 1763
            +LL  +TLS F  S GFYLPG+APV++C ++S+   C   I ++VN+LDS +SVLPYEYN FDFC+    K P+ENLGQ+LFGERI+ SPY + F      +++C T+ Y    ++D+ KL FL   + LNY++HWI+DN+PV  CY+  G  + C  GFP+GC    +  +   C  +   NKPNTYY+FNH+ +TI  +S D  E  +  R+V  ++   S    K  A + D  ++ PM +     ED    YT+S+ F+ N + +W+SRWDY+L++MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLHRDI RYN+ ++ EE QEE+GWKLVHGDVFRPP+  M L VF+GSG Q+ +MT ITLF +C GFLSPANRGA +TC +V +VL GL AG+ +AR+YK + GE+WK++V+LTAFLCP  VF  FF +N++LWA GSSAA+PF T++ +LA+WF ISVPL F+GA+ GFKK  I  PVRTNQIPR+IP QSLYTR +P I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+IL+ITCSETTILLCYFHLCAE
Sbjct:   23 VLLAVVTLSGF--SAGFYLPGLAPVSFCPEESKSDTCPSVIELFVNRLDSVESVLPYEYNAFDFCQAEGKKRPSENLGQVLFGERIEPSPYAISFKAEKTCEKVCETKVYNVKSTEDQVKLDFLKRAMQLNYQNHWIIDNMPVTWCYEVEGAKKFCNPGFPVGCLVSAEGEQRDACVINEAFNKPNTYYIFNHVDITILYHSGDA-EHSQEARLVTAKLEPRSF---KHAAGKPDCTSSDPMDIPVAFKEDVKITYTYSITFQKNDNIRWASRWDYILESMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHRDIARYNQAESAEEVQEEYGWKLVHGDVFRPPKASMLLAVFLGSGTQIFIMTFITLFFACMGFLSPANRGALMTCAMVLWVLLGLPAGYVAARMYKSLGGERWKTSVILTAFLCPSLVFVDFFTMNLILWAEGSSAAIPFGTLVAILALWFCISVPLTFLGAFVGFKKEVIECPVRTNQIPREIPTQSLYTRPLPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSETTILLCYFHLCAE 587          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010631.1 (pep scaffold:Pmarinus_7.0:GL476557:59155:81836:-1 gene:ENSPMAG00000009621.1 transcript:ENSPMAT00000010631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 478.789 bits (1231), Expect = 6.341e-161
Identity = 267/642 (41.59%), Postives = 382/642 (59.50%), Query Frame = 3
Query:  117 FYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTR-TYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVS----CYKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMI------LKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAI--PSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            FY+PG+AP+ Y      E+   K        + S  + LPYEY    FC+P  +   TENLG++L G+RI ++PY V      + K +C        ++ ++SKL  +   I   Y  H I DNLPV +      K+G+AE              K +                YL NH+ L +S + +    + K   +V   V   S+ Y    A +K    +P +       +  +++N   +++SVK++ +   KW+SRWD  L TM    I WFSI+NSV++V FLSG+L+MI+++TL RDI  YN+ D  E+  EE GWKLVHGDVFRPP+  M L   +GSG+QL LM +I + ++  G LSP++RGA +T     ++  GLF G+ S RLY+ + G++WK     T  + P  VFG+ F+LN  +W   SS AVPF+T++ LL MWF IS+PL F+G YFGF+K     PVRTNQIPRQIP Q  Y        ILM G+LPFG +FI+LFFI ++IW    YY+FG LFLVF+ILVI+CS+ +I++ YF LCAEDYRWWWR+F+ SG +A Y+  Y++++F  KL+I     + LYFGYT ++I   +L+TGT+GF+ ++ F+RKIY+ VK+D
Sbjct:   24 FYVPGVAPMDYAKNQYVEIKAVK--------MTSSHTQLPYEYYSLPFCKPQKILYKTENLGEVLRGDRIVNTPYEVRMTEKKDCKVLCDMPNVPVKLTVEQSKL--IAERIKEEYYVHLIADNLPVATILSFAEKSGDAE--------------KPEQFEHGYRLGFMDRQKVYLHNHLNLILSYHKETEDAKYK---VVRFEVIPQSIKYEALNADDKGDCQSPAISGVEAQEIDPSKENNVLFSYSVKWKEST-VKWASRWDTYL-TMSDVQIHWFSIVNSVVVVFFLSGILSMIIIRTLRRDIANYNREDDIEDTMEESGWKLVHGDVFRPPQYPMLLSSLLGSGIQLFLMVLIVIIVAGLGMLSPSSRGALMTTSCFLFMFMGLFGGYFSGRLYRTLKGQRWKKGAFWTTTIYPAVVFGVCFILNFFIWGKHSSGAVPFSTMVALLCMWFGISMPLVFLGYYFGFRKKGYENPVRTNQIPRQIPEQRWYMNKFIGAVILMAGILPFGAVFIELFFIFSAIWENQFYYLFGFLFLVFVILVISCSQISIVMVYFQLCAEDYRWWWRTFIVSGGSAFYVLMYAVFYFFNKLEIVEFIPSLLYFGYTGLMIVTFWLLTGTIGFIAAYIFIRKIYAAVKID 636          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Sea Lamprey
Match: tm9sf3 (transmembrane 9 superfamily member 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2714])

HSP 1 Score: 251.136 bits (640), Expect = 5.680e-76
Identity = 156/434 (35.94%), Postives = 240/434 (55.30%), Query Frame = 3
Query:  726 SVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWD-YVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQE-----EFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGE-KWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFG--FKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             + Y  +K  + +L +   + L  N      Y  SVK++ + + K+ SR+D Y+  +  Q  I WFSI NS ++V+FL G+++MIL++TL +D  RY+K +  +  E     E+GWK VHGDVFRP    +     +GSG Q+  +++I + ++ FG L    RG+ ++  I  Y       G+    LY    G  KW   + ++AFL P  V G  F +N +     +S A+PF T++ +  + F + +PL  VG   G      P + P R N +PR IP +  +      + +GG+LPFG IFI+++FI  S W+  +YY++G + LV +IL I     TI+  YF L AEDYRW W SFL +  T+ Y++ YSIY+F  K  + G   T  YFGY A+      ++ G VG++ +  FVRKIY+ VK+D
Sbjct:   22 EIGYKDNKIVDVNLTSESKVKLVPNTKIPLSY--SVKWKKS-EVKFESRFDKYLDPSFFQHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKEEEIDDMERDLGDEYGWKQVHGDVFRPATNPVMFTALIGSGSQVFFVSLIVIVVAIFGDLY-TERGSMLSTAIFVYAATSPVNGYFGGSLYSRQGGRRKWIKQMFVSAFLIPAMVCGTAFFINFIAIYYHASRAIPFGTMVAVACICFFVILPLNLVGTILGRNLSGQP-NFPCRVNAVPRPIPEKKWFMEPAVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLAAASTSAYVYMYSIYYFFFKTKMYGFFQTSFYFGYMALFSLALGVMCGAVGYMGTSAFVRKIYTNVKID 450          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Sea Lamprey
Match: tm9sf1 (transmembrane 9 superfamily member 1 [Source:ZFIN;Acc:ZDB-GENE-040801-64])

HSP 1 Score: 97.4413 bits (241), Expect = 4.421e-22
Identity = 66/213 (30.99%), Postives = 107/213 (50.23%), Query Frame = 3
Query:  726 SVAYVKDKAQEKDLAT--APPMILKENEDNTF-RYTFSVKFETNKDTKWSSRWDYVLKT--MPQS-NIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEF-----GWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFL 1331
            +V Y  D+    +++T  A P  L E E      +T++VK++      +  R + +      P++  I W SI+NS+++V  L G + +IL++ L  D  RYN  D  EA E+F     GWK++H DVFR P+    LC  +G G Q + +T   L ++  G  +    GA  +  I+ Y      AG+ S+  Y+ + G  W  N++LT  L
Sbjct:  164 TVEYNGDQVIFANVSTRDAKPYSLDELEPGAVVTHTYTVKWQPTS-VPYERRGERLRDRSFFPKTLEIHWLSIINSMVLVFLLIGFVLIILMRVLKNDFARYNVGD--EAAEDFDQGDNGWKIIHADVFRFPQHRSLLCAVLGVGSQFLTLTTGILVMALMGMFNVHRHGAINSAAILLYAFTCCIAGYVSSGFYRRLQGTNWVWNIVLTTSL 373          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Yeast
Match: EMP70 (Protein with a role in cellular adhesion and filamentous growth; also endosome-to-vacuole sorting; similar to Tmn3p; member of Transmembrane Nine family of proteins with 9 transmembrane segments; EMP70 has a paralog, TMN2, that arose from the whole genome duplication [Source:SGD;Acc:S000004073])

HSP 1 Score: 381.333 bits (978), Expect = 5.213e-123
Identity = 254/681 (37.30%), Postives = 368/681 (54.04%), Query Frame = 3
Query:   69 MLLVFLTLSFFQISF--GFYLPGIAPVTYCVKD---------SEEVDCQKEIAVYVNKLDSPQSVL---PYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICY--NGFPIGCYQ---------DPKSKSSTCSKDANVNKPN------TY---YLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEA-QEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQ-PVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCT-ALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            M  V L L +F +S    FYLPG+AP TY   D         +  ++ Q +     N     ++ L    Y YN+F FC+P  V+   E+LG ++FG+RI    YN PF ++   ++ C    K  +  D +K  F+   I   +  +W++D LP      +G  +  +   GF +G  Q          PK  + T  KD  +   N      TY   Y  NH  + I  Y D         R+V V V   S+        E    T  P++L E  DN   +T+SVKF  +  T W++RWD  L     S IQWFS++N  ++V+ LS ++   LL+ L  D  RYN+L+ ++  QE+ GWKL HGDVFR P   +TL + VGSGVQL LM   ++F +  GFLSP++RG+  T   + Y LFG    + S  +YK  +G  WK+N++LT  L PG++  I   LN  L    SS  +P +T+  ++ +WFL S+PL F G+    K+    + P +TNQI RQIP+Q  Y + IP+ L+ G+ PFG I ++L+FI  S+W   ++YMFG LF  FL+L +T S  TIL+ Y  LC E+++W WR F+  G   ALY+F +SI F   K  + G T+  LY GY+++I  L  LVTG++GF++S  FVRKIYS +KVD
Sbjct:    5 MAHVQLLLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFLYSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRI----YNSPFQLNMLQEKECESLCKTVIPGDDAK--FINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTDIEATPKG-AETTDKDVELETRNDRNMVKTYELPYFANHFDIMIE-YHDRGEGNY---RVVGVIVEPVSIKRSSPGTCE---TTGSPLMLDEGNDNEVYFTYSVKFNESA-TSWATRWDKYLHVYDPS-IQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRSPSQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIGGAGCALYVFIHSILF--TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSSIKVD 667          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Yeast
Match: TMN2 (Protein with a role in cellular adhesion and filamentous growth; similar to Tmn3p; member of the evolutionarily conserved Transmembrane Nine family of proteins with nine membrane-spanning segments; TMN2 has a paralog, EMP70, that arose from the whole genome duplication [Source:SGD;Acc:S000002514])

HSP 1 Score: 367.081 bits (941), Expect = 1.386e-117
Identity = 240/682 (35.19%), Postives = 355/682 (52.05%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKL------------------DSPQSVLPYEY--NKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICY--NGFPIGCYQD----------PKSKSSTCSKDANVN-----------KPNTY------YLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTM-PQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTE-EAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQ-PVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGC-TALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            GF LPG++P TY   D        EI + VN+L                  D    +  Y+Y   +F FC P  V+   E+LG ++FG+RI    YN PF ++   ++ C    K  +    +K  F+   I   +  +W+VD LP      +   +  Y   GF +G + D          P +     S+ +N +           KPN        Y  NH  + +  +           R+V V VN  S+      A      T  P+IL E++DN   +T+SVKF    DT W++RWD  L    PQ  IQWFS++N  +IV+ LS ++   LL+ L  D+ RYN+L+ + E  E+ GWKL HGDVFR P   M L + VGSG+QL LM + ++F +  G +SP +RG+  T   V Y LFG    + S  +YK   G  WK+N++LT  L PG++F +  ++N  L  + SS  +P  ++  ++ +WFL+SVPL F G+    K+    + P +TNQI RQIPYQ  Y R   + L+ G+  FG I ++L+FI +S+W   ++YMFG L   FL+L +T S  TIL+ Y+ LC E++ W WRSF+  G   ++Y F +SI F   K  + G  +  LY GY+ II  L  +VTG +GF +S +F+RKIYS +KV+
Sbjct:   18 GFSLPGLSPTTYHSGD--------EIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRI----YNSPFQLNMLEEKECVALCKSTIPGKDAK--FINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELG-FTDVKQTVDGKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNY----RVVGVIVNPVSIERSSPGACS---TTGKPLILDEDKDNEVYFTYSVKF-VASDTVWATRWDKYLHIYDPQ--IQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRSFIIGGLGCSIYTFIHSILF--TKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Yeast
Match: TMN3 (Protein with a role in cellular adhesion and filamentous growth; similar to Emp70p and Tmn2p; member of Transmembrane Nine family with 9 transmembrane segments; localizes to Golgi; induced by 8-methoxypsoralen plus UVA irradiation [Source:SGD;Acc:S000000915])

HSP 1 Score: 171.785 bits (434), Expect = 1.996e-45
Identity = 176/665 (26.47%), Postives = 291/665 (43.76%), Query Frame = 3
Query:  189 IAVYVNKLDSPQSVLPYEYNKFDF-CEPPLVKSPTE-NLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDN-LPVVSCYKNGEAEICY--NGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILK-ENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQ-----WFSILNSVIIVLFLSGMLAMILLKTLHRD---------------IDRYNKLDTEEAQEEFGWKLVHGDVF---RPPRMGM-TLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVL--------------LTAFLCPGSVFGIF----FVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQ-------PVRTNQIPRQIPYQSLYTRAIPSILMG----GVLPFGCIFIQLFFILNSIW--STYVYYMFGXXXXXXXXXXXTCSETTILLCYF--HLCAEDY----RWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIY 1982
            + + VNK++S  + LPY Y    F C P + K P   +L +I+ G+R   S Y + FG     + +C R   K   Q   KL      +   Y   W++D+ LP  + + +      Y  +GFP+G + DP +  +              YL NH+ L I  ++ D  +    G  V+ R    SV+        K+      +I + ENE     +T+SV +    +  W+ RWDY L     S+ Q     W S+ NSV IVL +S +  +I ++ ++ D               I+  + LD ++   ++    V  D     RP   G+  L + V  GVQ +   I +L ISC        R + +T  I+F+VL    A F   RL  +   ++ K+N L              +   LC  S+ GI     F+LN ++WA  S++A+PF TI+  ++++F++ +PL   G        P+ Q          +N     +       +  P +  G    G+ P   I++++ ++  S+W   T  YY +G LFL  ++L +   E +I+  Y     C ED      W W+ F       +Y+  YS+Y+  A L+I G +S  +   Y+ I   +  L  G + +LT+ WF+ KIY
Sbjct:   63 LELIVNKVESDLTQLPYAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKL------VREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLG-FIDPDTDKT--------------YLHNHVMLVIRFHASDNDKNTIVGFEVYPR----SVSDYHCPGASKNYEQYEIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQFHWMSLANSVGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLD-DDKYGKYSVYTVAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAILFFVLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPGIVMVSTFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVA-NNIPLPQYWLSGITKDESNSDGNGLFVPKSRAKFNPLVYCGIYLCGIFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSGGVYMELYSLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Nematostella
Match: EDO38363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD51])

HSP 1 Score: 744.191 bits (1920), Expect = 0.000e+0
Identity = 371/636 (58.33%), Postives = 471/636 (74.06%), Query Frame = 3
Query:  114 GFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKS-PTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYK--NGEAEICYNGFPIGCYQDPKSKS-STCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVK--DKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             FYLPG+APV+YC    E+  C+ +I +YVN+LDS  SV+PYEY+ FDFC     KS P+ENLGQ++FGERI+ S YN+ F      + +CT+TY    ++D  KL FL +GIALNY++HWIVDN+PV  CY   + E + C  GFPIGC+     ++   C      +  +T+Y+FNH+ +TI+ +S    E +   R++  ++   S+ + K  D    +D+   P    K +      YT+SV +  N   KW+SRWDY+L +MP + IQWFSI+NS IIVLFLSGM+AMI+L+TLH+DI RYN++D+ E+AQEEFGWKLVHGDVFR PR GM L + +GSG Q+++MT +TL  +C GFLSPANRGA +TC +V +V  G  AG+ SARLYKM  GE+WK+NV+L++F  PG VFGIFF+LN+VLWA GSSAA+PFTT+L LLA+WF ISVPL F+GAY GFKK PI QPVRTNQIPRQIP QS+YTRA+P I+MGGVLPFGCIFIQLFFILNSIWS  +YYMFG LF+V  ILV+T +ETT+LLCYFHLCAEDY WWWRSFLT GCTA Y F Y I+FF+ KL I G+ ST LYFGYT I++WL FL TGTVGF + F+F+RKIYS+VKVD
Sbjct:   25 AFYLPGLAPVSYCESSKEQDGCKAQINLYVNRLDSVDSVIPYEYSSFDFCLAKDSKSSPSENLGQVVFGERIRPSAYNLSFKKEVKCETLCTKTYDTSKNEDNKKLDFLRSGIALNYQNHWIVDNMPVTWCYDVTDEERKYCSTGFPIGCFVTADGQARDACVTSTKFSTADTHYVFNHVDITITYHSGKGEEWI-GARLLSAKLVPRSLKHEKASDCGANQDVLGIPA---KLSSTLKITYTYSVTYVENNSLKWASRWDYILDSMPHTKIQWFSIMNSFIIVLFLSGMVAMIMLRTLHKDIARYNQMDSGEDAQEEFGWKLVHGDVFRSPRKGMLLSILLGSGTQILIMTFVTLVFACLGFLSPANRGALMTCSLVLFVCLGSPAGYVSARLYKMFGGERWKTNVILSSFFVPGFVFGIFFLLNLVLWAEGSSAAIPFTTLLALLALWFCISVPLTFLGAYLGFKKKPIEQPVRTNQIPRQIPEQSIYTRALPGIIMGGVLPFGCIFIQLFFILNSIWSHQIYYMFGFLFVVCAILVLTVTETTVLLCYFHLCAEDYHWWWRSFLTGGCTAFYFFLYCIHFFYTKLTISGTASTVLYFGYTLIMVWLFFLFTGTVGFFSCFFFIRKIYSIVKVD 656          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Nematostella
Match: EDO44589 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV70])

HSP 1 Score: 453.751 bits (1166), Expect = 4.620e-150
Identity = 274/705 (38.87%), Postives = 389/705 (55.18%), Query Frame = 3
Query:  108 SFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCY---KNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLD-TEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAA--------------------------------------VPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILN--------------------------------SIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             +GFYLPGIAP+ Y     +++D      V   K+ S ++ LPYEY    FC+P  ++   ENLG++L G+RI ++PY V      N  + C       +S D SK+  + + I   Y  H ++DNLPV + +   + G+A+   +G+ +G     K        + ++     Y+ +++IT  +  +   P    K      ++V  +S + + D     ++          N +N   YT+ V +E++ D  W+SRWD  L  M    I WF+I+NSV+IVLFLSG+LAMI+++TL RDI RYNK D  E+  EE GWKLVHGDVFRPP+    L  F+G+GVQ+  M +I L  +  G LSPA+RG+ V   I+ YV  G+FAG+ +ARLYK + G+ WK +  LTA L PG V  I F LN  +W   SS A                                      VPFTT+L LL +W  IS+PL F+G YFG++K P   PVRTNQIPRQ+P Q  Y   IPS LM G+LPFG +FI+LFFIL+                                +IW    YY+FG LFLVF+IL +  S+ ++++ YF LC+EDY WWWRSF  S   A+Y+F Y+I++F  KL+I G     +YFGYT I+++  +L+TGT+GF T++ FVR IY+ VK+D
Sbjct:   31 GYGFYLPGIAPIDY--TQGQKLD------VKAVKMTSVKTQLPYEYYTMPFCQPKNLEYKPENLGEVLRGDRIVNTPYEV----EMNVNKKCVVLCPMKISADMSKV--VADRIFKEYYIHMVLDNLPVATKFHMIETGQAQY-EHGYKLGYMIGDKK----VLLNNHLKLTLKYHTYDNITYRVVGFEVQPKSYAKDA----IKVEGSSCSLLNDHPAGLEI--------NPNNENEIYYTYEVHWESS-DIVWASRWDTYL-AMSDVQIHWFAIVNSVVIVLFLSGILAMIMIRTLRRDIARYNKEDDMEDTLEETGWKLVHGDVFRPPQKAWLLTAFIGTGVQIFSMVVIILVFAMLGMLSPASRGSMVQAIILLYVFMGMFAGYFAARLYKTLKGQNWKKSAFLTATLYPGFVSAICFFLNFFIWGKHSSGAFEAFFEAFFEVIFEAFCKAISRKLNINRKAMSWGYQRRVPFTTMLALLCLWVGISLPLIFLGYYFGYRKYPYEHPVRTNQIPRQVPEQMWYMNLIPSNLMAGILPFGAVFIELFFILSDMFFCGYCPNPSFLGCCQLAPLLTHLKCIAFLAIWENQFYYLFGFLFLVFVILAVCVSQISMVMVYFQLCSEDYHWWWRSFFMSSSCAIYVFFYAIFYFVTKLNIVGFIPALMYFGYTIIMVFTFWLLTGTIGFYTTYLFVRHIYAAVKID 702          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Nematostella
Match: EDO46262 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQA7])

HSP 1 Score: 244.973 bits (624), Expect = 1.439e-73
Identity = 145/409 (35.45%), Postives = 226/409 (55.26%), Query Frame = 3
Query:  816 RYTFSVKF-ETNKDTKWSSRWD---YVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTE---------EAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKP-PISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            ++T+SV + +TNK     S+ +   +  KT+    I W SI+NS ++V  L G + +IL++ L  D  RYN  D E         +   ++GWK++H DVFR P+    LC  +G G Q + +    +F++ FG  +    G+  T  ++ Y L    +GF S+  Y+ + G KW  N +LT  L     F I+ + N V W   S+ A+P+TTI+ L+ +W ++  PL  +G  FG         P RT  IPR+IP    Y      +L+GG LPF  I ++L++I  ++W    Y ++G+L +VF+IL+   +  +I L YF L +EDY WWWRS L+SG T LY+F YS++++  + ++ G   T  YFGYT +   + FL+ GTV F  S  F+R IY  +K+D
Sbjct:   26 KHTYSVTWKQTNKQYTQRSKKEGGRFFPKTL---EIHWLSIINSAVLVFLLLGFVIIILMRVLKNDFARYNMTDDEVEDLGSYVPKTNYDYGWKIIHTDVFRFPQQKSLLCAILGVGSQFLALCFGIIFMALFGMFNVHRHGSMNTAAVLLYALTCCISGFVSSSFYRKIGGTKWVWNNVLTTCLFSVPFFLIWSISNSVAWIYQSTQALPYTTIILLMFIWLIVGFPLTVIGGIFGKNSATSFDAPCRTKNIPREIPPVPWYRSVSVHMLVGGFLPFSAISVELYYIFATLWGREQYTLYGILLIVFIILLSVTACISIALTYFQLSSEDYHWWWRSVLSSGSTGLYVFCYSLFYYFKRSNMSGVLQTVQYFGYTLLACHVFFLMLGTVSFFASLMFIRYIYVNLKMD 431          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Nematostella
Match: EDO38637 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCC5])

HSP 1 Score: 228.794 bits (582), Expect = 4.965e-66
Identity = 150/424 (35.38%), Postives = 229/424 (54.01%), Query Frame = 3
Query:  753 QEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWD-YVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQE-----EFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFG--FKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            Q  D+       +K + +    +T+ VK++ +    +  R++ Y+  +  Q  I WFSI NS ++V+FL G+++MIL++TL +D  RY+K D  +  E     E+GWK VHGDVFRP    +  C  +G+G  L L+  + +  +  G L    RG+ ++  I  Y       GF    LY    G  W   +++ A L P  V G+ F++N +     +S A+PF T++ +  +   + +PL  VG   G      P + P R N +PR IP +  +      + +GGVLPFG IFI+++FI  S W+  +YY+FG + LVF IL+      TI+  YF L AEDYRW W SFL++  TA Y++ YS Y++  K  + G   T  YFGY  +      ++ GT+G+  S  FVRKIYS VK+D
Sbjct:  163 QIVDVNLTSESKVKLSPNAKIVFTYEVKWK-DSAVPFEKRYEKYLDPSFFQHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKDDELDDMERDLGDEYGWKQVHGDVFRPASHRLLFCSLIGTGYHLALVACVVILFTIMGDLY-TGRGSILSATIFVYAACAPANGFFGGALYSRQGGRMWIRQMVVGAVLFPSLVCGMAFLINFIAIYYHASRAIPFGTMVAVACIVIFVILPLNLVGTVLGRNLSGTP-NAPCRVNTVPRPIPEKKWFMEPAVIVCLGGVLPFGSIFIEMYFIFTSFWAYKIYYVFGFMLLVFFILITVTICVTIVCTYFLLNAEDYRWQWTSFLSAASTAGYVYMYSFYYYFFKTKMYGLFQTTFYFGYMGLFSIGLGILCGTLGYAGSSIFVRKIYSTVKID 583          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Medaka
Match: tm9sf5 (transmembrane 9 superfamily member 2 [Source:NCBI gene;Acc:101166562])

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 374/647 (57.81%), Postives = 482/647 (74.50%), Query Frame = 3
Query:   69 MLLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY--QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            +L + L +  F  S  FYLPG+APV++C ++ +  +CQ +I ++VN+LDS +SVLPYEY+ FDFC+      P+ENLGQ+LFGERI+SSPY   F        +CT+ YKK V +D +KL FL  G+ LNY+HHWI+DN+PV  CY   + +  C  GFPIGC    D ++K + C  ++  N+ NTYY+FNH+++ I+ +S +  E  K  R+V   +   S+    +K    +  +   + +  + D +  YT+SV F  +   KW+SRWDY+L +MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D E+AQEE GWK VHGDVFRPPR GM L +F+G G Q+ +MT ITLF++C GFLSPANRGA +TC +V +VL G  AG+ SARLYK   GEKWK+NVLLTA LCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL F+GAYFGFKKP I QPVRTNQIPRQIP QS +T+ IP I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+IL+ITCSE TILLCYFHLCAEDY WWWRSFLTSG TA+YLF Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   10 VLFILLVVYCFSCS-AFYLPGLAPVSFC-EEKDVPECQTQIQLFVNRLDSVESVLPYEYDVFDFCKDVKETRPSENLGQVLFGERIESSPYKFSFKKDVKCSAVCTKIYKKDVKEDVAKLDFLKMGMQLNYQHHWIIDNMPVTWCYDVEDGQKYCNPGFPIGCLVTADGRAKDA-CVINSKFNEKNTYYVFNHVSIKITYHSGES-EGWKGARLVGATLEPKSIKQTDEKNLNCEDGSPMEVPVVFDSDVSVLYTYSVTFTEDNSIKWASRWDYILVSMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQVDQEDAQEESGWKQVHGDVFRPPRKGMLLSIFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSARLYKTFGGEKWKTNVLLTALLCPGIVFADFFLMNLILWVEGSSAAIPFGTLVAILALWFGISVPLTFIGAYFGFKKPAIEQPVRTNQIPRQIPEQSFFTKPIPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSEATILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYAVHYFFSKLQIIGAASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVNKIYSVVKVD 652          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Medaka
Match: tm9sf5 (transmembrane 9 superfamily member 2 [Source:NCBI gene;Acc:101166562])

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 374/664 (56.33%), Postives = 482/664 (72.59%), Query Frame = 3
Query:   69 MLLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAE-ICYNGFPIGCY--QDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTE-----------------EAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            +L + L +  F  S  FYLPG+APV++C ++ +  +CQ +I ++VN+LDS +SVLPYEY+ FDFC+      P+ENLGQ+LFGERI+SSPY   F        +CT+ YKK V +D +KL FL  G+ LNY+HHWI+DN+PV  CY   + +  C  GFPIGC    D ++K + C  ++  N+ NTYY+FNH+++ I+ +S +  E  K  R+V   +   S+    +K    +  +   + +  + D +  YT+SV F  +   KW+SRWDY+L +MP +NIQWFSI+NS++IVLFLSGM+AMI+L+TLH+DI RYN++D E                 +AQEE GWK VHGDVFRPPR GM L +F+G G Q+ +MT ITLF++C GFLSPANRGA +TC +V +VL G  AG+ SARLYK   GEKWK+NVLLTA LCPG VF  FF++N++LW  GSSAA+PF T++ +LA+WF ISVPL F+GAYFGFKKP I QPVRTNQIPRQIP QS +T+ IP I+MGG+LPFGCIFIQLFFILNSIWS  +YYMFG LFLVF+IL+ITCSE TILLCYFHLCAEDY WWWRSFLTSG TA+YLF Y++++F +KL I G+ ST LYFGYT I++ + FL TGT+GF   FWFV KIYSVVKVD
Sbjct:   10 VLFILLVVYCFSCS-AFYLPGLAPVSFC-EEKDVPECQTQIQLFVNRLDSVESVLPYEYDVFDFCKDVKETRPSENLGQVLFGERIESSPYKFSFKKDVKCSAVCTKIYKKDVKEDVAKLDFLKMGMQLNYQHHWIIDNMPVTWCYDVEDGQKYCNPGFPIGCLVTADGRAKDA-CVINSKFNEKNTYYVFNHVSIKITYHSGES-EGWKGARLVGATLEPKSIKQTDEKNLNCEDGSPMEVPVVFDSDVSVLYTYSVTFTEDNSIKWASRWDYILVSMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQVDQENLIKVPSTRDKSSVTYEDAQEESGWKQVHGDVFRPPRKGMLLSIFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSARLYKTFGGEKWKTNVLLTALLCPGIVFADFFLMNLILWVEGSSAAIPFGTLVAILALWFGISVPLTFIGAYFGFKKPAIEQPVRTNQIPRQIPEQSFFTKPIPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSEATILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYAVHYFFSKLQIIGAASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVNKIYSVVKVD 669          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Medaka
Match: tm9sf4 (transmembrane 9 superfamily member 4 [Source:NCBI gene;Acc:101163659])

HSP 1 Score: 485.723 bits (1249), Expect = 6.265e-163
Identity = 276/648 (42.59%), Postives = 389/648 (60.03%), Query Frame = 3
Query:  117 FYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVS---CYKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKP--------NTYYLFNHITLTISVYSDDPPE-QVKSGRIVFVRVNIASVAY--VKDKAQEK-----DLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            FY+PG+AP  +   D E VD +        KL S ++ LPYEY    FC+P  V    ENLG++L G+RI ++ Y+V        + +C     K +S ++SKL  +   I   Y  H I DNLPV +    Y N EA               + +S    KD              N +YL NH++  +  + +   E +V + R+V   V   SV    +K  A EK     + + +  M +  N +N   +++SV +E + + KW+SRWD  L TM    I WFSI+NSV++V FLSG+L+MI+++TL +DI  YN+ D  E+  EE GWK VHGDVFRPP+  M L   +GSG+QL  M +I +F++  G LSP++RGA +T     ++  G+F G+ + RLY+ + G +W+     TA L PG VFGI F LN  +W   SS AVPFTT+L LL MWF IS+PL ++G YFGF+K P   PVRTNQIPRQ+P Q  Y      ILM G+LPFG +FI+LFFI ++IW    YY+FG LFLVF+ILV++CS+ +I++ YF LCAEDYRWWWR+F+ SG +A Y+  Y+I++F  KLDI     + LYFGYTA+++   +L+TGT+GF  ++ F+ KIY+ VK+D
Sbjct:   24 FYVPGVAPRDF--HDGEPVDIK------AVKLTSSRTQLPYEYYSLPFCKPDSVVYKGENLGEVLRGDRIVNTLYSVEMNKDKKCEVVCG---SKKLSLEESKL--VAERIQEEYYVHLIADNLPVATRLEFYPNREA-------------GGEEQSKDVVKDVQFEHGYRLGFVDNNKFYLHNHLSFILYFHREKQEEGEVHNYRVVRFEVVPQSVKAEDLKASATEKTCVLPEASDSHAMEIDPNVENEVLFSYSVHWEES-EVKWASRWDTYL-TMSDVQIHWFSIVNSVVVVFFLSGILSMIIIRTLRKDIANYNREDDIEDTMEESGWKNVHGDVFRPPQYPMILSSLLGSGIQLFCMFLIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGYFAGRLYRTLKGHRWRKGAFCTATLYPGVVFGISFFLNFFIWGEHSSGAVPFTTMLALLCMWFGISMPLVYLGYYFGFRKQPYDNPVRTNQIPRQVPEQRWYMNKFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRTFVVSGGSAFYVLIYAIFYFVNKLDIVEFIPSLLYFGYTAMMVISFWLLTGTIGFYAAYMFIGKIYAAVKID 643          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Medaka
Match: tm9sf3 (transmembrane 9 superfamily member 3 [Source:NCBI gene;Acc:101158880])

HSP 1 Score: 238.039 bits (606), Expect = 6.585e-69
Identity = 187/598 (31.27%), Postives = 288/598 (48.16%), Query Frame = 3
Query:  237 YEYNKFDFC--EPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWD-YVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDT-----EEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFG--FKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            Y+Y    FC      +    E LG+ L G  ++ S      G+   +KE   +T    V  DK+K    +  I  +Y +   +D+LP+      GEA+   NG                           +YL+ +  L I              RIV   VN+ S   VK               L  N      Y  SVK++ + D K+  R+D Y+  +  Q  I WFSI NS ++V+FL G+++MIL++TL +D  RY+K +       +  +E+GWK VHGDVFRP    +     +GSG Q+  +++I + ++    L    RG+ ++  I  Y       G+    LY    G +W   + + AF+ P  V G  F +N +     +S A+PF T++ +  + F + +PL  VG   G      P + P R N +PR IP +  +      + +GG+LPFG IFI+++FI  S W+  +YY++G + LV +IL I     TI+  YF L AEDYRW W SFL++  TA+Y++ YS Y++  K  + G   T  YFGY A+      ++ G VG++ +  FVRKIY+ VK+D
Sbjct:   57 YKYFSLPFCAGSKKTISHYHETLGEALQGVELEFS------GLDIKFKEEVMQTTYCEVELDKAKRDAFVYAIKNHYWYQMYIDDLPIWGIV--GEAD--ENG-------------------------EDHYLWTYKKLEIGF---------NGNRIV--DVNLTSEGKVK---------------LMPNTRIAMSY--SVKWKKS-DVKFEDRFDKYLDPSFFQHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKEEEMDDMDRDLGDEYGWKQVHGDVFRPSSHPLIFSSLIGSGCQIFSVSLIVIIVAMVEDLY-TERGSMLSTAIFVYAATSPVNGYFGGSLYAKQGGRRWIKQMFIGAFMIPAMVCGTAFFINFIAIYYHASRAIPFGTMVAVCCICFFVILPLNLVGTILGRNLSGQP-NFPCRVNAVPRPIPEKKWFMEPAVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTAFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID 588          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Medaka
Match: tm9sf4 (transmembrane 9 superfamily member 4 [Source:NCBI gene;Acc:101163659])

HSP 1 Score: 219.935 bits (559), Expect = 9.626e-67
Identity = 111/199 (55.78%), Postives = 149/199 (74.87%), Query Frame = 3
Query: 1404 VPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            VPFTT+L LL MWF IS+PL ++G YFGF+K P   PVRTNQIPRQ+P Q  Y      ILM G+LPFG +FI+LFFI ++IW    YY+FG LFLVF+ILV++CS+ +I++ YF LCAEDYRWWWR+F+ SG +A Y+  Y+I++F  KLDI     + LYFGYTA+++   +L+TGT+GF  ++ F+ KIY+ VK+D
Sbjct:    7 VPFTTMLALLCMWFGISMPLVYLGYYFGFRKQPYDNPVRTNQIPRQVPEQRWYMNKFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRTFVVSGGSAFYVLIYAIFYFVNKLDIVEFIPSLLYFGYTAMMVISFWLLTGTIGFYAAYMFIGKIYAAVKID 205          
BLAST of Transmembrane 9 superfamily member vs. Planmine SMEST
Match: SMESG000060705.1 (SMESG000060705.1)

HSP 1 Score: 1296.18 bits (3353), Expect = 0.000e+0
Identity = 643/644 (99.84%), Postives = 644/644 (100.00%), Query Frame = 3
Query:   69 MLLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            MLLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTY+LFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGLLFLVFLILVITCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD
Sbjct:    1 MLLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYFLFNHITLTISVYSDDPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNKLDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGLLFLVFLILVITCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 644          
BLAST of Transmembrane 9 superfamily member vs. Planmine SMEST
Match: SMESG000016907.1 (SMESG000016907.1)

HSP 1 Score: 266.159 bits (679), Expect = 1.469e-79
Identity = 174/464 (37.50%), Postives = 259/464 (55.82%), Query Frame = 3
Query:  654 SVYSDDPP------EQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKT-MPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNK---LDTEEAQ--EEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFG---FKKPPISQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
             +Y DD P      EQ K G        +  V Y K +  E +L     + LK   D   ++T+ V ++ + +  + +R+D  L T   Q  I WFSI NS ++V+FL G+++MIL++TL +D  RY +   +D+ E    +E+GWK VHGDVFRPP   +     +G+G  +I++TI+ + ++  G L    RG+ ++  I  Y +     GF S  LY  M+G  W   +L+ A + P  V G  F++N +     +S A+PF T+L + A+   + +PL  VG   G   F +P  + P R N +PR IP +  +   I   L+GG+LPFG IFI+++FI  S W+  +YY+FG  FLV LIL++  S  TI+  YF L AEDYRW W SF     TA Y++ YS+Y+F  K  + G   T  YFGY A+  +   L+ G +G+L+S  FVRKIYS VK+D
Sbjct:  120 QMYLDDLPVWGLVGEQSKEGDFYLYTHKLLKVGYNKKQIVEVNLENGNKVKLKP--DMKIQFTYEVVWKPS-NILFENRFDKYLDTNFFQHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYGRDEEMDSLEKDLGDEYGWKQVHGDVFRPPTSLVFFTSLIGTGGHIIVVTIVVIVMALIGHLY-TERGSLLSTSIFVYAVTSPVNGFFSGSLYSRMNGRNWIRQLLIGALMLPTLVCGTAFIINFIAIYYQASRAIPFLTMLAISAIIVFVVLPLNLVGTVIGRNTFGQP--NYPCRINAVPRPIPEKKWFMEPIFITLLGGILPFGSIFIEMYFIFTSFWAYKIYYVFGFTFLVVLILLVVTSCVTIVCTYFLLNAEDYRWQWTSFAAGASTAFYVYMYSVYYFFFKTKMYGFFQTTFYFGYMALFCFGLGLMCGAIGYLSSNVFVRKIYSYVKID 577          
BLAST of Transmembrane 9 superfamily member vs. Planmine SMEST
Match: SMESG000012184.1 (SMESG000012184.1)

HSP 1 Score: 236.113 bits (601), Expect = 3.104e-68
Identity = 187/638 (29.31%), Postives = 292/638 (45.77%), Query Frame = 3
Query:  156 KDSEEVDCQKEIAVYVNKLD---SPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICYNGFPIGCYQDPKSKSSTCSKDANV----NKPNTYYLFNHITLTISVYSDDPPEQVKSGRIVFV-RVN-IASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYN-KLDTE---EAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMM--------SGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPI--SQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGXXXXXXXXXXXTCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 2000
            K+ +     +E+ +YVNK+    +P     Y Y     C PP V   +  LG++L G+R+  S Y + F  +     +CT   K   + D  +L   +N I   Y   +++D++P+     N E               P +  +      N+    N+ N  Y   +I  T S   +  P Q K   I F   V+ I+S   VKD+ +          I+K N        F V  E                      I W SI NS+I+V  L   +  I+ + L RD  RYN + D+E   E Q+E GWK+VH DVFRPP   +  C  +G+G QL+ ++I  + ++     +  N G      ++ Y      AGF S RL+KM         S   W   V  T  L    +  ++ + N V    G++ A+P TTIL L+ +W +I  PL   G   G +      S   R   I R+IP    Y      +L+GG LPF  I I+L++I +++W    Y ++G+LF++F IL+I      I L YF L  EDYRWWW +   +GC+ L++F Y I+ +  +  + G   +  YF Y+ +I +  FL  G V F++S++F++ +Y  +K+D
Sbjct:   18 KEPKTFSTNEEVILYVNKVGPYYNPHET--YHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLK---ASDTKRL---INAIEDLYYFEFVIDDIPIRGFIGNLEESKLL----------PHTHKALLYTHHNIEIDYNQNNIIY--GNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKR---------IMKNN-------FFPVTLE----------------------IHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVLFIIFFILLIVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 597          
BLAST of Transmembrane 9 superfamily member vs. Planmine SMEST
Match: SMESG000013664.1 (SMESG000013664.1)

HSP 1 Score: 213.001 bits (541), Expect = 1.539e-61
Identity = 155/428 (36.21%), Postives = 225/428 (52.57%), Query Frame = 3
Query:   72 LLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPP--LVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICY-NGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPP---------EQVKSGRIVFVRVNIASVAYVKD---KAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNK-LDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKS 1307
            +L  LTLS  + S  FY+PG+ PV +   D  EV   K        L S ++ LPY Y    FC+P   LV   +ENLG+IL G+RI ++PY +          +C+      ++ D+S+       I  +Y  H ++DNLPV + Y  G A I Y +GF +G  ++ K                  ++ NH+   +  ++DD           E + SGR        +S+   KD   +        A    ++E ++N   +T+ V +    D KW SRWD  L  M    I WFSI+NS++I++FLSG+L MI+++TL +DI +YNK  D EEA EE GWKLVHGDVFRPP+    L   +GSGVQL  + +I +F++  G LSPA+RGA ++  I  Y   G+FAG+ S R+YK + G  WKS
Sbjct:    7 VLFLLTLSV-KFSHNFYIPGVFPVQFHAGDIVEVKAVK--------LTSLKTQLPYSYYSLKFCKPKDGLVYV-SENLGEILRGDRIVNTPYEIRMLEKKPCSTLCSPII---LNADESEA--FRKRILNSYSVHLLIDNLPVATRYSIG-AHIQYEHGFHLGFIRNEK-----------------VFINNHLKFILKYHTDDEINYNIVGFEIEPLSSGR--------SSMKIDKDGTCRVTAIHNGDAGYQQIEEKKENIIDFTYEVMW-IKSDIKWVSRWDTYL-AMSDGQIHWFSIINSIVIIIFLSGILTMIMIRTLRKDIAKYNKDEDMEEAFEESGWKLVHGDVFRPPKHPRFLTACIGSGVQLFCVVLIIIFVAMLGMLSPASRGALISATIFTYAFMGMFAGYYSGRIYKTLRGHLWKS 391          
BLAST of Transmembrane 9 superfamily member vs. Planmine SMEST
Match: SMESG000013664.1 (SMESG000013664.1)

HSP 1 Score: 213.772 bits (543), Expect = 2.247e-61
Identity = 156/433 (36.03%), Postives = 226/433 (52.19%), Query Frame = 3
Query:   72 LLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDSPQSVLPYEYNKFDFCEPP--LVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICY-NGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSDDPP---------EQVKSGRIVFVRVNIASVAYVKD---KAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYNK-LDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKWKSNVLLT 1322
            +L  LTLS  + S  FY+PG+ PV +   D  EV   K        L S ++ LPY Y    FC+P   LV   +ENLG+IL G+RI ++PY +          +C+      ++ D+S+       I  +Y  H ++DNLPV + Y  G A I Y +GF +G  ++ K                  ++ NH+   +  ++DD           E + SGR        +S+   KD   +        A    ++E ++N   +T+ V +    D KW SRWD  L  M    I WFSI+NS++I++FLSG+L MI+++TL +DI +YNK  D EEA EE GWKLVHGDVFRPP+    L   +GSGVQL  + +I +F++  G LSPA+RGA ++  I  Y   G+FAG+ S R+YK + G  WKS    T
Sbjct:    7 VLFLLTLSV-KFSHNFYIPGVFPVQFHAGDIVEVKAVK--------LTSLKTQLPYSYYSLKFCKPKDGLVYV-SENLGEILRGDRIVNTPYEIRMLEKKPCSTLCSPII---LNADESEA--FRKRILNSYSVHLLIDNLPVATRYSIG-AHIQYEHGFHLGFIRNEK-----------------VFINNHLKFILKYHTDDEINYNIVGFEIEPLSSGR--------SSMKIDKDGTCRVTAIHNGDAGYQQIEEKKENIIDFTYEVMW-IKSDIKWVSRWDTYL-AMSDGQIHWFSIINSIVIIIFLSGILTMIMIRTLRKDIAKYNKDEDMEEAFEESGWKLVHGDVFRPPKHPRFLTACIGSGVQLFCVVLIIIFVAMLGMLSPASRGALISATIFTYAFMGMFAGYYSGRIYKTLRGHLWKSTAFFT 396          
The following BLAST results are available for this feature:
BLAST of Transmembrane 9 superfamily member vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TM9SF20.000e+057.39transmembrane 9 superfamily member 2 [Source:HGNC ... [more]
TM9SF20.000e+057.39transmembrane 9 superfamily member 2 [Source:HGNC ... [more]
TM9SF42.159e-16943.17transmembrane 9 superfamily member 4 [Source:HGNC ... [more]
TM9SF45.266e-16943.17transmembrane 9 superfamily member 4 [Source:HGNC ... [more]
TM9SF17.451e-7430.48transmembrane 9 superfamily member 1 [Source:HGNC ... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tag-1230.000e+055.35Transmembrane 9 superfamily member [Source:UniPro... [more]
ZK858.65.015e-14138.73Transmembrane 9 superfamily member [Source:UniPro... [more]
ZK858.65.015e-14138.73Transmembrane 9 superfamily member [Source:UniPro... [more]
ZK858.66.084e-14138.75Transmembrane 9 superfamily member [Source:UniPro... [more]
ZK858.66.084e-14138.75Transmembrane 9 superfamily member [Source:UniPro... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TM9SF20.000e+059.06gene:FBgn0032880 transcript:FBtr0335149[more]
TM9SF20.000e+059.06gene:FBgn0032880 transcript:FBtr0081393[more]
TM9SF42.616e-16041.76gene:FBgn0028541 transcript:FBtr0080532[more]
TM9SF42.616e-16041.76gene:FBgn0028541 transcript:FBtr0343657[more]
TM9SF33.405e-6737.22gene:FBgn0035622 transcript:FBtr0077127[more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tm9sf50.000e+058.60transmembrane 9 superfamily protein member 5 [Sour... [more]
tm9sf20.000e+058.02transmembrane 9 superfamily member 2 [Source:ZFIN;... [more]
tm9sf20.000e+058.02transmembrane 9 superfamily member 2 [Source:ZFIN;... [more]
tm9sf50.000e+057.36transmembrane 9 superfamily protein member 5 [Sour... [more]
tm9sf41.253e-16442.28transmembrane 9 superfamily protein member 4 [Sour... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnih20.000e+057.57cornichon family AMPA receptor auxiliary protein 2... [more]
TM9SF20.000e+057.48transmembrane 9 superfamily member 2 [Source:NCBI ... [more]
TM9SF20.000e+057.48transmembrane 9 superfamily member 2 [Source:NCBI ... [more]
TM9SF20.000e+057.48transmembrane 9 superfamily member 2 [Source:NCBI ... [more]
TM9SF20.000e+057.48transmembrane 9 superfamily member 2 [Source:NCBI ... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tm9sf20.000e+057.26transmembrane 9 superfamily member 2 [Source:MGI S... [more]
Tm9sf25.611e-2268.12transmembrane 9 superfamily member 2 [Source:MGI S... [more]
Gm3647.697e-17841.50predicted gene 364 [Source:MGI Symbol;Acc:MGI:2685... [more]
Tm9sf49.293e-16743.01transmembrane 9 superfamily protein member 4 [Sour... [more]
Tm9sf12.341e-7530.48transmembrane 9 superfamily member 1 [Source:MGI S... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R8Y6|TM9S2_PONAB0.000e+057.70Transmembrane 9 superfamily member 2 OS=Pongo abel... [more]
sp|Q66HG5|TM9S2_RAT0.000e+057.10Transmembrane 9 superfamily member 2 OS=Rattus nor... [more]
sp|Q99805|TM9S2_HUMAN0.000e+057.39Transmembrane 9 superfamily member 2 OS=Homo sapie... [more]
sp|P58021|TM9S2_MOUSE0.000e+057.26Transmembrane 9 superfamily member 2 OS=Mus muscul... [more]
sp|Q8RWW1|TMN10_ARATH1.365e-17944.41Transmembrane 9 superfamily member 10 OS=Arabidops... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A096M0B50.000e+059.38Transmembrane 9 superfamily member OS=Poecilia for... [more]
A0A3P9P0680.000e+059.91Transmembrane 9 superfamily member OS=Poecilia ret... [more]
H2SS100.000e+059.81Transmembrane 9 superfamily member OS=Takifugu rub... [more]
A0A3B3WU190.000e+059.38Transmembrane 9 superfamily member OS=Poecilia mex... [more]
A0A3B3U3I70.000e+059.38Transmembrane 9 superfamily member OS=Poecilia lat... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tm9sf50.000e+058.11transmembrane 9 superfamily member 2-like [Source:... [more]
tm9sf50.000e+056.88transmembrane 9 superfamily member 2-like [Source:... [more]
tm9sf20.000e+058.31transmembrane 9 superfamily member 2 [Source:NCBI ... [more]
tm9sf41.080e-16141.45transmembrane 9 superfamily member 4 [Source:NCBI ... [more]
tm9sf32.845e-6832.33transmembrane 9 superfamily member 3 [Source:NCBI ... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tm9sf20.000e+056.57transmembrane 9 superfamily member 2 [Source:ZFIN;... [more]
ENSPMAT00000010631.16.341e-16141.59pep scaffold:Pmarinus_7.0:GL476557:59155:81836:-1 ... [more]
tm9sf35.680e-7635.94transmembrane 9 superfamily member 3 [Source:ZFIN;... [more]
tm9sf14.421e-2230.99transmembrane 9 superfamily member 1 [Source:ZFIN;... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
EMP705.213e-12337.30Protein with a role in cellular adhesion and filam... [more]
TMN21.386e-11735.19Protein with a role in cellular adhesion and filam... [more]
TMN31.996e-4526.47Protein with a role in cellular adhesion and filam... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO383630.000e+058.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445894.620e-15038.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462621.439e-7335.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386374.965e-6635.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tm9sf50.000e+057.81transmembrane 9 superfamily member 2 [Source:NCBI ... [more]
tm9sf50.000e+056.33transmembrane 9 superfamily member 2 [Source:NCBI ... [more]
tm9sf46.265e-16342.59transmembrane 9 superfamily member 4 [Source:NCBI ... [more]
tm9sf36.585e-6931.27transmembrane 9 superfamily member 3 [Source:NCBI ... [more]
tm9sf49.626e-6755.78transmembrane 9 superfamily member 4 [Source:NCBI ... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060705.10.000e+099.84SMESG000060705.1[more]
SMESG000016907.11.469e-7937.50SMESG000016907.1[more]
SMESG000012184.13.104e-6829.31SMESG000012184.1[more]
SMESG000013664.11.539e-6136.21SMESG000013664.1[more]
SMESG000013664.12.247e-6136.03SMESG000013664.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035549 ID=SMED30035549|Name=Transmembrane 9 superfamily member|organism=Schmidtea mediterranea sexual|type=transcript|length=2232bp
TCATTATTTAAACCATTCATTTAAATATTTAATTGACTTATTTTTTAAGT
AAATTTTTGAAAATATAAATGCTATTGGTATTTCTAACTCTTTCATTTTT
TCAAATTTCATTTGGGTTTTACTTACCAGGAATAGCACCTGTAACTTATT
GTGTGAAAGATTCGGAGGAAGTAGATTGTCAAAAAGAAATTGCCGTATAT
GTGAATAAATTAGATTCGCCTCAGTCTGTTTTGCCTTATGAATATAATAA
ATTTGACTTTTGTGAACCACCATTAGTAAAATCCCCTACAGAAAATTTAG
GTCAAATTTTGTTTGGCGAGCGTATACAAAGTTCTCCGTATAATGTTCCT
TTTGGCGTGAGTTTTAATTATAAAGAGATTTGCACAAGAACGTATAAGAA
AGGTGTATCTCAAGATAAAAGCAAATTAAGTTTCCTTCTAAACGGAATAG
CATTAAATTATAAGCATCATTGGATTGTAGATAATCTGCCAGTGGTATCA
TGTTATAAGAACGGTGAAGCTGAAATTTGTTACAACGGATTCCCAATCGG
ATGTTATCAAGACCCTAAATCCAAATCATCGACATGCTCAAAGGATGCAA
ACGTAAATAAACCGAATACCTATTATCTTTTCAATCATATCACTCTAACT
ATCAGCGTTTACAGCGATGATCCCCCAGAACAAGTCAAGTCTGGTAGAAT
CGTTTTCGTTCGGGTTAATATAGCCAGTGTAGCGTACGTCAAGGACAAAG
CTCAAGAGAAAGATCTTGCGACTGCTCCTCCAATGATCCTTAAAGAAAAT
GAGGACAATACCTTTAGATATACTTTTTCAGTTAAATTTGAGACTAACAA
AGATACCAAATGGTCATCGAGGTGGGACTATGTATTGAAAACGATGCCTC
AGAGTAACATTCAGTGGTTCTCTATTCTCAATTCGGTCATCATCGTATTG
TTTCTGTCAGGCATGTTGGCAATGATTCTGCTGAAAACTTTGCATCGAGA
CATTGATCGATATAACAAGCTGGATACGGAAGAAGCTCAGGAAGAATTCG
GATGGAAGCTGGTACATGGCGATGTATTCCGTCCGCCGAGAATGGGAATG
ACTCTTTGTGTATTCGTCGGCAGTGGTGTGCAATTGATTCTTATGACAAT
CATCACACTTTTCATCTCGTGTTTTGGATTCCTGAGCCCCGCCAACCGAG
GAGCATTTGTCACATGCGGTATTGTGTTCTACGTGCTGTTCGGCCTGTTT
GCGGGTTTCAATTCCGCGCGGCTCTACAAGATGATGAGTGGAGAGAAATG
GAAGAGTAATGTACTTTTGACCGCCTTTCTTTGTCCCGGAAGCGTTTTTG
GCATTTTTTTTGTTCTTAACATTGTTTTGTGGGCGAGCGGAAGTTCTGCA
GCCGTTCCATTCACCACCATCCTTGGGTTGCTGGCCATGTGGTTCCTTAT
CAGTGTTCCTCTCTGCTTTGTTGGGGCTTACTTCGGATTTAAAAAACCGC
CAATTTCTCAACCAGTTCGAACTAATCAAATTCCCAGACAAATTCCCTAT
CAATCCCTTTATACTAGAGCTATTCCCAGCATTTTGATGGGAGGAGTTTT
ACCATTCGGATGTATTTTTATCCAATTATTTTTCATCTTGAACAGTATTT
GGTCGACATATGTCTATTATATGTTTGGACTATTGTTCTTGGTTTTCTTA
ATTTTGGTCATCACATGCTCGGAAACAACCATTCTTCTCTGCTATTTCCA
TCTTTGTGCAGAGGATTACCGTTGGTGGTGGAGGTCATTCCTTACAAGTG
GTTGCACCGCACTCTATTTATTCGGTTATAGCATTTACTTTTTCCATGCT
AAACTCGATATCAAAGGATCAACATCAACGTTCCTATATTTTGGTTATAC
TGCCATCATCATTTGGCTGGCGTTCCTGGTTACAGGTACGGTTGGATTTC
TAACATCGTTCTGGTTTGTGAGGAAGATATACAGCGTTGTAAAAGTGGAT
TGAATAATGGCGCGACATAAATGAAATATTTAATCATATTAGTGTAATTT
ACGATATTGTTTGTTTTGCTTTTCAACAATTTTTTGTTCATCTTAAATAC
AATTAAGATAAATTAATAGTTTTATTTTGCTGCCAATTTATTTAGTTTTC
CTATTGTTATCTTACTGTTATATTTTACTAATTGTGTTATTGCATAATAA
TAACGAGAATGATTATTATATCAATTGCATGT
back to top

protein sequence of SMED30035549-orf-1

>SMED30035549-orf-1 ID=SMED30035549-orf-1|Name=SMED30035549-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=645bp
MLLVFLTLSFFQISFGFYLPGIAPVTYCVKDSEEVDCQKEIAVYVNKLDS
PQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFN
YKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGE
AEICYNGFPIGCYQDPKSKSSTCSKDANVNKPNTYYLFNHITLTISVYSD
DPPEQVKSGRIVFVRVNIASVAYVKDKAQEKDLATAPPMILKENEDNTFR
YTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGML
AMILLKTLHRDIDRYNKLDTEEAQEEFGWKLVHGDVFRPPRMGMTLCVFV
GSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSA
RLYKMMSGEKWKSNVLLTAFLCPGSVFGIFFVLNIVLWASGSSAAVPFTT
ILGLLAMWFLISVPLCFVGAYFGFKKPPISQPVRTNQIPRQIPYQSLYTR
AIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGLLFLVFLILVITC
SETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKG
STSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004240EMP70
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005768endosome
GO:0010008endosome membrane
GO:0016020membrane
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004240Nonaspanin (TM9SF)PFAMPF02990EMP70coord: 56..600
e-value: 6.6E-199
score: 661.9
IPR004240Nonaspanin (TM9SF)PANTHERPTHR10766TRANSMEMBRANE 9 SUPERFAMILY PROTEINcoord: 12..644
NoneNo IPR availablePANTHERPTHR10766:SF36TRANSMEMBRANE 9 SUPERFAMILY MEMBER 2coord: 12..644
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.888
NoneNo IPR availableTMHMMTMhelixcoord: 612..634
NoneNo IPR availableTMHMMTMhelixcoord: 283..305
NoneNo IPR availableTMHMMTMhelixcoord: 450..472
NoneNo IPR availableTMHMMTMhelixcoord: 378..400
NoneNo IPR availableTMHMMTMhelixcoord: 346..368
NoneNo IPR availableTMHMMTMhelixcoord: 501..523
NoneNo IPR availableTMHMMTMhelixcoord: 413..435
NoneNo IPR availableTMHMMTMhelixcoord: 570..592
NoneNo IPR availableTMHMMTMhelixcoord: 527..549