NPHS1-7

Overview
NameNPHS1-7
Smed IDSMED30035538
Length (bp)3431
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NPHS1-7 (SMED30035538) t-SNE clustered cells

Violin plots show distribution of expression levels for NPHS1-7 (SMED30035538) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035538

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30035538h1SMcG0008022 dd_Smed_v4_50143_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NPHS1-7 vs. Ensembl Human
Match: NPHS1 (NPHS1 adhesion molecule, nephrin [Source:HGNC Symbol;Acc:HGNC:7908])

HSP 1 Score: 76.2554 bits (186), Expect = 3.151e-13
Identity = 127/518 (24.52%), Postives = 203/518 (39.19%), Query Frame = 3
Query:  792 YLFISQVDWRLSVTAECLVYEKSNMIAFQRIPLVIHSLPSKVNIQLLGLKPENEI------GDVLSIECSSVGGFPVPNYEIYI-----------MREGKDFETFT-EKTIILTKE--DNNLLMKCRALQAGTHNFIESNVFMIHVFYPPDG--LEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEK---LLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSK-TGVTISDSFVLNILYNPSVKIF----PSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEI----ISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISW 2243
            +L I   D       EC V  +S M      P VI S+   V  +LL L PE         G    + C S    P P+  I +           + EG   + FT E T  +T    DN  L+ C A        I+++ F ++V +PP    +E   + E  +   + ++  C  + G NP AT+QW    KN +  S  + ++         +A+  SV+         G  ++C+A   N++  G ++    L V F P AI   I  ++S  EN+ + L+C    S P   L+W    + +   + T       M G +GG    S L      R    +   C +F    T  T   S +LN+ Y P+ K++    P   K++    V L C  I GNP+  +  Y     +SR  T ++     + +    +  S S  S + V        Q   T  +G+  S    L V+F P  ++         P + +N     +S    V +SW
Sbjct:   95 HLHIEACDLSDDAEYECQV-GRSEMGPELVSPRVILSI--LVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKAS-FTVNVLFPPGPPVIEWPGLDEGHVRAGQSLELPCVARGG-NPLATLQWL---KNGQPVSTAWGTEHT-------QAVARSVLVMTVRPEDHGAQLSCEA--HNSVSAGTQEHGITLQVTFPPSAI--IILGSASQTENKNVTLSCVSKSSRPRVLLRWWLGWRQLLPMEET------VMDGLHGGHISMSNLTFL-ARREDNGLTLTCEAFSEAFTKETFKKSLILNVKY-PAQKLWIEGPPEGQKLRAGTRVRLVCLAIGGNPEPSLMWYK----DSRTVTESRLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQ-LSASTQLAVQFPPTNVTILANASALRPGDALNLTCVSVSSNPPVNLSW 580          
BLAST of NPHS1-7 vs. Ensembl Human
Match: NPHS1 (NPHS1 adhesion molecule, nephrin [Source:HGNC Symbol;Acc:HGNC:7908])

HSP 1 Score: 75.8702 bits (185), Expect = 4.192e-13
Identity = 127/518 (24.52%), Postives = 203/518 (39.19%), Query Frame = 3
Query:  792 YLFISQVDWRLSVTAECLVYEKSNMIAFQRIPLVIHSLPSKVNIQLLGLKPENEI------GDVLSIECSSVGGFPVPNYEIYI-----------MREGKDFETFT-EKTIILTKE--DNNLLMKCRALQAGTHNFIESNVFMIHVFYPPDG--LEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEK---LLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSK-TGVTISDSFVLNILYNPSVKIF----PSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEI----ISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISW 2243
            +L I   D       EC V  +S M      P VI S+   V  +LL L PE         G    + C S    P P+  I +           + EG   + FT E T  +T    DN  L+ C A        I+++ F ++V +PP    +E   + E  +   + ++  C  + G NP AT+QW    KN +  S  + ++         +A+  SV+         G  ++C+A   N++  G ++    L V F P AI   I  ++S  EN+ + L+C    S P   L+W    + +   + T       M G +GG    S L      R    +   C +F    T  T   S +LN+ Y P+ K++    P   K++    V L C  I GNP+  +  Y     +SR  T ++     + +    +  S S  S + V        Q   T  +G+  S    L V+F P  ++         P + +N     +S    V +SW
Sbjct:   95 HLHIEACDLSDDAEYECQVG-RSEMGPELVSPRVILSI--LVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKAS-FTVNVLFPPGPPVIEWPGLDEGHVRAGQSLELPCVARGG-NPLATLQWL---KNGQPVSTAWGTEHT-------QAVARSVLVMTVRPEDHGAQLSCEA--HNSVSAGTQEHGITLQVTFPPSAI--IILGSASQTENKNVTLSCVSKSSRPRVLLRWWLGWRQLLPMEET------VMDGLHGGHISMSNLTFL-ARREDNGLTLTCEAFSEAFTKETFKKSLILNVKY-PAQKLWIEGPPEGQKLRAGTRVRLVCLAIGGNPEPSLMWYK----DSRTVTESRLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQ-LSASTQLAVQFPPTNVTILANASALRPGDALNLTCVSVSSNPPVNLSW 580          
BLAST of NPHS1-7 vs. Ensembl Human
Match: CD22 (CD22 molecule [Source:HGNC Symbol;Acc:HGNC:1643])

HSP 1 Score: 56.9954 bits (136), Expect = 2.328e-7
Identity = 60/232 (25.86%), Postives = 111/232 (47.84%), Query Frame = 3
Query: 1485 LNVIFSPDAIKITIKPNSSIMENQTIILTCSVSES---HPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLK-SELIVHE---TSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP--SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLST 2153
            LNV   P    I + P   I E+Q + LTC ++ S   +P+ +L+W  + +G+        ++  T+   +   +LK S    H     +   Q+ + K LS         +D+  LN+ + P   +K+ PS   ++E D V + C +   NP++     SW+          K+ ++ K+   N+ + ++ + VT   SGKY C +++  G G S E FL+V++ P+ ++T
Sbjct:  134 LNVSERPFPPHIQLPPE--IQESQEVTLTCLLNFSCYGYPI-QLQW--LLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLS---------NDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTT--VSWL----------KDGTSLKK--QNTFT-LNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYPPKKVTT 336          
BLAST of NPHS1-7 vs. Ensembl Human
Match: CD22 (CD22 molecule [Source:HGNC Symbol;Acc:HGNC:1643])

HSP 1 Score: 55.0694 bits (131), Expect = 9.232e-7
Identity = 63/260 (24.23%), Postives = 117/260 (45.00%), Query Frame = 3
Query: 1485 LNVIFSPDAIKITIKPNSSIMENQTIILTCSVSES---HPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTIS-DSFVLNILYNP--SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWF 2246
            LNV   P    I + P   I E+Q + LTC ++ S   +P+ +L+W+     +    VT+  SL   + F      +SEL    + + S + +          G  +S D+  LN+ + P   +K+ PS   ++E D V + C +   NP++     SW+          K+ ++ K+   N+ + ++ + VT   SGKY C +++  G G S E FL+V++ P   +        +    + F+   ++ P     +W+
Sbjct:  134 LNVSERPFPPHIQLPPE--IQESQEVTLTCLLNFSCYGYPI-QLQWLLEGVPMRQAAVTS-TSLTIKSVF-----TRSELKF--SPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTT--VSWL----------KDGTSLKK--QNTFT-LNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWY 367          
BLAST of NPHS1-7 vs. Ensembl Human
Match: CD22 (CD22 molecule [Source:HGNC Symbol;Acc:HGNC:1643])

HSP 1 Score: 54.6842 bits (130), Expect = 1.101e-6
Identity = 62/263 (23.57%), Postives = 118/263 (44.87%), Query Frame = 3
Query: 1485 LNVIFSPDAIKITIKPNSSIMENQTIILTCSVSES---HPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLK-SELIVHE---TSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP--SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWF 2246
            LNV   P    I + P   I E+Q + LTC ++ S   +P+ +L+W  + +G+        ++  T+   +   +LK S    H     +   Q+ + K LS         +D+  LN+ + P   +K+ PS   ++E D V + C +   NP++     SW+          K+ ++ K+   N+ + ++ + VT   SGKY C +++  G G S E FL+V++ P   +        +    + F+   ++ P     +W+
Sbjct:  134 LNVSERPFPPHIQLPPE--IQESQEVTLTCLLNFSCYGYPI-QLQW--LLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLS---------NDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTT--VSWL----------KDGTSLKK--QNTFT-LNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWY 367          
BLAST of NPHS1-7 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 51.2174 bits (121), Expect = 4.725e-6
Identity = 44/174 (25.29%), Postives = 85/174 (48.85%), Query Frame = 3
Query: 1404 ANKNQSGIIINCDAIYK-NNIIPGPEKLLNVIFSPDAIKITIKPN-SSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP-SVKIFPSSNKIKESDYVELRCNLIQGNP 1916
            +++N  G +I C+A  K  +I       L+V+F P    + I  N S++     + + CSV+  +P  ++ W   NK +      +H++L T +     +++K+ +     S++    EY+C + +S+TG     +  L + Y P SV++F  SN I+      ++C  +  NP
Sbjct:  198 SDRNDHGKVITCEAFQKETDIRITTNTTLDVLFPPSDPTVEILRNPSALRSGDNVTIACSVTGGNPPPDVFWYHENKRL-----QSHSTLDTRS-----KEIKN-IYSFIASQNDNMAEYECRANNSRTGNPKRKAMKLEVNYPPASVELFGESN-IRYGSSANIQCKSLPSNP 359          
BLAST of NPHS1-7 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 51.2174 bits (121), Expect = 4.755e-6
Identity = 44/174 (25.29%), Postives = 85/174 (48.85%), Query Frame = 3
Query: 1404 ANKNQSGIIINCDAIYK-NNIIPGPEKLLNVIFSPDAIKITIKPN-SSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP-SVKIFPSSNKIKESDYVELRCNLIQGNP 1916
            +++N  G +I C+A  K  +I       L+V+F P    + I  N S++     + + CSV+  +P  ++ W   NK +      +H++L T +     +++K+ +     S++    EY+C + +S+TG     +  L + Y P SV++F  SN I+      ++C  +  NP
Sbjct:  198 SDRNDHGKVITCEAFQKETDIRITTNTTLDVLFPPSDPTVEILRNPSALRSGDNVTIACSVTGGNPPPDVFWYHENKRL-----QSHSTLDTRS-----KEIKN-IYSFIASQNDNMAEYECRANNSRTGNPKRKAMKLEVNYPPASVELFGESN-IRYGSSANIQCKSLPSNP 359          
BLAST of NPHS1-7 vs. Ensembl Fly
Match: hbs (gene:FBgn0029082 transcript:FBtr0087413)

HSP 1 Score: 74.7146 bits (182), Expect = 4.196e-13
Identity = 127/559 (22.72%), Postives = 224/559 (40.07%), Query Frame = 3
Query:  843 LVYEKSNMIAFQ--RIPLVIHSLPSKVNIQLLGLKPENEIGDVLSIECS------------SVGGFPVPNYEIYIMREGKDFETFTEKTIILT--KEDNNLLMKCRALQAG-THNFIESNVFMIHVFYPPDGLEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGP---EKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESD---YVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKP-KKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIG 2447
            LV E  N++A    R  L +  L +  ++ L G   + ++GD + + C             S+ G P+ N   Y      D    +   I LT   +    +  C AL    T N + S+   ++V YPP    +    + +I+ +  I  +  + +G NPP T+QW      YKN  +              ++  +S +  + N + +  I  C    +N  I  P    K L V F P+ +KI++ P  +++      L C  S S+P +++ W K   GI  E +    +L    G +GG     E+ V+ T +    + Y C S +     ++ ++  L+ILY P  +   S+  +       +VEL   L  GNP  I   Y+W    ++       NS   + + +    ++   ++  D+G Y C   +  G     E  + VE+ P  ++   +    +  EP        ++P +   + W     ++D              D +T      R  SSF ENG   L I+ +  +D G + C + N+ G
Sbjct:  321 LVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGAN-QAKVGDSVQLSCVTAPSNPQARISWSINGRPLDN-STYKTTSSSDGGWVSSSNISLTIDSQSRTFIAVCHALNTELTQNVVGSHT--VNVLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGNPPPTLQW------YKNDKIINAPSKLV------DSKITSELSLLVNASDNNAIYKCKV--QNAAIDIPLFATKTLGVHFPPETVKISVVPK-NLVPGIRAKLICDSSSSNPPAKISWWK--DGIPVEGL----NLANRPGLWGGSVSTLEMYVNIT-QDLDGIVYTCQSHNEVLQRSVHETISLDILYPPKFETPQSTTFVGVEGAPFHVEL---LASGNPMVI--TYTW----TKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGVYICEALNSQGTALL-EIQVAVEYAP-TITAVSEGRSFVAGEPAVLACHIQARPLEAAHVRW-----SRDG------------YDLAT------RTISSF-ENGTALLQIASVERSDIGNFTCIVDNQRG 818          
BLAST of NPHS1-7 vs. Ensembl Fly
Match: hbs (gene:FBgn0029082 transcript:FBtr0087414)

HSP 1 Score: 74.3294 bits (181), Expect = 5.376e-13
Identity = 127/559 (22.72%), Postives = 224/559 (40.07%), Query Frame = 3
Query:  843 LVYEKSNMIAFQ--RIPLVIHSLPSKVNIQLLGLKPENEIGDVLSIECS------------SVGGFPVPNYEIYIMREGKDFETFTEKTIILT--KEDNNLLMKCRALQAG-THNFIESNVFMIHVFYPPDGLEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGP---EKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESD---YVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKP-KKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIG 2447
            LV E  N++A    R  L +  L +  ++ L G   + ++GD + + C             S+ G P+ N   Y      D    +   I LT   +    +  C AL    T N + S+   ++V YPP    +    + +I+ +  I  +  + +G NPP T+QW      YKN  +              ++  +S +  + N + +  I  C    +N  I  P    K L V F P+ +KI++ P  +++      L C  S S+P +++ W K   GI  E +    +L    G +GG     E+ V+ T +    + Y C S +     ++ ++  L+ILY P  +   S+  +       +VEL   L  GNP  I   Y+W    ++       NS   + + +    ++   ++  D+G Y C   +  G     E  + VE+ P  ++   +    +  EP        ++P +   + W     ++D              D +T      R  SSF ENG   L I+ +  +D G + C + N+ G
Sbjct:  321 LVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGAN-QAKVGDSVQLSCVTAPSNPQARISWSINGRPLDN-STYKTTSSSDGGWVSSSNISLTIDSQSRTFIAVCHALNTELTQNVVGSHT--VNVLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGNPPPTLQW------YKNDKIINAPSKLV------DSKITSELSLLVNASDNNAIYKCKV--QNAAIDIPLFATKTLGVHFPPETVKISVVPK-NLVPGIRAKLICDSSSSNPPAKISWWK--DGIPVEGL----NLANRPGLWGGSVSTLEMYVNIT-QDLDGIVYTCQSHNEVLQRSVHETISLDILYPPKFETPQSTTFVGVEGAPFHVEL---LASGNPMVI--TYTW----TKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGVYICEALNSQGTALL-EIQVAVEYAP-TITAVSEGRSFVAGEPAVLACHIQARPLEAAHVRW-----SRDG------------YDLAT------RTISSF-ENGTALLQIASVERSDIGNFTCIVDNQRG 818          
BLAST of NPHS1-7 vs. Ensembl Fly
Match: hbs (gene:FBgn0029082 transcript:FBtr0345419)

HSP 1 Score: 74.3294 bits (181), Expect = 5.376e-13
Identity = 127/559 (22.72%), Postives = 224/559 (40.07%), Query Frame = 3
Query:  843 LVYEKSNMIAFQ--RIPLVIHSLPSKVNIQLLGLKPENEIGDVLSIECS------------SVGGFPVPNYEIYIMREGKDFETFTEKTIILT--KEDNNLLMKCRALQAG-THNFIESNVFMIHVFYPPDGLEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGP---EKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESD---YVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKP-KKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIG 2447
            LV E  N++A    R  L +  L +  ++ L G   + ++GD + + C             S+ G P+ N   Y      D    +   I LT   +    +  C AL    T N + S+   ++V YPP    +    + +I+ +  I  +  + +G NPP T+QW      YKN  +              ++  +S +  + N + +  I  C    +N  I  P    K L V F P+ +KI++ P  +++      L C  S S+P +++ W K   GI  E +    +L    G +GG     E+ V+ T +    + Y C S +     ++ ++  L+ILY P  +   S+  +       +VEL   L  GNP  I   Y+W    ++       NS   + + +    ++   ++  D+G Y C   +  G     E  + VE+ P  ++   +    +  EP        ++P +   + W     ++D              D +T      R  SSF ENG   L I+ +  +D G + C + N+ G
Sbjct:  321 LVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGAN-QAKVGDSVQLSCVTAPSNPQARISWSINGRPLDN-STYKTTSSSDGGWVSSSNISLTIDSQSRTFIAVCHALNTELTQNVVGSHT--VNVLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGNPPPTLQW------YKNDKIINAPSKLV------DSKITSELSLLVNASDNNAIYKCKV--QNAAIDIPLFATKTLGVHFPPETVKISVVPK-NLVPGIRAKLICDSSSSNPPAKISWWK--DGIPVEGL----NLANRPGLWGGSVSTLEMYVNIT-QDLDGIVYTCQSHNEVLQRSVHETISLDILYPPKFETPQSTTFVGVEGAPFHVEL---LASGNPMVI--TYTW----TKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGVYICEALNSQGTALL-EIQVAVEYAP-TITAVSEGRSFVAGEPAVLACHIQARPLEAAHVRW-----SRDG------------YDLAT------RTISSF-ENGTALLQIASVERSDIGNFTCIVDNQRG 818          
BLAST of NPHS1-7 vs. Ensembl Fly
Match: side-VII (gene:FBgn0037736 transcript:FBtr0082170)

HSP 1 Score: 67.3958 bits (163), Expect = 7.509e-11
Identity = 98/407 (24.08%), Postives = 179/407 (43.98%), Query Frame = 3
Query:  957 GDVLSIECSSVGGFPVPNYEIYIMREGK----DFETFTEKTII--------LTKEDNNLLMKCRALQAGTHNFIESNVFMIHVFYPPDGLEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEKL-----LNVIFSPDA---IKITIKPNSSIMENQTIILTCSVSESHP-VSELKWVKINKGIFNEDVTAH-ASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSV-----KIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGK 2096
            GD++S++C  +GG+P P    Y  R+G     +        II        L +ED N  + CRAL       +E+ V +   F P   L ++++   + +   +   +    +GS PPA I W      ++N  +      +T +    +  T+S +    +K+ +G  ++C A   N+ +P  E L     L++ + P+A   +  ++ P S++ E   +   C V  +HP V  ++W        NE   +H  SL  +   +        L++   +R++    Y C+ F+++ G  IS  F LNILY P+      K++     I + +  ++ C  +  NP+ +   +SW F  S +S     N     I S + S +++  +T  D G   CL ++  GK
Sbjct:  161 GDIVSLKCQVIGGYPTPTISWY--RDGIEIPCELSHLAGGKIIECEITLPSLGREDLNSRLTCRALSHPRAPIVEAVVQIDMNFAP---LNIRLLGAHQPLSAGRRYDLLCQSAGSRPPAVITW------WQN-GIRLEKTTETTSSDGNQ--TTSTLSISLSKSDAGKYLSCKAY--NHAVPS-EPLEDGWKLDIQYVPEAYVRLGTSLDP-STLREGTDVYFDCLVM-AHPNVFRIEWR------HNEQPLSHNISLGVIISNH-------SLVLQGVTRATAG-NYSCVGFNAE-GEGISAPFALNILYAPTCAQNQKKVY----GIAKQEDAKVMCT-VDANPREV--EFSWTFNNSAESIDVATN---HIIRSGTTSIVTYTPITELDYGTLLCLASNKIGK 523          

HSP 2 Score: 55.0694 bits (131), Expect = 4.457e-7
Identity = 75/328 (22.87%), Postives = 130/328 (39.63%), Query Frame = 3
Query: 1485 LNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSF-HSKTGVTISDSFVLNILYNP------SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIG 2447
            +++ F+P  I++ +  +  +   +   L C  + S P + + W +   GI  E  T   S         G Q  S L +   S+S       C ++ H+     + D + L+I Y P         + PS+  ++E   V   C L+  +P        W   E   S     N +   IISN    +  Q VT   +G Y C+  +  G+G S  F L + + P      KKV     +E    +    + P++VE SW   +++ +S+ +  N            I+  G           + ++ + I E D+G  +C  SN+IG
Sbjct:  238 IDMNFAPLNIRL-LGAHQPLSAGRRYDLLCQSAGSRPPAVITWWQ--NGIRLEKTTETTSSD-------GNQTTSTLSI-SLSKSDAGKYLSCKAYNHAVPSEPLEDGWKLDIQYVPEAYVRLGTSLDPST--LREGTDVYFDC-LVMAHPNVF--RIEWRHNEQPLS----HNISLGVIISNH--SLVLQGVTRATAGNYSCVGFNAEGEGISAPFALNILYAPTCAQNQKKVYGIAKQEDAKVMCTVDANPREVEFSWTF-NNSAESIDVATNH-----------IIRSGT---------TSIVTYTPITELDYGTLLCLASNKIG 522          
BLAST of NPHS1-7 vs. Ensembl Fly
Match: side-VII (gene:FBgn0037736 transcript:FBtr0331695)

HSP 1 Score: 67.3958 bits (163), Expect = 7.509e-11
Identity = 98/407 (24.08%), Postives = 179/407 (43.98%), Query Frame = 3
Query:  957 GDVLSIECSSVGGFPVPNYEIYIMREGK----DFETFTEKTII--------LTKEDNNLLMKCRALQAGTHNFIESNVFMIHVFYPPDGLEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEKL-----LNVIFSPDA---IKITIKPNSSIMENQTIILTCSVSESHP-VSELKWVKINKGIFNEDVTAH-ASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSV-----KIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGK 2096
            GD++S++C  +GG+P P    Y  R+G     +        II        L +ED N  + CRAL       +E+ V +   F P   L ++++   + +   +   +    +GS PPA I W      ++N  +      +T +    +  T+S +    +K+ +G  ++C A   N+ +P  E L     L++ + P+A   +  ++ P S++ E   +   C V  +HP V  ++W        NE   +H  SL  +   +        L++   +R++    Y C+ F+++ G  IS  F LNILY P+      K++     I + +  ++ C  +  NP+ +   +SW F  S +S     N     I S + S +++  +T  D G   CL ++  GK
Sbjct:  161 GDIVSLKCQVIGGYPTPTISWY--RDGIEIPCELSHLAGGKIIECEITLPSLGREDLNSRLTCRALSHPRAPIVEAVVQIDMNFAP---LNIRLLGAHQPLSAGRRYDLLCQSAGSRPPAVITW------WQN-GIRLEKTTETTSSDGNQ--TTSTLSISLSKSDAGKYLSCKAY--NHAVPS-EPLEDGWKLDIQYVPEAYVRLGTSLDP-STLREGTDVYFDCLVM-AHPNVFRIEWR------HNEQPLSHNISLGVIISNH-------SLVLQGVTRATAG-NYSCVGFNAE-GEGISAPFALNILYAPTCAQNQKKVY----GIAKQEDAKVMCT-VDANPREV--EFSWTFNNSAESIDVATN---HIIRSGTTSIVTYTPITELDYGTLLCLASNKIGK 523          

HSP 2 Score: 55.0694 bits (131), Expect = 4.457e-7
Identity = 75/328 (22.87%), Postives = 130/328 (39.63%), Query Frame = 3
Query: 1485 LNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSF-HSKTGVTISDSFVLNILYNP------SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIG 2447
            +++ F+P  I++ +  +  +   +   L C  + S P + + W +   GI  E  T   S         G Q  S L +   S+S       C ++ H+     + D + L+I Y P         + PS+  ++E   V   C L+  +P        W   E   S     N +   IISN    +  Q VT   +G Y C+  +  G+G S  F L + + P      KKV     +E    +    + P++VE SW   +++ +S+ +  N            I+  G           + ++ + I E D+G  +C  SN+IG
Sbjct:  238 IDMNFAPLNIRL-LGAHQPLSAGRRYDLLCQSAGSRPPAVITWWQ--NGIRLEKTTETTSSD-------GNQTTSTLSI-SLSKSDAGKYLSCKAYNHAVPSEPLEDGWKLDIQYVPEAYVRLGTSLDPST--LREGTDVYFDC-LVMAHPNVF--RIEWRHNEQPLS----HNISLGVIISNH--SLVLQGVTRATAGNYSCVGFNAEGEGISAPFALNILYAPTCAQNQKKVYGIAKQEDAKVMCTVDANPREVEFSWTF-NNSAESIDVATNH-----------IIRSGT---------TSIVTYTPITELDYGTLLCLASNKIG 522          
BLAST of NPHS1-7 vs. Ensembl Zebrafish
Match: si:ch211-152f2.2 (si:ch211-152f2.2 [Source:ZFIN;Acc:ZDB-GENE-121214-75])

HSP 1 Score: 62.7734 bits (151), Expect = 1.585e-9
Identity = 87/334 (26.05%), Postives = 129/334 (38.62%), Query Frame = 3
Query: 1473 PEKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNV-EYKCLSFHSKTGVTISDSFVLNILYNP---SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLS-TFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYS 2459
            PE  LNV + P +I ++I  ++ IM   ++ L+CS S+S+P +E+ W                       F G + L S  I      SS +  EYKC +  ++ GV  SD   L++ Y P   SV I  S+  I   D V L C+     P  I    SW         F  E S     I       S   ++  DSG+Y C  ++  G+ +S    L+V++ PR  S +       +  + +       S P  +  SW+     K   S                 V  GR +           SIS+I   D G Y C+  N+ G  YS
Sbjct:  212 PEVYLNVTYPPKSILVSISGSAVIMSGDSVTLSCS-SDSNPPAEISW-----------------------FKGKKYLNSGRIFRIPKISSDDSGEYKCRA-RNEHGVKYSDPVTLDVQYPPRNISVSISGSA-VIMSGDSVTLNCSSDSNPPAEI----SW---------FKGETSVGSGRI------FSISKISSDDSGEYNCSASNKHGEKYSDPVTLDVQYPPRRASVSINPSAVIMSGDSVTLSCSSDSNPPALNFSWY-----KGDTS-----------------VGSGRLY-----------SISKISSGDSGEYKCRARNDHGEKYS 467          

HSP 2 Score: 57.7658 bits (138), Expect = 6.048e-8
Identity = 92/378 (24.34%), Postives = 145/378 (38.36%), Query Frame = 3
Query: 1038 KDFETFTEKTIILTKEDNNLLMKCRALQAGT-------HNFIESNVFMIHVFYPPDGLEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP---SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPR 2141
            ++  T TE++  L      LL   R   AG        H      V++ +V YPP  + + I     I+    +   C   S SNPPA I W F  K Y N S       K  +   GE    +       +N+ G+       Y + +       L+V + P  I ++I  ++ IM   ++ L CS S+S+P +E+ W K    + +                        +       S  + EY C S  +K G   SD   L++ Y P   SV I PS+  I   D V L C+     P     N+SW   ++              + S  L  IS   ++  DSG+Y+C   +  G+ +S    L +++  R
Sbjct:  175 RNSHTLTERSSEL------LLQSVRRQDAGRYRCAVDGHTLTSPEVYL-NVTYPPKSILVSISGSAVIMSGDSVTLSC--SSDSNPPAEISW-FKGKKYLN-SGRIFRIPKISSDDSGEYKCRA-------RNEHGVK------YSDPVT------LDVQYPPRNISVSISGSAVIMSGDSVTLNCS-SDSNPPAEISWFKGETSVGS----------------------GRIFSISKISSDDSGEYNC-SASNKHGEKYSDPVTLDVQYPPRRASVSINPSA-VIMSGDSVTLSCSSDSNPPAL---NFSWYKGDT-------------SVGSGRLYSIS--KISSGDSGEYKCRARNDHGEKYSDPVTLSIQWAGR 479          
BLAST of NPHS1-7 vs. Ensembl Zebrafish
Match: cadm2a (cell adhesion molecule 2a [Source:ZFIN;Acc:ZDB-GENE-040426-1614])

HSP 1 Score: 56.6102 bits (135), Expect = 9.091e-8
Identity = 55/194 (28.35%), Postives = 89/194 (45.88%), Query Frame = 3
Query: 1542 IMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSF-VLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFL 2120
            ++E   I LTC  S S P ++++W K N+         +AS KT T       +KS L +H  +R    V Y C   H     T  ++  VL + Y P V+I  S+N  +E  Y++L+C + +GNP        W       +    E  +   +I +   D++F ++   D+G Y+C  T+  G   + EF L
Sbjct:  116 VLEGDHITLTCVTSGSKPAADVRWFK-NEMEVKGAKEVNASGKTFT-------VKSSLRLH-VNRDDDGVAYTCRVDHVALTATHEETTQVLEVHYAPYVEIRQSTNVPQEGQYLKLQC-VPKGNPS--PDPVLW-------TKDGGELPDMDRMIVDG-RDLTFTSLNKTDNGTYRCEATNHLGTSHA-EFKL 288          
BLAST of NPHS1-7 vs. Ensembl Zebrafish
Match: cadm2a (cell adhesion molecule 2a [Source:ZFIN;Acc:ZDB-GENE-040426-1614])

HSP 1 Score: 56.6102 bits (135), Expect = 1.003e-7
Identity = 55/194 (28.35%), Postives = 89/194 (45.88%), Query Frame = 3
Query: 1542 IMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSF-VLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFL 2120
            ++E   I LTC  S S P ++++W K N+         +AS KT T       +KS L +H  +R    V Y C   H     T  ++  VL + Y P V+I  S+N  +E  Y++L+C + +GNP        W       +    E  +   +I +   D++F ++   D+G Y+C  T+  G   + EF L
Sbjct:  116 VLEGDHITLTCVTSGSKPAADVRWFK-NEMEVKGAKEVNASGKTFT-------VKSSLRLH-VNRDDDGVAYTCRVDHVALTATHEETTQVLEVHYAPYVEIRQSTNVPQEGQYLKLQC-VPKGNPS--PDPVLW-------TKDGGELPDMDRMIVDG-RDLTFTSLNKTDNGTYRCEATNHLGTSHA-EFKL 288          
BLAST of NPHS1-7 vs. Ensembl Zebrafish
Match: cadm2a (cell adhesion molecule 2a [Source:ZFIN;Acc:ZDB-GENE-040426-1614])

HSP 1 Score: 56.6102 bits (135), Expect = 1.160e-7
Identity = 55/194 (28.35%), Postives = 89/194 (45.88%), Query Frame = 3
Query: 1542 IMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSF-VLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFL 2120
            ++E   I LTC  S S P ++++W K N+         +AS KT T       +KS L +H  +R    V Y C   H     T  ++  VL + Y P V+I  S+N  +E  Y++L+C + +GNP        W       +    E  +   +I +   D++F ++   D+G Y+C  T+  G   + EF L
Sbjct:  105 VLEGDHITLTCVTSGSKPAADVRWFK-NEMEVKGAKEVNASGKTFT-------VKSSLRLH-VNRDDDGVAYTCRVDHVALTATHEETTQVLEVHYAPYVEIRQSTNVPQEGQYLKLQC-VPKGNPS--PDPVLW-------TKDGGELPDMDRMIVDG-RDLTFTSLNKTDNGTYRCEATNHLGTSHA-EFKL 277          
BLAST of NPHS1-7 vs. Ensembl Zebrafish
Match: cadm2a (cell adhesion molecule 2a [Source:ZFIN;Acc:ZDB-GENE-040426-1614])

HSP 1 Score: 56.225 bits (134), Expect = 1.311e-7
Identity = 55/194 (28.35%), Postives = 89/194 (45.88%), Query Frame = 3
Query: 1542 IMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSF-VLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFL 2120
            ++E   I LTC  S S P ++++W K N+         +AS KT T       +KS L +H  +R    V Y C   H     T  ++  VL + Y P V+I  S+N  +E  Y++L+C + +GNP        W       +    E  +   +I +   D++F ++   D+G Y+C  T+  G   + EF L
Sbjct:  105 VLEGDHITLTCVTSGSKPAADVRWFK-NEMEVKGAKEVNASGKTFT-------VKSSLRLH-VNRDDDGVAYTCRVDHVALTATHEETTQVLEVHYAPYVEIRQSTNVPQEGQYLKLQC-VPKGNPS--PDPVLW-------TKDGGELPDMDRMIVDG-RDLTFTSLNKTDNGTYRCEATNHLGTSHA-EFKL 277          
BLAST of NPHS1-7 vs. Ensembl Xenopus
Match: prdx1 (peroxiredoxin 1 [Source:Xenbase;Acc:XB-GENE-481165])

HSP 1 Score: 65.4698 bits (158), Expect = 5.024e-10
Identity = 79/336 (23.51%), Postives = 145/336 (43.15%), Query Frame = 3
Query: 1524 IKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGI--------FNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSN---CKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYSYFWLVSENSCVIP 2498
            I+ N++   +++++L+C  ++  P  E+ W+K  + I        FNED                   KSE+ ++   +  +  EY C++ ++K G   +++ +L  +Y      +  +    E D + L C    G+P   I + SW       S+  K        KE I   +S ++ + +   D+G+Y C+ ++  G+     +F EV++ P++      V+ T    P+N   + ++ P  V +SWF     +D   + ++       +FS I +  G   SS        L ++   ENDFG Y C   N IG   S F LV  ++   P
Sbjct:  192 IRVNATANMDESVVLSCD-ADGFPDPEISWLKKGEPIEDGEEKISFNED-------------------KSEMTIYRVGKDDE-AEYSCIA-NNKAGE--AEAIILLKVYAKPKITYVENKTAVELDEITLTCEA-SGDP---IPSISWRTATRNISSEEKTLDGHIVVKEHIR--MSALTLKDIQYTDAGEYICIASNAIGEDMRAMYF-EVQYAPKIKGPV--VVYTWEGNPVNITCEVLAYPSAV-VSWF-----RDGQLLPSS-------NFSNIKIYSGPSSSS--------LEVNPDSENDFGNYNCTAVNSIGHESSEFILVQADTPSSP 473          
BLAST of NPHS1-7 vs. Ensembl Xenopus
Match: prdx1 (peroxiredoxin 1 [Source:Xenbase;Acc:XB-GENE-481165])

HSP 1 Score: 65.0846 bits (157), Expect = 7.739e-10
Identity = 79/336 (23.51%), Postives = 145/336 (43.15%), Query Frame = 3
Query: 1524 IKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGI--------FNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSN---CKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYSYFWLVSENSCVIP 2498
            I+ N++   +++++L+C  ++  P  E+ W+K  + I        FNED                   KSE+ ++   +  +  EY C++ ++K G   +++ +L  +Y      +  +    E D + L C    G+P   I + SW       S+  K        KE I   +S ++ + +   D+G+Y C+ ++  G+     +F EV++ P++      V+ T    P+N   + ++ P  V +SWF     +D   + ++       +FS I +  G   SS        L ++   ENDFG Y C   N IG   S F LV  ++   P
Sbjct:  195 IRVNATANMDESVVLSCD-ADGFPDPEISWLKKGEPIEDGEEKISFNED-------------------KSEMTIYRVGKDDE-AEYSCIA-NNKAGE--AEAIILLKVYAKPKITYVENKTAVELDEITLTCEA-SGDP---IPSISWRTATRNISSEEKTLDGHIVVKEHIR--MSALTLKDIQYTDAGEYICIASNAIGEDMRAMYF-EVQYAPKIKGPV--VVYTWEGNPVNITCEVLAYPSAV-VSWF-----RDGQLLPSS-------NFSNIKIYSGPSSSS--------LEVNPDSENDFGNYNCTAVNSIGHESSEFILVQADTPSSP 476          
BLAST of NPHS1-7 vs. Ensembl Xenopus
Match: prdx1 (peroxiredoxin 1 [Source:Xenbase;Acc:XB-GENE-481165])

HSP 1 Score: 64.6994 bits (156), Expect = 8.414e-10
Identity = 79/336 (23.51%), Postives = 145/336 (43.15%), Query Frame = 3
Query: 1524 IKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGI--------FNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSN---CKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYSYFWLVSENSCVIP 2498
            I+ N++   +++++L+C  ++  P  E+ W+K  + I        FNED                   KSE+ ++   +  +  EY C++ ++K G   +++ +L  +Y      +  +    E D + L C    G+P   I + SW       S+  K        KE I   +S ++ + +   D+G+Y C+ ++  G+     +F EV++ P++      V+ T    P+N   + ++ P  V +SWF     +D   + ++       +FS I +  G   SS        L ++   ENDFG Y C   N IG   S F LV  ++   P
Sbjct:  219 IRVNATANMDESVVLSCD-ADGFPDPEISWLKKGEPIEDGEEKISFNED-------------------KSEMTIYRVGKDDE-AEYSCIA-NNKAGE--AEAIILLKVYAKPKITYVENKTAVELDEITLTCEA-SGDP---IPSISWRTATRNISSEEKTLDGHIVVKEHIR--MSALTLKDIQYTDAGEYICIASNAIGEDMRAMYF-EVQYAPKIKGPV--VVYTWEGNPVNITCEVLAYPSAV-VSWF-----RDGQLLPSS-------NFSNIKIYSGPSSSS--------LEVNPDSENDFGNYNCTAVNSIGHESSEFILVQADTPSSP 500          
BLAST of NPHS1-7 vs. Ensembl Xenopus
Match: prdx1 (peroxiredoxin 1 [Source:Xenbase;Acc:XB-GENE-481165])

HSP 1 Score: 64.6994 bits (156), Expect = 9.593e-10
Identity = 79/336 (23.51%), Postives = 145/336 (43.15%), Query Frame = 3
Query: 1524 IKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGI--------FNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSN---CKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYSYFWLVSENSCVIP 2498
            I+ N++   +++++L+C  ++  P  E+ W+K  + I        FNED                   KSE+ ++   +  +  EY C++ ++K G   +++ +L  +Y      +  +    E D + L C    G+P   I + SW       S+  K        KE I   +S ++ + +   D+G+Y C+ ++  G+     +F EV++ P++      V+ T    P+N   + ++ P  V +SWF     +D   + ++       +FS I +  G   SS        L ++   ENDFG Y C   N IG   S F LV  ++   P
Sbjct:  233 IRVNATANMDESVVLSCD-ADGFPDPEISWLKKGEPIEDGEEKISFNED-------------------KSEMTIYRVGKDDE-AEYSCIA-NNKAGE--AEAIILLKVYAKPKITYVENKTAVELDEITLTCEA-SGDP---IPSISWRTATRNISSEEKTLDGHIVVKEHIR--MSALTLKDIQYTDAGEYICIASNAIGEDMRAMYF-EVQYAPKIKGPV--VVYTWEGNPVNITCEVLAYPSAV-VSWF-----RDGQLLPSS-------NFSNIKIYSGPSSSS--------LEVNPDSENDFGNYNCTAVNSIGHESSEFILVQADTPSSP 514          
BLAST of NPHS1-7 vs. Ensembl Xenopus
Match: prdx1 (peroxiredoxin 1 [Source:Xenbase;Acc:XB-GENE-481165])

HSP 1 Score: 62.7734 bits (151), Expect = 3.826e-9
Identity = 77/345 (22.32%), Postives = 148/345 (42.90%), Query Frame = 3
Query: 1524 IKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGI--------FNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSL------------SDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYSYFWLVSENSCVIP 2498
            I+ N++   +++++L+C  ++  P  E+ W+K  + I        FNED                   KSE+ ++   +  +  EY C++ ++K G   +++ +L  +Y      +  +    E D + L C    G+P   I + SW    +R  +  ++ S  + +   +L            S ++ + +   D+G+Y C+ ++  G+     +F EV++ P++      V+ T    P+N   + ++ P  V +SWF     +D   + ++       +FS I +  G   SS        L ++   ENDFG Y C   N IG   S F LV  ++   P
Sbjct:  192 IRVNATANMDESVVLSCD-ADGFPDPEISWLKKGEPIEDGEEKISFNED-------------------KSEMTIYRVGKDDE-AEYSCIA-NNKAGE--AEAIILLKVYAKPKITYVENKTAVELDEITLTCEA-SGDP---IPSISWRTA-TRNISSEEKASWTRPLKQETLDGHIVVKEHIRMSALTLKDIQYTDAGEYICIASNAIGEDMRAMYF-EVQYAPKIKGPV--VVYTWEGNPVNITCEVLAYPSAV-VSWF-----RDGQLLPSS-------NFSNIKIYSGPSSSS--------LEVNPDSENDFGNYNCTAVNSIGHESSEFILVQADTPSSP 483          
BLAST of NPHS1-7 vs. Ensembl Mouse
Match: Nphs1 (nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:1859637])

HSP 1 Score: 70.4774 bits (171), Expect = 1.331e-11
Identity = 99/420 (23.57%), Postives = 164/420 (39.05%), Query Frame = 3
Query: 1032 EGKDFETFTEKTIILTKEDNNLLMKCRALQAGTHNFIESNVFMIHVFYPPDG--LEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEK--LLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSK-TGVTISDSFVLNILYNPSVKIF----PSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEI----ISNSLSDISFQTV----TPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEIS 2240
            E K F T  E  +     DN  L+ C          I+++ F +++ +PP    ++   + E  +   + ++  C  + G NPPAT+QW    KN K  S+        +     +A+  SV+         G  ++C + Y +      E+   L V F P A+  TI  ++S  EN+ + L C    S P   L+W    + +   D T       M G +GG    S L +    R    +   C +F    +  T   S  LN+ Y P+ K++    P    I+    V L C  I GNP+    + +W+  +SR     +++   + +    +  S S  S + V     P +  K+ C          S    L V+F P  L+         P + +N     IS    V +S
Sbjct:  192 EEKLFFTEAEARVTPQSSDNGQLLVCEGSNPALATPIKAS-FTMNILFPPGPPVIDWPGLNEGHVRAGENLELPCIARGG-NPPATLQWL---KNGKPVSI-------AWGTEHAQAVAHSVLVMTVRPEDHGARLSCQS-YNSVSAETQERSITLQVTFPPSAV--TILGSTSQSENKNVTLCCLTKSSRPRVLLRWWLGGRQLLPTDET------VMDGLHGGHISMSNLTLL-VKREDNGLSLTCEAFSDAFSKETFKKSLTLNVKY-PAQKLWIEGPPEGQSIRTGTRVRLVCLAIGGNPE---PSLTWLK-DSRPVNDPRQSQEPRRVQLGSVEKSGSTFSRELVLIIGPPDNLAKFSC-----KAGQLSASTQLVVQFPPTNLTILANSSALRPGDALNLTCVSISSNPPVNLS 579          
BLAST of NPHS1-7 vs. Ensembl Mouse
Match: Nphs1 (nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:1859637])

HSP 1 Score: 70.0922 bits (170), Expect = 1.583e-11
Identity = 99/420 (23.57%), Postives = 164/420 (39.05%), Query Frame = 3
Query: 1032 EGKDFETFTEKTIILTKEDNNLLMKCRALQAGTHNFIESNVFMIHVFYPPDG--LEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEK--LLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSK-TGVTISDSFVLNILYNPSVKIF----PSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEI----ISNSLSDISFQTV----TPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEIS 2240
            E K F T  E  +     DN  L+ C          I+++ F +++ +PP    ++   + E  +   + ++  C  + G NPPAT+QW    KN K  S+        +     +A+  SV+         G  ++C + Y +      E+   L V F P A+  TI  ++S  EN+ + L C    S P   L+W    + +   D T       M G +GG    S L +    R    +   C +F    +  T   S  LN+ Y P+ K++    P    I+    V L C  I GNP+    + +W+  +SR     +++   + +    +  S S  S + V     P +  K+ C          S    L V+F P  L+         P + +N     IS    V +S
Sbjct:  206 EEKLFFTEAEARVTPQSSDNGQLLVCEGSNPALATPIKAS-FTMNILFPPGPPVIDWPGLNEGHVRAGENLELPCIARGG-NPPATLQWL---KNGKPVSI-------AWGTEHAQAVAHSVLVMTVRPEDHGARLSCQS-YNSVSAETQERSITLQVTFPPSAV--TILGSTSQSENKNVTLCCLTKSSRPRVLLRWWLGGRQLLPTDET------VMDGLHGGHISMSNLTLL-VKREDNGLSLTCEAFSDAFSKETFKKSLTLNVKY-PAQKLWIEGPPEGQSIRTGTRVRLVCLAIGGNPE---PSLTWLK-DSRPVNDPRQSQEPRRVQLGSVEKSGSTFSRELVLIIGPPDNLAKFSC-----KAGQLSASTQLVVQFPPTNLTILANSSALRPGDALNLTCVSISSNPPVNLS 593          
BLAST of NPHS1-7 vs. Ensembl Mouse
Match: Cd22 (CD22 antigen [Source:MGI Symbol;Acc:MGI:88322])

HSP 1 Score: 60.8474 bits (146), Expect = 8.008e-9
Identity = 58/266 (21.80%), Postives = 118/266 (44.36%), Query Frame = 3
Query: 1380 TSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHP---VSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPS----VKIFPSSNKIKESDYVELRCNLIQGNP---KFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLL 2147
            T S + F       G  + C   + + ++      L+V ++P  ++I + P + + +N ++ +TC V+ S+P      + W K  + + ++++     +             S+LI+H  ++  +  +Y+C +  +  G   S+   L + Y P     +K+ P+S +I+    V L+C+  + NP   +F  K    +  E R                     +SF +V+P+DSG Y C++ +  G+  S  + L+V + PR L
Sbjct:  216 TESKLTFQPKWTDHGKSVKCQVQHSSKVLSERTVRLDVKYTP-KLEIKVNP-TEVEKNNSVTMTCRVNSSNPKLRTVAVSWFKDGRPLEDQELEQEQQM-------------SKLILHSVTKDMRG-KYRCQA-SNDIGPGESEEVELTVHYAPRDVKVLKVSPAS-EIRAGQRVLLQCDFAESNPAEVRFFWKKNGSLVQEGRY--------------------LSFGSVSPEDSGNYNCMVNNSIGETLSQAWNLQVLYAPRRL 443          
BLAST of NPHS1-7 vs. Ensembl Mouse
Match: Pxdn (peroxidasin [Source:MGI Symbol;Acc:MGI:1916925])

HSP 1 Score: 55.8398 bits (133), Expect = 3.759e-7
Identity = 72/329 (21.88%), Postives = 131/329 (39.82%), Query Frame = 3
Query: 1476 EKLLNVIFSPDAIKITIKP-NSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVE--ISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFV 2453
            E  L  + SP      I+P N+ ++  +++ L CS +  HP+ ++ W + ++     D     ++    G Y          +   ++S    EY C + +S   +  +   ++  L  P   + P S  + E   V+ +C   +G+P+ +I   +W    S+ S   +       ++S+    IS   V   D G+Y+C   ++ G   S +    +  QPR+   F  +   +  E    V    S   + E  I+W     NKD + +                   G+FH S    GF  L+I+++   D G Y C   N IG+ 
Sbjct:  147 EVTLRYLGSPARPTFVIQPQNTEVLVGESVTLECSAT-GHPLPQITWTRGDRTPLPID--PRVNITPSGGLY----------IQNVAQSDSG-EYTCFASNSVDSIHATAFIIVQAL--PQFTVTPQSRVVIEGQTVDFQC-AAKGHPQPVI---AWTKGGSQLSVDRRH-----LVLSSGTLRIS--GVALHDQGQYECQAVNIIG---SQKVVAHLTVQPRVTPVFASIPSDMTVEVGTNVQLPCSSQGEPEPAITW-----NKDGVQV----------------TESGKFHIS--PEGF--LTINDVGTADAGRYECVARNTIGYA 420          
BLAST of NPHS1-7 vs. Ensembl Mouse
Match: Pxdn (peroxidasin [Source:MGI Symbol;Acc:MGI:1916925])

HSP 1 Score: 55.8398 bits (133), Expect = 3.986e-7
Identity = 72/329 (21.88%), Postives = 131/329 (39.82%), Query Frame = 3
Query: 1476 EKLLNVIFSPDAIKITIKP-NSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVE--ISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFV 2453
            E  L  + SP      I+P N+ ++  +++ L CS +  HP+ ++ W + ++     D     ++    G Y          +   ++S    EY C + +S   +  +   ++  L  P   + P S  + E   V+ +C   +G+P+ +I   +W    S+ S   +       ++S+    IS   V   D G+Y+C   ++ G   S +    +  QPR+   F  +   +  E    V    S   + E  I+W     NKD + +                   G+FH S    GF  L+I+++   D G Y C   N IG+ 
Sbjct:  327 EVTLRYLGSPARPTFVIQPQNTEVLVGESVTLECSAT-GHPLPQITWTRGDRTPLPID--PRVNITPSGGLY----------IQNVAQSDSG-EYTCFASNSVDSIHATAFIIVQAL--PQFTVTPQSRVVIEGQTVDFQC-AAKGHPQPVI---AWTKGGSQLSVDRRH-----LVLSSGTLRIS--GVALHDQGQYECQAVNIIG---SQKVVAHLTVQPRVTPVFASIPSDMTVEVGTNVQLPCSSQGEPEPAITW-----NKDGVQV----------------TESGKFHIS--PEGF--LTINDVGTADAGRYECVARNTIGYA 600          
BLAST of NPHS1-7 vs. UniProt/SwissProt
Match: sp|O60500|NPHN_HUMAN (Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.513e-12
Identity = 127/518 (24.52%), Postives = 203/518 (39.19%), Query Frame = 3
Query:  792 YLFISQVDWRLSVTAECLVYEKSNMIAFQRIPLVIHSLPSKVNIQLLGLKPENEI------GDVLSIECSSVGGFPVPNYEIYI-----------MREGKDFETFT-EKTIILTKE--DNNLLMKCRALQAGTHNFIESNVFMIHVFYPPDG--LEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEK---LLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSK-TGVTISDSFVLNILYNPSVKIF----PSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEI----ISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISW 2243
            +L I   D       EC V  +S M      P VI S+   V  +LL L PE         G    + C S    P P+  I +           + EG   + FT E T  +T    DN  L+ C A        I+++ F ++V +PP    +E   + E  +   + ++  C  + G NP AT+QW    KN +  S  + ++         +A+  SV+         G  ++C+A   N++  G ++    L V F P AI   I  ++S  EN+ + L+C    S P   L+W    + +   + T       M G +GG    S L      R    +   C +F    T  T   S +LN+ Y P+ K++    P   K++    V L C  I GNP+  +  Y     +SR  T ++     + +    +  S S  S + V        Q   T  +G+  S    L V+F P  ++         P + +N     +S    V +SW
Sbjct:   95 HLHIEACDLSDDAEYECQV-GRSEMGPELVSPRVILSI--LVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKAS-FTVNVLFPPGPPVIEWPGLDEGHVRAGQSLELPCVARGG-NPLATLQWL---KNGQPVSTAWGTEHT-------QAVARSVLVMTVRPEDHGAQLSCEA--HNSVSAGTQEHGITLQVTFPPSAI--IILGSASQTENKNVTLSCVSKSSRPRVLLRWWLGWRQLLPMEET------VMDGLHGGHISMSNLTFL-ARREDNGLTLTCEAFSEAFTKETFKKSLILNVKY-PAQKLWIEGPPEGQKLRAGTRVRLVCLAIGGNPEPSLMWYK----DSRTVTESRLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQ-LSASTQLAVQFPPTNVTILANASALRPGDALNLTCVSVSSNPPVNLSW 580          
BLAST of NPHS1-7 vs. UniProt/SwissProt
Match: sp|Q9R044|NPHN_RAT (Nephrin OS=Rattus norvegicus OX=10116 GN=Nphs1 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 4.270e-12
Identity = 101/416 (24.28%), Postives = 160/416 (38.46%), Query Frame = 3
Query: 1050 TFTEKTIILTKEDNNLLMKCRALQAGTHNFIESNVFMIHVFYPPDG--LEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEK---LLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSK-TGVTISDSFVLNILYNPSVKIF----PSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEI----ISNSLSDISFQTV----TPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISW 2243
            T  E  +I    DN  L+ C          I+++ F +++ +PP    ++   + E  +   + ++  C T  G NPPAT+QW    KN K  S         +     +A+  SV+         G  ++C +   N++  G ++    L V F P A  ITI  + S  EN+ + L C    S P   L+W    + +   D T       M G +GG    S L      R    +   C +F    +  T   S  LN+ Y P+ K++    P    I+    V L C  I GNP     +  W F +SR  +  ++    + +    +  S S  S + V     P +  K+ C          S    L V+F P  L+         P + +N     IS    V +SW
Sbjct:  212 TEAEARVIPQSSDNGQLLVCEGSNPALDTPIKAS-FTMNILFPPGPPVIDWPGLNEGHVRAGENLELPC-TARGGNPPATLQWL---KNGKPVS-------TAWGTEHAQAVAHSVLVMTVRPEDHGARLSCQSY--NSVSAGTQERSITLQVTFPPSA--ITILGSVSQSENKNVTLCCLTKSSRPRVLLRWWLGGRQLLPTDET------VMDGLHGGHISMSNLTFL-VRREDNGLPLTCEAFSDAFSKETFKKSLTLNVKY-PAQKLWIEGPPEGQYIRTGTRVRLVCLAIGGNPD---PSLIW-FKDSRPVSEPRQPQEPRRVQLGSVEKSGSTFSRELVLIIGPPDNRAKFSC-----KAGQLSASTQLVVQFPPTNLTILANSSALRPGDALNLTCVSISSNPPVNLSW 594          
BLAST of NPHS1-7 vs. UniProt/SwissProt
Match: sp|Q9QZS7|NPHN_MOUSE (Nephrin OS=Mus musculus OX=10090 GN=Nphs1 PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 1.107e-10
Identity = 99/420 (23.57%), Postives = 164/420 (39.05%), Query Frame = 3
Query: 1032 EGKDFETFTEKTIILTKEDNNLLMKCRALQAGTHNFIESNVFMIHVFYPPDG--LEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEK--LLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSK-TGVTISDSFVLNILYNPSVKIF----PSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEI----ISNSLSDISFQTV----TPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEIS 2240
            E K F T  E  +     DN  L+ C          I+++ F +++ +PP    ++   + E  +   + ++  C  + G NPPAT+QW    KN K  S+        +     +A+  SV+         G  ++C + Y +      E+   L V F P A+  TI  ++S  EN+ + L C    S P   L+W    + +   D T       M G +GG    S L +    R    +   C +F    +  T   S  LN+ Y P+ K++    P    I+    V L C  I GNP+    + +W+  +SR     +++   + +    +  S S  S + V     P +  K+ C          S    L V+F P  L+         P + +N     IS    V +S
Sbjct:  206 EEKLFFTEAEARVTPQSSDNGQLLVCEGSNPALATPIKAS-FTMNILFPPGPPVIDWPGLNEGHVRAGENLELPCIARGG-NPPATLQWL---KNGKPVSI-------AWGTEHAQAVAHSVLVMTVRPEDHGARLSCQS-YNSVSAETQERSITLQVTFPPSAV--TILGSTSQSENKNVTLCCLTKSSRPRVLLRWWLGGRQLLPTDET------VMDGLHGGHISMSNLTLL-VKREDNGLSLTCEAFSDAFSKETFKKSLTLNVKY-PAQKLWIEGPPEGQSIRTGTRVRLVCLAIGGNPE---PSLTWLK-DSRPVNDPRQSQEPRRVQLGSVEKSGSTFSRELVLIIGPPDNLAKFSC-----KAGQLSASTQLVVQFPPTNLTILANSSALRPGDALNLTCVSISSNPPVNLS 593          
BLAST of NPHS1-7 vs. UniProt/SwissProt
Match: sp|Q9N1E3|CD22_PONPY (B-cell receptor CD22 (Fragment) OS=Pongo pygmaeus OX=9600 GN=CD22 PE=2 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 2.846e-8
Identity = 66/228 (28.95%), Postives = 106/228 (46.49%), Query Frame = 3
Query: 1485 LNVIFSPDAIKITIKPNSSIMENQTIILTCSVSES---HPVSELKW----VKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTIS-DSFVLNILYNPSVKIF--PSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQP 2138
            LNV   P    I + P   I E+Q + LTC ++ S   +P+ +L+W    V + +   N       SL T + F      +SEL    + + S + +      H   G  +S D+  LN+ + P +KI   PS   ++E D V + C +   NPK+     SW+          K+ +  K+   N+L  ++ Q VT   SGKY C +++  G G S E FL+V++ P
Sbjct:  132 LNVSERPFPPHIQLPPE--IQESQEVTLTCLLNFSCYGYPI-QLQWFLEGVPVGQAAVNS-----TSLATKSVF-----TRSELKF--SPQWSHHGKIVTCQLHGADGKFLSNDTVQLNVKHTPKLKIEVNPSDAIVREGDSVTMTCEVSSSNPKYT--TVSWL----------KDGTPLKK--QNALM-LTLQEVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAP 329          
BLAST of NPHS1-7 vs. UniProt/SwissProt
Match: sp|P36335|NCA12_XENLA (Neural cell adhesion molecule 1-B OS=Xenopus laevis OX=8355 GN=ncam1-b PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 3.054e-8
Identity = 73/336 (21.73%), Postives = 147/336 (43.75%), Query Frame = 3
Query: 1524 IKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGI--------FNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNS---LSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYSYFWLVSENSCVIP 2498
            I+ N++   +++++L+C  ++  P  E+ W+K  + I        FNED                   KSE+ ++   +  +  EY C++ +++ G   +++ VL  +Y      +  +    E D + L C    G+P   I + +W    + ++  ++E +    I+      +S ++ + +   D+G+Y C+ ++  G      +F EV++ P++      V+ T    P+N     ++ P    +SWF     +D   + ++       +FS I +        +N   F++L ++   ENDFG Y C   N IG   S F LV  ++   P
Sbjct:  216 IRVNATANMDESVVLSCD-ADGFPDPEISWLKKGEPIEDGEEKISFNED-------------------KSEMTIYRVEKEDE-AEYSCIA-NNQAGE--AEAIVLLKVYAKPKMTYVENKTTVELDEITLTCEA-SGDP---IPSITWRT--AHRNISSEEKTLDGHIVVKDHIRMSALTLKDIQYTDAGEYFCVASNPIGVDMQAMYF-EVQYAPKIRGPV--VVYTWEGNPVNITCDVLAHPSAA-VSWF-----RDGQLLPSS-------NFSNIKI--------YNGPTFSSLEVNPDSENDFGNYNCSAVNSIGHESSEFILVQADTPSSP 497          
BLAST of NPHS1-7 vs. TrEMBL
Match: A0A0H3YKM4 (NPHS1-7 OS=Schmidtea mediterranea OX=79327 GN=NPHS1-7 PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 6.590e-88
Identity = 250/903 (27.69%), Postives = 422/903 (46.73%), Query Frame = 3
Query:  342 GETRDLYCVINKPVVVGDVFLICPLSPGLCLINCRGSNEYTKAIDCKTEQQSHETIFHYKIKFFEKHQGKWICQFRDWLSEPLAFRVKRNLSIESLTYYPNPIISGNNLTLTCSAIXXXXXXXXXXXXIIETST-NKTSHFDGIATDDWSAYLFISQVDWRLSVTAECLVYEKSNMIAFQRIPLVIHSLPSKVNIQLLGLKPENEIGDVLSIECSSVGGFPVPNYEIYIMREGKDFETFTEKTIILTKEDNNLLMKCRALQ-AGTHNFIESNVFMIHVFYPPDGLEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMDKNYK--NHSLHXXXXXXXXXXXXGEAIT-SSVVDFIANKNQSGIIINCDAIYKNNIIPGPEKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKN-YSWMFCESRKS-TFAKENSNCKEIISN--SLSDI-SFQ--------TVTPKDSGKYQCLITDVSGKGFSGEF-FLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIW-------NNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYSYFWLVSENSCVIPQESITVLLDKNKAAITYQPPKVGHYSHVLLTMCEIQFSNSCQDIQIPHPSTGNVISPVLANIENYSFYLSVFQNSELKYKTESIRSFKNLNIRNSVTINFTIII-VVLCCFGILILV-LGISAFMIRKYKRQAKKTTLFNGNSF---NEHLCQEKQLL 2957
            G  +DL+C I        + L+CPL+ GLC+ +C  +    K I C  +  S + +F YK K F+  +G+W CQ+    S  L+ +V     I+SL   P P   G  L +TC  + +  +   F+  I++  T    ++      D +S  + I   +  L    +C+V+ +S +   + +   I+  PS++ +       + EIG ++S +CSS  G P P   +Y  R GK  +      +ILTK DN     C   + +G    + SN  MI V YPP+ +E+   P    +E++  +  C +K  S P + I+WT  D   +   HS  F+   +      G   T  S V     +  +G  I C  IY+   +   EK + V+F+P+ I +   P   I E +++ LTC    S+P S ++W +   G   ED+T+H++   M   Y G  + S L +H T+R      YKC+  H+     IS  + LN+LY P +++F       E ++V+L+C    GNP  I ++ + W FC    S  +  E+    EI  N   L D+ SF            PKD G Y C   +    G + EF FL V F P L       +       I   V++ S PK  EI WF+  +++ S  ++       N  + ++ +D S       RF  +   N    L+IS I   D+G Y C++SN  G     F +   N   I + +I +  + NKA + + PP +GH++H+ L +C IQ S +C ++QI +P++G+    +  +   Y++ L V   S++   T  I+  ++++  + V ++  ++I V++   GIL+L+ + +   ++ K +R+  K      NS    N H  ++  +L
Sbjct:   41 GTEQDLFCSIETEEQTHRMLLLCPLTVGLCMTDCIEN----KDISCNRKTISGQIVFQYKFKVFKTFEGEWKCQYGGQSSRSLSLKVSDKPFIKSLAMTPKPAWKGKQLNITCQVMPMTGITGIFIQRILDDGTVENIANAIPYKVDQYSEGITIKAAEPDLHNKVQCIVHTESEISTAKILETNIYYFPSQLILTSSNPLKQYEIGSLISFQCSSDNGNPRPVVSLYKKRFGKKPQKQVSANVILTKYDNKAEFFCLMEKISGKSPNLTSNTIMILVHYPPEKIELNEEPVDNQLESQSKQFTCSSKGNSEPLSQIEWTLFDAYGRLVAHSETFKILERVKKANPGALNTLESTVKMTLIRKYNGFKIKCSIIYQGLNMLNQEKQIKVVFAPNHISLIPDPQGGIPETRSVNLTCFTGSSNPSSNIQWFRTEPGKRPEDITSHSNKDMMPSNYSGIAIHSSLNIHGTNRQDHGTIYKCIVSHAYMNSEISKEYFLNVLYPPVIQLFSLPKIPNEGNFVQLQCQTSGGNPSIISQSQFQWKFCPVITSYEYKYEDQPNTEIRQNCYQLPDMFSFHHHHIFNITAAAPKDRGWYSCQCENAG--GVTVEFMFLNVYFSPILKHQTSSRVYVKSGSNIVLQVKWSSYPKIHEIKWFIKPNSRISARLYEPDHQAQNINEMKKRIDLS----PNSRFKLTI-VNSTIQLNISSITAYDYGDYFCEVSNSRGQSSIEFQIFPTNDISISESNIRLQFNANKATVYFDPPTIGHFTHMSLRVCLIQSSGTCSEMQINNPNSGHATISLPQSPSLYNYRLIVHNGSKVLQMTNIIQ--RDISSPHWVEMSLEMMIAVIIGVVGILVLLFVALMTLILLKCRRKKPKDNYLENNSVATTNSHQRRQDYML 930          
BLAST of NPHS1-7 vs. TrEMBL
Match: A0A504YN65 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_01852 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.357e-39
Identity = 202/913 (22.12%), Postives = 351/913 (38.44%), Query Frame = 3
Query:  396 VFLICPLSPGLCLINCRGSNEYTKAIDCKT-EQQSHET------------IFHYKI-KFFEKHQGKWICQFRDWLSEPLAFRVKRNLSIESLTYYPNPIISGNNLTLTCSAIXXXXXXXXXXXXIIETSTNKTSHFDGIA-------------------------TDDWSAYLFISQVDWRLSVTAECLVYEKSNMIAFQRIPLVIHSLPSKVNIQLLGLKPENE----IGDVLSIECSSVGGFPVPNYEIYIMREGKDFETFTEKTII------------------LTKEDNNLLMKCRALQAGTHNFIE----SNVFMIHVFYPPDGLEMQXXXXXXXXXXXXXXXXC-FTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGE---AITSSVVDFIANKNQSGIIINCDAIYKNN-IIPGPEKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKI-NKGIFNE---------------DVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSW----------MFCESRKS--------------------------TFAKENSNCKEIISNSLSDISFQ-------TVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSL-----SIWNNEK----------------FERILDFSTIIVSEGRFHSSF------------------------NENGFTT--LSISEIVENDFGLYVCKISNEIGFVYSYFWLV--SENSCVIPQESITVLLDKNKAAITYQPPKVGHYSHVLLTMCE 2600
            VFL+CPLS G+CL +C+        I C+  E QS  T               Y+I +   +H G W+CQ +   SE    +V     IESLT   NP+ +G+ + LTC+                ET+  +   F+GI                           D +++ L +  + +      EC   +     A ++I L +H  P  ++I+ +   P +E     G    I C++    P P + +   R G+      E T +                  LT++DN     C  +   TH  +E    S+    +V YPP  + + + P   + E+      C    SGSNPP+ + WT +D       L      ++  +  GE    I  SV+  +A ++ +G    C AIY+    +   E++L V F+P+ + +T  P   + E+Q + LTC+ S  HP + ++W ++ N G   E               ++T  A + T  G +GG ++ S+L V +T R  Q   ++CL  H      +     L +LY   V++     +      V L C    GNP  I   Y+W          +F +S  +                          T A + ++    + N L  +S Q        V     G Y C +    G   S  +FL++ +QP++    +  ++    E + F +   + P   E  WF ++ ++ S+     +  +N +                ++ + D+   +  + R  + F                         E G  T  LS +E+   DFG YVC++ +++G     F L+  SE   ++P  S+ V        + ++PP    +S ++L +C 
Sbjct:   32 VFLLCPLSTGVCLEDCK-PTPNVHNITCEELEPQSARTGSDRSSMTRASRRIRYQIPQVTGRHNGTWVCQNKGVSSERHELKVSDAPYIESLTASRNPVAAGSTVRLTCTVAPTPTAYELLRQRSWETNRLRQFKFEGIQFAWHRLRSKVDTGERSSPILNRVEQPDAFTSSLEVHDLRYEEGTVFECTAEDSRGRRAVRQIQLDVHYTPKSIHIETI---PSHERPVQAGTRCHILCTAESSNPAPTFNLLRRRVGQSQAYLMEDTALDGASLGTGNVARQAFAFQLTEQDNGASFFCEVI---THGVMETVARSDGRQFNVTYPPQSIFVTMDPVGSVAESVSKVFTCQLNASGSNPPSELTWTQLDSAGALIPLKDDIHVQSTDQIVGEFGALIARSVLTVVARRSINGRRFECTAIYQGKKTMLRAEEILEVKFAPNNVGLTALPMDGVRESQRLDLTCATSSCHPPATIRWFEVPNHGSLEEEEGSWTIGTDPMKPNELTDLAQMDTKPGKFGGTEVSSKLTVTKTYRLHQGTVFRCLVEHPAMEKPVISEHRLQVLYPTVVQLISHPPEPVVGQTVLLSCQTSGGNP-LIGFTYTWFAADRFQLAGLFADSANNDSNRIEDASKSSMTATSSVRATGGVETRAAKRADGAPALKNMLRLLSQQEAYLNLTKVRLSQRGWYACQVASAGGVSHS-TYFLDLFYQPQIDRRTRSRVQAHVGESVAFKLFIDANPPWAEAIWFQLNTDEQSIHPSLPTPLSNGRGSDTYFVGYHHNPYMGYDELYDYGMELKRKRRLVTGFGGKTRTQVGSDNSDRSNIVAGKGSGEKGNLTFILSFNEVRSEDFGDYVCQLRHKLGVQEFPFQLLRKSEAEGILP-SSVVVQKRGPTTVVRFRPPGNLRFSRLVLRVCR 934          
BLAST of NPHS1-7 vs. TrEMBL
Match: A0A4E0RP05 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_000418 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.653e-38
Identity = 199/910 (21.87%), Postives = 347/910 (38.13%), Query Frame = 3
Query:  396 VFLICPLSPGLCLINCRGSNEYTKAIDCKT-EQQSHET------------IFHYKI-KFFEKHQGKWICQFRDWLSEPLAFRVKRNLSIESLTYYPNPIISGNNLTLTCSAIXXXXXXXXXXXXIIETSTNKTSHFDGIA-------------------------TDDWSAYLFISQVDWRLSVTAECLVYEKSNMIAFQRIPLVIHSLPSKVNIQLLGLKPEN-EIGDVLSIECSSVGGFPVPNYEIYIMREGKDFETFTEKTII------------------LTKEDNNLLMKCRALQAGTHNFIE----SNVFMIHVFYPPDGLEMQXXXXXXXXXXXXXXXXC-FTKSGSNPPATIQWTFMDKNYKNHSLHXXXXXXXXXXXXGE---AITSSVVDFIANKNQSGIIINCDAIYKNN-IIPGPEKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKI-NKGIFNE---------------DVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSW----------MFCESRKS--------------------------TFAKENSNCKEIISNSLSDISFQ-------TVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSL-----SIWNNEK----------------FERILDFSTIIVSEGRFHSSF------------------------NENGFTT--LSISEIVENDFGLYVCKISNEIGFVYSYFWLV--SENSCVIPQESITVLLDKNKAAITYQPPKVGHYSHVLLTMCE 2600
            VFL+CPLS G+CL +C+        I C+  E QS  T               Y+I +   +H G W+CQ +   SE    +V     IESLT   NP+ +G+ + LTC                 ET+  +   F+GI                           D +++ L +  + +      EC   +     A ++I L +H  P  ++I+ +       + G    I C++    P P + +   R G+      E T                    LT++DN     C  +   TH  +E    S+    +V YPP  + + + P   + E+      C    SGSNPP+ + WT +D       L      ++  +  GE    I  SV+  +A ++ +G    C AIY+    +   E++L V F+P+ + +T  P   + E+Q + LTC+ S  HP + ++W ++ N G   E               ++T  A + T  G +GG ++ S+L V +T R  Q   ++CL  H      +     L +LY   V++     +      V L C    GNP  +   Y+W          +F +S  +                          T A + ++    + N L  +S Q        V     G Y C +    G   S  +FL++ +QP++    +  ++    E + F +   + P   E  WF ++ ++ S+     +  +N +                ++ + D+   +  + R  + F                         E G  T  LS +E+   DFG YVC++ +++G     F L+  SE   ++P  S+ V        + ++PP    +S ++L +C 
Sbjct:   32 VFLLCPLSTGVCLEDCK-PTPNVHNITCEELEPQSARTGSDRSSMTRASRRIRYQIPQVTGRHNGTWVCQNKGVSSERHELKVSDAPYIESLTANRNPVAAGSTVRLTCIVAPTPTAYELLRQRSRETNRLRQFKFEGIQFAWHRLRSKVDTGARRSPIVNRVEQPDAFTSSLEVHDLRYEEGTVFECTAEDSRGRRAVRQIQLDVHYTPKSIHIETIPAHDRPVQAGTRCHILCTAESSNPAPTFNLLRRRVGQSQAYLMEDTAFDGPSLGNENVARQAFAFQLTEQDNGASFFCEVI---THGVMETVARSDGRQFNVTYPPQSIFVTMDPVGSVAESVSKVFTCQLNASGSNPPSELTWTQLDSAGALIPLKDDIHVQSTDQIVGEFGALIARSVLTVVARRSINGRRFECTAIYQGKKTMLRAEEILEVKFAPNNVGLTALPMDGVRESQRLDLTCATSSCHPPATIRWFEVPNHGSLEEEEGSWTIGTDPTKPNELTDLAQMDTKPGKFGGTEVSSKLTVTKTYRLHQGTVFRCLVEHPAMEKPVISEHRLQVLYPTVVQLISHPPEPVVGQTVLLSCQTSGGNP-LVGFTYTWFAADRFQLAGLFADSANNDSNRIQDASKSSMTATSSVRATGGVETRAAKRADGAPALKNMLRLLSQQEAYLNLTKVRLSQRGWYACQVASAGGVSHS-TYFLDLFYQPQIDRRTRSRVQAHVGESVAFKLFIDANPPWAEAIWFQLNTDEQSIHPSLPTPLSNGRGSDTYFVGYHHNPYMGYDELYDYGMELKRKRRLVTGFGGKTRTQVGSDNSDRSNIIAGKGSGEQGNLTFILSFNEVRSEDFGDYVCQLRHKLGVQEFPFQLLRKSEVEGILP-SSVVVQKRGPTTVVRFRPPGNLRFSRLVLRVCR 934          
BLAST of NPHS1-7 vs. TrEMBL
Match: G7Y8F2 (Cell adhesion molecule 2 OS=Clonorchis sinensis OX=79923 GN=CLF_102725 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.582e-29
Identity = 146/599 (24.37%), Postives = 250/599 (41.74%), Query Frame = 3
Query: 1068 IILTKEDNNLLMKCRALQAGTHN-FIESNVFMIHVFYPPDGLEMQXXXXXXXXXXXXXXXXC-FTKSGSNPPATIQWTFMDKNYKNHSLHXX--XXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIP-GPEKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKIN-KGIFNEDVTAH----ASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIF--PSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAK----------------ENSNCKEIIS------NSL-------------------SDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIWN--------------------------------NEKFERILD--FSTIIVSEG---RFH---SSFNENGFT-TLSISEIVENDFGLYVCKISNEIGFVYSYFWLVS--ENSCVIPQESITVLLDKNKAAITYQPPKVGHYS 2576
            +++T +DN   + C    AGT    + S    ++V YPP+G+ +   P   + E+   K  C    +GSNPP+ IQW  +D       +     +  +  +   G  +  S +   A ++ +G    C AIY     P   E++L V+F+P+ +++T KP   + E+  + LTC  S  HP + ++W ++  K  F+   T      A + T  G YGG  + S L+V +T RS Q+  ++C   H      I +   + +LY P+V++   P    ++++  V L C    GNP+    ++SW F  SR S FA+                +N N +E+ +      N L                   S ++F  V     G Y C ++  SG      FFL++ +QP L    K+ +     E ++F+    + P  VE++WF +++   S +                                   N     +LD   S I V  G   + H      +E+  T +L    +  +DFG Y+C+  + +G    YF L    E   +IP  SI +    +   + Y+PP+   Y+
Sbjct:  115 LVMTDQDNRAELFCGVNGAGTDTTLVRSTGVRMNVTYPPNGVHVTASPAGPVTESVAKKFTCKLNSTGSNPPSDIQWMQLDSAGARLPMADVEITPTEQMSSPTGGYLAHSTLTVNARRSSNGRRFECAAIYLQKRTPLRSEEILEVLFAPNNVRLTEKPMGGVRESDRLELTCKTSSCHPPAVIRWFEVPPKAKFSNQATNELTDLAQIDTSPGEYGGISVSSTLVVSKTYRSQQHTVFRCQVEHPGLEKPIINEHQMQVLYPPTVQLLTVPEEPVVRQT--VTLSCQTSGGNPQDGF-SFSW-FAGSR-SQFAELLDGNHDNTASNKKPAKNDN-RELTTQQRKEFNQLSKSSPPELDKMVSMTVFQDSQLNFTNVGLSQRGWYACEVSS-SGGAAHASFFLDLFYQPILDRRTKQQVAAHLGETVSFIAHLEANPPSVEVTWFQLNNVAQSSAPSGYPRHYETFYASGYPYHGYDGFYEYRVRRASGLNRTIRSLLDQGQSRIQVGNGMGEKHHIVAEKSDEDNLTFSLRFMGVQTSDFGGYLCQARHRLGVKEFYFQLTKKPETDGIIP-SSINITQRGSITIVRYKPPEKPPYT 705          
BLAST of NPHS1-7 vs. TrEMBL
Match: A0A4S2LUT7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004718 PE=4 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.565e-27
Identity = 135/594 (22.73%), Postives = 239/594 (40.24%), Query Frame = 3
Query: 1068 IILTKEDNNLLMKCRALQAGTHN-FIESNVFMIHVFYPPDGLEMQXXXXXXXXXXXXXXXXC-FTKSGSNPPATIQWTFMDKNYKNHSLHXX--XXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIP-GPEKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKI-NKGIFNEDVTAH----ASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSW------MFCESRKSTFAKENSNCKEIISNSL--------------------------------SDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIWN--------------------------------NEKFERILD--FSTIIVSEG---RFH---SSFNENGFT-TLSISEIVENDFGLYVCKISNEIGFVYSYFWLVS--ENSCVIPQESITVLLDKNKAAITYQPPKVGHYS 2576
            +++T +DN   + C   +AGT    + S    +++ YPP+G+ +   P   + E+   K  C    +GSNPP+ I W  +D       +     +  +  +   G  ++ S +   A ++ +G    C AIY     P   E++L V+F+P+ +++T KP   + E+  + LTC  S  HP + ++W ++  K  F+   T      A + T    YGG  + S L+V +T RS Q+  ++C   H      I +   L +LY P+V++     +      V L C    GNP+    ++SW       F E          SN K + +++                                 S ++F  V     G Y C ++   G   +  FFL++ +QP L    K+ +     E ++F+    + P  VE++WF +++   S +                                   N     +LD   S I V  G   + H      +E+  T +L    +  +DFG Y+C+  + +G    YF L    +   +IP  SI +    +   + Y+PP+   Y+
Sbjct:   97 LVMTDQDNRAELFCGVNRAGTDTTLVRSTGVRMNITYPPNGVHVTASPAGPVTESVAKKFTCKLNSTGSNPPSDIHWMQLDSAGAQLPMTDVEITPTEQMSSPNGGYLSHSTLTVNARRSSNGRRFECAAIYLQKRTPLRSEEILEVLFAPNNVRLTEKPMGGVRESDRLELTCKTSSCHPPAVIRWFEVPPKPKFSNQATNELTDLAQIDTSPAEYGGTSVSSILVVSKTYRSQQHTVFRCQVEHPGLEKPIINEHRLQVLYPPTVQLLIVPEEPVVGQTVTLSCQTSGGNPQDGF-SFSWFAGSHSQFAELLDGNHDNTASNKKPVKNDNREPTIQQRKEFNQLSKSSPPEIDKMVSMTVFQDSQLNFTNVGLSQRGWYACEVSSSGGTAHA-SFFLDLFYQPILDRRTKQQVPAHLGETVSFIAHMEANPPSVEVTWFQLNNVVQSSAPSGYPRHYETFYASGYPYHGYDGFYEYRVRRASALNRTIRSLLDQGQSRIQVGNGMGEKHHIVAEKSDEDNLTFSLRFMGVQTSDFGAYLCQARHRLGVKEFYFQLTKKPDTDGIIP-SSINITQRGSTTIVRYKPPEKPPYT 687          
BLAST of NPHS1-7 vs. Ensembl Cavefish
Match: ENSAMXT00000036142.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001677.1:18159:21331:1 gene:ENSAMXG00000038439.1 transcript:ENSAMXT00000036142.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 3.300e-9
Identity = 60/204 (29.41%), Postives = 97/204 (47.55%), Query Frame = 3
Query: 1479 KLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP---SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLIT 2081
            K L ++  P ++ ++I P+  I+E  ++ LTCS S+ +P  E  W K +  +        A+ KT T             +++ S S  + EYKC S + K G   SD+  LN+LY P   SV I P S +I E   V L C+   GNP   ++ Y+W         F K + + ++  +  +  I+   +   DSG+YQ + T
Sbjct:   14 KTLTILNPPKSVSVSISPSGEIVEGSSVTLTCS-SDGNPPVEYTWYKGSSSV--------ATGKTFT-------------LNKIS-SVNSGEYKCRSSN-KHGEKYSDTVTLNVLYPPKSVSVSISP-SGEIVEGSSVTLTCSS-DGNPP--VQKYTW---------FKKVDKDVQQKWTGQIYSIT--NIRSADSGEYQLMET 178          
BLAST of NPHS1-7 vs. Ensembl Cavefish
Match: si:dkey-33i11.1 (B-cell receptor CD22 [Source:NCBI gene;Acc:103028527])

HSP 1 Score: 58.9214 bits (141), Expect = 2.615e-8
Identity = 48/160 (30.00%), Postives = 75/160 (46.88%), Query Frame = 3
Query: 1482 LLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQ---QLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP---SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSW 1943
            L+NV +SP   K+ I P   IME  ++ LTC  + + PV +  W K+                      GGQ   +  S+ + + + RS  + +Y C S++   GV  S S  L++LY P   SV   PS+  I+    + L C+  Q NP   ++NY+W
Sbjct:  307 LVNVTYSPKNTKVLISPRGDIMEGYSVNLTCISNANPPVEKYSWYKVG---------------------GGQPWARGSSQNLTYSSVRSHHSGQYYCTSWNV-IGVGTSPSVTLSVLYAPKNTSVLARPST-VIETGASLTLTCS-SQANPA--VENYTW 440          
BLAST of NPHS1-7 vs. Ensembl Cavefish
Match: ENSAMXT00000050572.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001677.1:18993:21625:1 gene:ENSAMXG00000029721.1 transcript:ENSAMXT00000050572.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 2.242e-7
Identity = 59/221 (26.70%), Postives = 98/221 (44.34%), Query Frame = 3
Query: 1485 LNVIF--SPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP---SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEF 2132
            +N IF   P ++ ++I P+  I+E  ++ LTCS   + PV +  W K      ++DV               Q+   ++      RS+ + EY+C++ +++ G   S+   L +L+ P   SV I P S KI E   V L C+   GNP      Y+W    S  +T        K    N +S +        +SG+Y+C  ++  G+ +S    L V F
Sbjct:    4 INDIFLDPPKSVSVSISPSGKIVEGSSVTLTCSSDGNPPVQKYTWFK----KVDKDVQ--------------QKWTGQIYSITNIRSADSGEYQCMATNTQ-GSQSSEYKSLTVLHPPKSVSVSISP-SGKIVEGSSVTLTCSS-DGNPPV---EYTWYKGSSSVAT-------GKTFTLNKISSV--------NSGEYKCRSSNKHGEKYSDTVTLNVLF 185          
BLAST of NPHS1-7 vs. Ensembl Cavefish
Match: ENSAMXT00000001412.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001731.1:57675:66251:-1 gene:ENSAMXG00000001390.2 transcript:ENSAMXT00000001412.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 5.724e-7
Identity = 41/156 (26.28%), Postives = 71/156 (45.51%), Query Frame = 3
Query: 1476 EKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSW 1943
            E+L  +   P ++ ++I P+  I+E  ++ LTCS   + PV    W K      N+DV               Q+   ++      RS+ + EY+C++ +++ G   S+   L +L  PS +I        E   V L C+   GNP   ++NY+W
Sbjct:   20 ERLELITHPPKSVSVSISPSGEIVEGSSVTLTCSSDGNPPVQNYTWFK----KVNKDVP--------------QKWTGQIYSITNIRSADSGEYQCMATNTQ-GSRSSEYKTLTVLRTPSGEIV-------EGSSVTLTCSS-DGNPP--VQNYTW 146          
BLAST of NPHS1-7 vs. Ensembl Cavefish
Match: ENSAMXT00000047510.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001731.1:157159:160856:1 gene:ENSAMXG00000034132.1 transcript:ENSAMXT00000047510.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 1.164e-6
Identity = 38/131 (29.01%), Postives = 64/131 (48.85%), Query Frame = 3
Query: 1473 PEKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKI-NKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP---SVKIFPS 1853
            PE  LNV + P +I ++I P+  I+E  ++ LTCS   + PV +  W K  +KG+                    Q+   ++   +  RS+ + EY+C++ +++ G   S+   L +LY P   SV I PS
Sbjct:  193 PEVTLNVRYPPKSISVSISPSGEIVEGSSVTLTCSSDGNPPVQKYTWFKKGDKGV-------------------QQKFTGQIYSIKNIRSADSGEYQCMATNTQ-GSQSSEYKSLTVLYPPKRISVSISPS 303          
BLAST of NPHS1-7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004392.1 (pep scaffold:Pmarinus_7.0:GL476636:579022:606187:1 gene:ENSPMAG00000003992.1 transcript:ENSPMAT00000004392.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 1.746e-6
Identity = 70/329 (21.28%), Postives = 128/329 (38.91%), Query Frame = 3
Query: 1521 TIKPNSSIMENQTIILTCSVSESHPVSELKW------VKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNK----IKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKG------FSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYS 2459
            T+ P  S    +T+ L C +++S+P +  +W      +K NK           SL+      GG      L++ +  R      ++CL+ + + G   S    L   +   +  FPS  +    ++  + + L CN     P      Y W+  E  +     E    +  +S    ++    V   D+G+Y CL+    G+       FS    LE+     ++S   ++   LP E +      + K   + +  F + +   S+S W   K  R+ D + + VS               L ++++   D G+YVC  +N +G V S
Sbjct:   19 TLYPEDS--PEKTVTLRC-LAKSNPPATYRWRHNGTEIKWNK---------RYSLE------GGN-----LVISDLDRDQDASTFQCLATN-RFGTLASKQATLKFAH---LDRFPSEERGPLRVRLQNSLVLLCNPPSHYPDV---EYQWLLNEFPELVPQDE----RRFVSQQTGNLYIARVEASDAGRYACLLRSTLGRHSPNVNIFSAFAALEIRRDSPMMSLLPRIEVKLPAETV------VLKGDNLRLECFALGNPVPSIS-WQ-RKDGRLPDRTRLSVSAA------------VLEVADVTHEDEGVYVCNATNALGSVLS 293          
BLAST of NPHS1-7 vs. Ensembl Nematostella
Match: EDO49557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM1])

HSP 1 Score: 50.8322 bits (120), Expect = 3.084e-6
Identity = 70/321 (21.81%), Postives = 128/321 (39.88%), Query Frame = 3
Query: 1584 ESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKG---FSGEFFLEVEFQPRLLSTFKKVIKTLPKE--------PINFVVQFISKPKKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYSYFWL-VSENSCVIPQESI 2510
            E  P   ++W+K ++ + ++   +H  +      Y        L + E ++S + +    ++    +G    D  V +   N S   F S+    E   V L    I G P   +   SW    ++      +  N +    + +  ++ +  TP DSG Y+C +T+ +GK    FS E  +E E +P      ++  K L +E         +    Q   KP+   + WF     KD + +  +E          I ++E        E+G  +L I E  + D G Y  ++SNE G     F + V +    IP++++
Sbjct:  193 EGKPKPSVEWLKDDRPVLSD---SHIKMTEEDDIYS-------LTIREPTKSDEGMYTVKITNDVGSGTRTFDVKVEDTTTNDSFVPFEST----EEGNVRLSVK-ITGKP---VPEVSW----TKDEKPVHKIQNIRLDHQDDIYTLTIREATPNDSGSYKCTLTNDAGKSTRTFSVE--IEGETKPEKGKPTEREGKPLEEEELPVSAETEVEMTAQVTGKPQP-SVEWF-----KDDVPVSPDEH---------ITITE--------EDGTYSLVIKEPTKKDEGTYTVEVSNEAGLGRRTFDVSVDDTRKTIPKDAV 466          
BLAST of NPHS1-7 vs. Ensembl Medaka
Match: mag (myelin associated glycoprotein [Source:NCBI gene;Acc:101159465])

HSP 1 Score: 63.1586 bits (152), Expect = 1.310e-9
Identity = 68/298 (22.82%), Postives = 127/298 (42.62%), Query Frame = 3
Query: 1374 AITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEKL--LNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDN 2261
            A+ SS + F+     +G ++ C   Y N  +   E+L  L++ ++P ++ + +  +S +ME  ++ L C V +S+P   + W      +F E      +   ++ F      ++E I            Y C+  +      ++ S  L++ Y P   +   S  + E   + L C+  QGNP   +             T+ K+      I ++ LS +    VTP+  G+Y+CL  +  G+  S  F + VE+ P LL   K    T+ +E +  V      P+ + I ++L   N
Sbjct:  196 AVMSSTLAFVPRPMHNGQLLGCRVYYPNTTLVY-ERLISLDIKYAPRSVWVNV--SSEVMEGSSVTLHCEV-DSNPPPRISW------MFGEQELLWDTASNVSLFLDDVTPQNEGI------------YTCVGDNGFG--AMNTSMYLSVRYPPREPVVNESMTVLEGSSLALHCS-TQGNPAPTL-------------TWLKDGELVGTITADELSVLEVIEVTPQGDGQYRCLAENEHGRA-SSSFNITVEYAPVLLEESK---CTVVREGVQCVCMATGNPEPI-IEFYLADLN 450          
BLAST of NPHS1-7 vs. Ensembl Medaka
Match: mag (myelin associated glycoprotein [Source:NCBI gene;Acc:101159465])

HSP 1 Score: 62.7734 bits (151), Expect = 1.597e-9
Identity = 68/298 (22.82%), Postives = 127/298 (42.62%), Query Frame = 3
Query: 1374 AITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEKL--LNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDN 2261
            A+ SS + F+     +G ++ C   Y N  +   E+L  L++ ++P ++ + +  +S +ME  ++ L C V +S+P   + W      +F E      +   ++ F      ++E I            Y C+  +      ++ S  L++ Y P   +   S  + E   + L C+  QGNP   +             T+ K+      I ++ LS +    VTP+  G+Y+CL  +  G+  S  F + VE+ P LL   K    T+ +E +  V      P+ + I ++L   N
Sbjct:  196 AVMSSTLAFVPRPMHNGQLLGCRVYYPNTTLVY-ERLISLDIKYAPRSVWVNV--SSEVMEGSSVTLHCEV-DSNPPPRISW------MFGEQELLWDTASNVSLFLDDVTPQNEGI------------YTCVGDNGFG--AMNTSMYLSVRYPPREPVVNESMTVLEGSSLALHCS-TQGNPAPTL-------------TWLKDGELVGTITADELSVLEVIEVTPQGDGQYRCLAENEHGRA-SSSFNITVEYAPVLLEESK---CTVVREGVQCVCMATGNPEPI-IEFYLADLN 450          
BLAST of NPHS1-7 vs. Ensembl Medaka
Match: ENSORLT00000038552.1 (B-cell receptor CD22-like [Source:NCBI gene;Acc:105356876])

HSP 1 Score: 62.3882 bits (150), Expect = 2.386e-9
Identity = 57/233 (24.46%), Postives = 105/233 (45.06%), Query Frame = 3
Query: 1494 IFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP---SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRL----LSTFKKVIK 2171
            +++P ++ +++   + IME  ++ LTCS  +++P ++ +W K N+ +  +D +                    LI+    RS    +Y C++  +K G   SD   +N+ Y P   SV + PS+ ++ E   V L C+    NP     NY+W           K+N   +     S   + F ++  + SG Y C   +  G+  S    L+V++ PR+    +S F K+ K
Sbjct:  246 VYAPKSVSVSMS-LTEIMEGSSVTLTCSC-DANPAAKFRWYKNNQPLLRKDQS--------------------LILRSVQRSDSR-KYHCVA-ENKLGEAASDYVFINVEYPPETSSVSVSPSA-EVLEGSSVTLTCS-SDANP---AANYTWF----------KDNRPLR-----SEDKVHFSSIRSEHSGNYSCKSENKHGQSSSTPLLLDVQYPPRIPSVSVSVFGKISK 434          

HSP 2 Score: 51.9878 bits (123), Expect = 3.448e-6
Identity = 54/222 (24.32%), Postives = 95/222 (42.79%), Query Frame = 3
Query: 1482 LLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP-----SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISN-SLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVE 2129
             +NV + P+   +++ P++ ++E  ++ LTCS S+++P +   W K N+ + +ED    +S+                      RS  +  Y C S  +K G + S   +L++ Y P     SV +F    KI +   V L C+    NP     N+SW         + K+ ++ K    N ++SD   +      SG Y C   +  G+  S    +E E
Sbjct:  327 FINVEYPPETSSVSVSPSAEVLEGSSVTLTCS-SDANPAANYTWFKDNRPLRSEDKVHFSSI----------------------RSEHSGNYSCKS-ENKHGQSSSTPLLLDVQYPPRIPSVSVSVF---GKISKGSSVTLTCS-SDANP---AANFSW---------YKKDENSPKASGPNWTISDFRAE-----HSGFYYCEAENRRGRLNSSLHLIEAE 503          
BLAST of NPHS1-7 vs. Ensembl Medaka
Match: ENSORLT00000046542.1 (B-cell receptor CD22-like [Source:NCBI gene;Acc:105356876])

HSP 1 Score: 62.3882 bits (150), Expect = 2.430e-9
Identity = 57/233 (24.46%), Postives = 105/233 (45.06%), Query Frame = 3
Query: 1494 IFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP---SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRL----LSTFKKVIK 2171
            +++P ++ +++   + IME  ++ LTCS  +++P ++ +W K N+ +  +D +                    LI+    RS    +Y C++  +K G   SD   +N+ Y P   SV + PS+ ++ E   V L C+    NP     NY+W           K+N   +     S   + F ++  + SG Y C   +  G+  S    L+V++ PR+    +S F K+ K
Sbjct:  279 VYAPKSVSVSMS-LTEIMEGSSVTLTCSC-DANPAAKFRWYKNNQPLLRKDQS--------------------LILRSVQRSDSR-KYHCVA-ENKLGEAASDYVFINVEYPPETSSVSVSPSA-EVLEGSSVTLTCS-SDANP---AANYTWF----------KDNRPLR-----SEDKVHFSSIRSEHSGNYSCKSENKHGQSSSTPLLLDVQYPPRIPSVSVSVFGKISK 467          

HSP 2 Score: 51.9878 bits (123), Expect = 3.477e-6
Identity = 54/222 (24.32%), Postives = 95/222 (42.79%), Query Frame = 3
Query: 1482 LLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP-----SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISN-SLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVE 2129
             +NV + P+   +++ P++ ++E  ++ LTCS S+++P +   W K N+ + +ED    +S+                      RS  +  Y C S  +K G + S   +L++ Y P     SV +F    KI +   V L C+    NP     N+SW         + K+ ++ K    N ++SD   +      SG Y C   +  G+  S    +E E
Sbjct:  360 FINVEYPPETSSVSVSPSAEVLEGSSVTLTCS-SDANPAANYTWFKDNRPLRSEDKVHFSSI----------------------RSEHSGNYSCKS-ENKHGQSSSTPLLLDVQYPPRIPSVSVSVF---GKISKGSSVTLTCS-SDANP---AANFSW---------YKKDENSPKASGPNWTISDFRAE-----HSGFYYCEAENRRGRLNSSLHLIEAE 536          
BLAST of NPHS1-7 vs. Ensembl Medaka
Match: ENSORLT00000031495.1 (B-cell receptor CD22-like [Source:NCBI gene;Acc:105356876])

HSP 1 Score: 61.6178 bits (148), Expect = 3.340e-9
Identity = 55/225 (24.44%), Postives = 101/225 (44.89%), Query Frame = 3
Query: 1494 IFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNP---SVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFCESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGFSGEFFLEVEFQPRLLSTFK 2159
            +++P ++ +++   + IME  ++ LTCS  +++P ++ +W K N+ +  +D +                    LI+    RS    +Y C++  +K G   SD   +N+ Y P   SV + PS+ ++ E   V L C+    NP     NY+W           K+N   +     S   + F ++  + SG Y C   +  G+  S    L+V++ PR+ S  K
Sbjct:  279 VYAPKSVSVSMS-LTEIMEGSSVTLTCSC-DANPAAKFRWYKNNQPLLRKDQS--------------------LILRSVQRSDSR-KYHCVA-ENKLGEAASDYVFINVEYPPETSSVSVSPSA-EVLEGSSVTLTCS-SDANP---AANYTWF----------KDNRPLR-----SEDKVHFSSIRSEHSGNYSCKSENKHGQSSSTPLLLDVQYPPRIPSVSK 459          
BLAST of NPHS1-7 vs. Planmine SMEST
Match: SMESG000035985.1 (SMESG000035985.1)

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 360/407 (88.45%), Postives = 363/407 (89.19%), Query Frame = 3
Query: 2130 FQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYSYFWLVSENSCVIPQESITVLLDKNKAAITYQPPKVGHYSHVLLTMCEIQFSNSCQDIQIPHPSTGNVISPVLANIENYSFYLSVFQNSELKYKTESIRSFKNLNIRNSVTINFTIIIVVLCCFGILILVLGISAFMIRKYKRQAKKTTLFNGNSFNEHLCQEKQLLHLRNRSGLLXXXXXXXXXXXXXXXXXXXXXYQMNFVPHEYPVSDSKSHVYMNMTPKGHSLDGFSNKSSNMETIKSQETSFTCLSNLSPSKSQKLLTMSDINKFNHYENCDSYQNKMLLNGLYNDEIYNFPE 3350
            FQPRLLSTFKKVIKTLPKEPINFVVQFISKPK+VEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYSYFWLVSENSCVIPQESITVLLDKNKAAITYQPPKVGHYSHVLLTMCEIQFSNSCQDIQIPHPSTGNVISPVLANIENYSFYLSVFQNSELKYKTESIRSF                                            KKTTLFNGNSFNEHLCQEKQLL+LRNRSGLLQSTSSMLSPPKSQSSLLSQNSYQMNFVPHEYPVSDSKSHVYMNMTPKGHSLDGFSNKSSNMET+KSQETSFTCLSNLSPSKSQKLLTMSDINKFNHYENCDSYQNKMLLNGLYNDEIYNFPE
Sbjct:  113 FQPRLLSTFKKVIKTLPKEPINFVVQFISKPKEVEISWFLISDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYSYFWLVSENSCVIPQESITVLLDKNKAAITYQPPKVGHYSHVLLTMCEIQFSNSCQDIQIPHPSTGNVISPVLANIENYSFYLSVFQNSELKYKTESIRSF--------------------------------------------KKTTLFNGNSFNEHLCQEKQLLNLRNRSGLLQSTSSMLSPPKSQSSLLSQNSYQMNFVPHEYPVSDSKSHVYMNMTPKGHSLDGFSNKSSNMETLKSQETSFTCLSNLSPSKSQKLLTMSDINKFNHYENCDSYQNKMLLNGLYNDEIYNFPE 475          
BLAST of NPHS1-7 vs. Planmine SMEST
Match: SMESG000016267.1 (SMESG000016267.1)

HSP 1 Score: 318.931 bits (816), Expect = 2.572e-91
Identity = 247/903 (27.35%), Postives = 417/903 (46.18%), Query Frame = 3
Query:  342 GETRDLYCVINKPVVVGDVFLICPLSPGLCLINCRGSNEYTKAIDCKTEQQSHETIFHYKIKFFEKHQGKWICQFRDWLSEPLAFRVKRNLSIESLTYYPNPIISGNNLTLTCSAIXXXXXXXXXXXXIIETST-NKTSHFDGIATDDWSAYLFISQVDWRLSVTAECLVYEKSNMIAFQRIPLVIHSLPSKVNIQLLGLKPENEIGDVLSIECSSVGGFPVPNYEIYIMREGKDFETFTEKTIILTKEDNNLLMKCRALQ-AGTHNFIESNVFMIHVFYPPDGLEMQXXXXXXXXXXXXXXXXCFTKSGSNPPATIQWTFMD---KNYKNHSLHXXXXXXXXXXXXGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEKLLNVIFSPDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVTAHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISDSFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKN-YSWMFCESRKS-TFAKENSNCKEIISN--SLSDI-SFQ--------TVTPKDSGKYQCLITDVSGKGFSGEF-FLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLISDNKDSLSIW-------NNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVENDFGLYVCKISNEIGFVYSYFWLVSENSCVIPQESITVLLDKNKAAITYQPPKVGHYSHVLLTMCEIQFSNSCQDIQIPHPSTGNVISPVLANIENYSFYLSVFQNSELKYKTESIRSFKNLNIRNSVTINFTIII-VVLCCFGILILV-LGISAFMIRKYKRQAKKTTLFNGNSF---NEHLCQEKQLL 2957
            G  +DL+C I        + L+CPL+ GLC+ +C  +    K I C  +  S + +F YK K F+  +G+W CQ+    S  L+ +V     I+SL   P P   G  L +TC  + +  +   F+  I++  T    ++      D +S  + I   +  L    +C+V+ +S +   + +   I+  PS++ +       + EIG ++S +CSS  G P P   +Y  R GK  +      +ILTK DN     C   + +G    + SN  MI V YPP+ +E+   P    +E++     C +K  S P + I+WT  D   +   N       +              S V     +  +G  I C  IY+   +   EK + V+F+P+ I +   P   I E +++ LTC    S+P S ++W +   G   ED+T+H++   M   Y G  + S L +H T+R      YKC+  H+     IS  + LN+LY P +++F       E ++V+L+C    GNP  I ++ + W FC    S  +  E+    EI  N   L D+ SF          V PKD G Y C   +    G + EF FL V F P L       +       I   V++ S PK  EI WF+  +++ S  ++       N  + ++ +D S       RF  +   N    L+IS I   D+G Y C++SN  G     F +   N   I + +I +  + NKA + + PP +GH++H+ L +C IQ S +C ++QI +P++G+    +  +   Y++ L V   S++   T  I+  ++++  + V ++  ++I V++   GIL+L+ + +   ++ K +R+  K      NS    N H  ++  +L
Sbjct:   41 GTEQDLFCSIETEEQTHRMLLLCPLTVGLCMTDCIEN----KDISCNRKTISGQIVFQYKFKVFKTFEGEWKCQYGGQSSRSLSLKVSDKPFIKSLAMTPKPAWKGKQLNITCQVMPMTGITGIFIQRILDDGTVENIANAIPYKVDQYSEGITIKAAEPDLHNKVQCIVHTESEISTAKILETNIYYFPSQLILTSSNPLKQYEIGSLISFQCSSDNGNPRPVVSLYKKRFGKKPQKQVSANVILTKYDNKAEFFCLMEKISGKSPNLTSNTIMILVHYPPEKIELNEEPVDNQLESQSKHFTCSSKGNSEPLSQIEWTLFDAYGRLVANSETFKILERVKKANPGALNTLESTVKMTLIRKYNGFKIKCSIIYQGLNMLNQEKQIKVVFAPNHISLIPDPQGGIPETRSVNLTCFTGSSNPSSNIQWFRTEPGKRPEDITSHSNKDMMPSNYSGIAIHSSLNIHGTNRQDHGTIYKCIVSHAYMNSEISKEYFLNVLYPPVIQLFSLPKIPNEGNFVQLQCQTSGGNPSIISQSQFQWKFCPVITSYEYKYEDQPNTEIRQNCYQLPDMFSFHHHHIFNITAVAPKDRGWYSCQCENAG--GVTVEFMFLNVYFSPILKHQTSSRVYVKSGSNIVLQVKWSSYPKIHEIKWFIKPNSRISARLYEPDHQAQNINEMKKRIDLS----PNSRFKLTI-VNSTIQLNISSITAYDYGDYFCEVSNSRGQSSIEFQIFPTNDISISESNIRLQFNANKATVYFDPPTIGHFTHMSLRVCLIQSSGTCSEMQINNPNSGHATISLPQSPSLYNYRLIVHNGSKVLQMTNIIQ--RDISSPHWVEMSLEMMIAVIIGVVGILVLLFVALMTLILLKCRRKKPKDNYLENNSVATTNSHQRRQDYML 930          
BLAST of NPHS1-7 vs. Planmine SMEST
Match: SMESG000035985.1 (SMESG000035985.1)

HSP 1 Score: 166.007 bits (419), Expect = 4.914e-48
Identity = 80/81 (98.77%), Postives = 81/81 (100.00%), Query Frame = 3
Query: 3108 MNMTPKGHSLDGFSNKSSNMETIKSQETSFTCLSNLSPSKSQKLLTMSDINKFNHYENCDSYQNKMLLNGLYNDEIYNFPE 3350
            MNMTPKGHSLDGFSNKSSNMET+KSQETSFTCLSNLSPSKSQKLLTMSDINKFNHYENCDSYQNKMLLNGLYNDEIYNFPE
Sbjct:    1 MNMTPKGHSLDGFSNKSSNMETLKSQETSFTCLSNLSPSKSQKLLTMSDINKFNHYENCDSYQNKMLLNGLYNDEIYNFPE 81          
The following BLAST results are available for this feature:
BLAST of NPHS1-7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPHS13.151e-1324.52NPHS1 adhesion molecule, nephrin [Source:HGNC Symb... [more]
NPHS14.192e-1324.52NPHS1 adhesion molecule, nephrin [Source:HGNC Symb... [more]
CD222.328e-725.86CD22 molecule [Source:HGNC Symbol;Acc:HGNC:1643][more]
CD229.232e-724.23CD22 molecule [Source:HGNC Symbol;Acc:HGNC:1643][more]
CD221.101e-623.57CD22 molecule [Source:HGNC Symbol;Acc:HGNC:1643][more]
back to top
BLAST of NPHS1-7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
syg-24.725e-625.29Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-24.755e-625.29Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
back to top
BLAST of NPHS1-7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hbs4.196e-1322.72gene:FBgn0029082 transcript:FBtr0087413[more]
hbs5.376e-1322.72gene:FBgn0029082 transcript:FBtr0087414[more]
hbs5.376e-1322.72gene:FBgn0029082 transcript:FBtr0345419[more]
side-VII7.509e-1124.08gene:FBgn0037736 transcript:FBtr0082170[more]
side-VII7.509e-1124.08gene:FBgn0037736 transcript:FBtr0331695[more]
back to top
BLAST of NPHS1-7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-152f2.21.585e-926.05si:ch211-152f2.2 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
cadm2a9.091e-828.35cell adhesion molecule 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
cadm2a1.003e-728.35cell adhesion molecule 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
cadm2a1.160e-728.35cell adhesion molecule 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
cadm2a1.311e-728.35cell adhesion molecule 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of NPHS1-7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdx15.024e-1023.51peroxiredoxin 1 [Source:Xenbase;Acc:XB-GENE-481165... [more]
prdx17.739e-1023.51peroxiredoxin 1 [Source:Xenbase;Acc:XB-GENE-481165... [more]
prdx18.414e-1023.51peroxiredoxin 1 [Source:Xenbase;Acc:XB-GENE-481165... [more]
prdx19.593e-1023.51peroxiredoxin 1 [Source:Xenbase;Acc:XB-GENE-481165... [more]
prdx13.826e-922.32peroxiredoxin 1 [Source:Xenbase;Acc:XB-GENE-481165... [more]
back to top
BLAST of NPHS1-7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nphs11.331e-1123.57nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:18... [more]
Nphs11.583e-1123.57nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:18... [more]
Cd228.008e-921.80CD22 antigen [Source:MGI Symbol;Acc:MGI:88322][more]
Pxdn3.759e-721.88peroxidasin [Source:MGI Symbol;Acc:MGI:1916925][more]
Pxdn3.986e-721.88peroxidasin [Source:MGI Symbol;Acc:MGI:1916925][more]
back to top
BLAST of NPHS1-7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60500|NPHN_HUMAN1.513e-1224.52Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 PE=1 SV=1[more]
sp|Q9R044|NPHN_RAT4.270e-1224.28Nephrin OS=Rattus norvegicus OX=10116 GN=Nphs1 PE=... [more]
sp|Q9QZS7|NPHN_MOUSE1.107e-1023.57Nephrin OS=Mus musculus OX=10090 GN=Nphs1 PE=1 SV=... [more]
sp|Q9N1E3|CD22_PONPY2.846e-828.95B-cell receptor CD22 (Fragment) OS=Pongo pygmaeus ... [more]
sp|P36335|NCA12_XENLA3.054e-821.73Neural cell adhesion molecule 1-B OS=Xenopus laevi... [more]
back to top
BLAST of NPHS1-7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKM46.590e-8827.69NPHS1-7 OS=Schmidtea mediterranea OX=79327 GN=NPHS... [more]
A0A504YN652.357e-3922.12Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A4E0RP054.653e-3821.87Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
G7Y8F21.582e-2924.37Cell adhesion molecule 2 OS=Clonorchis sinensis OX... [more]
A0A4S2LUT71.565e-2722.73Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of NPHS1-7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036142.13.300e-929.41pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
si:dkey-33i11.12.615e-830.00B-cell receptor CD22 [Source:NCBI gene;Acc:1030285... [more]
ENSAMXT00000050572.12.242e-726.70pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000001412.25.724e-726.28pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000047510.11.164e-629.01pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of NPHS1-7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004392.11.746e-621.28pep scaffold:Pmarinus_7.0:GL476636:579022:606187:1... [more]
back to top
BLAST of NPHS1-7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHS1-7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO495573.084e-621.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NPHS1-7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mag1.310e-922.82myelin associated glycoprotein [Source:NCBI gene;A... [more]
mag1.597e-922.82myelin associated glycoprotein [Source:NCBI gene;A... [more]
ENSORLT00000038552.12.386e-924.46B-cell receptor CD22-like [Source:NCBI gene;Acc:10... [more]
ENSORLT00000046542.12.430e-924.46B-cell receptor CD22-like [Source:NCBI gene;Acc:10... [more]
ENSORLT00000031495.13.340e-924.44B-cell receptor CD22-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of NPHS1-7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000035985.10.000e+088.45SMESG000035985.1[more]
SMESG000016267.12.572e-9127.35SMESG000016267.1[more]
SMESG000035985.14.914e-4898.77SMESG000035985.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035538 ID=SMED30035538|Name=NPHS1-7|organism=Schmidtea mediterranea sexual|type=transcript|length=3431bp
CCGATCTCGTTTTTTATGAAAAATGATTTATTCATTTAAATTGTATTTAT
ACGATGTTTTTATTACTCAATATCAATCTTGATGCCAACAACCACTCGTA
TGATTGCGCAACCGAGAATTATTGAATCTAAAAGAATCCGTTCGACATAC
AGATGGAACAAAAGATATTTTGTTGTGTCTTTGACATTTCTTGCACACAA
ATTCAGAGAATTATATATCAATGTTTGACATGCGCGTTTCTTTGGTTCTA
TCTTTTTGAAACAGTACACAGTCATAAAAATATAAAATTGCAAGTAAAGG
AGTCCAAAGAAAATATAAGCGATTTTTACACAATTCCGCATGGTGAAACC
CGCGATTTATATTGCGTTATCAACAAACCGGTTGTCGTCGGTGACGTTTT
TCTAATATGTCCACTGAGTCCGGGTTTGTGTCTAATAAACTGCAGAGGAT
CCAATGAATATACGAAAGCCATAGATTGCAAAACTGAACAGCAATCTCAT
GAAACAATATTTCATTACAAAATAAAGTTTTTTGAAAAACACCAAGGAAA
ATGGATATGCCAATTTAGAGATTGGCTTAGTGAACCGTTGGCGTTCAGAG
TAAAACGAAATCTCTCGATTGAATCACTTACGTATTATCCGAATCCAATT
ATTTCAGGAAACAATCTTACATTAACCTGTTCAGCAATTAAATTAAAAAA
CGTAAAGCTTAAATTTCTTTTTAATATCATAGAAACTTCAACCAATAAAA
CGTCGCATTTTGACGGAATAGCTACGGATGATTGGAGCGCATATCTCTTT
ATTTCTCAAGTTGATTGGCGTTTAAGTGTAACTGCAGAGTGTTTAGTCTA
TGAAAAGTCAAATATGATTGCATTTCAAAGGATTCCTCTAGTTATTCACA
GTCTACCGTCAAAAGTAAATATTCAATTACTTGGACTGAAACCAGAAAAC
GAAATTGGAGATGTTTTATCAATAGAATGTTCTTCTGTTGGAGGTTTTCC
GGTTCCAAATTATGAAATATATATCATGAGAGAAGGAAAAGATTTTGAAA
CTTTTACGGAAAAGACTATTATTTTAACAAAAGAAGATAATAATCTCTTA
ATGAAGTGTCGAGCTTTGCAAGCTGGAACTCATAATTTTATCGAATCAAA
TGTTTTTATGATACATGTTTTTTATCCTCCTGATGGCTTGGAAATGCAAA
TTATTCCAGAAAAAGAAATTATAGAAAATAAAAAAATTAAATCCATCTGT
TTTACTAAATCTGGAAGCAATCCTCCAGCCACTATTCAGTGGACTTTCAT
GGATAAAAATTATAAAAATCACTCTTTACATTTTCGTTCTAAATTCAAAA
CATTTACCAAAAGATTCGGAGAAGCAATTACTAGTTCAGTCGTTGATTTT
ATTGCAAACAAAAATCAAAGTGGAATTATTATAAATTGTGACGCCATTTA
TAAGAATAATATTATCCCAGGACCAGAAAAACTTCTCAATGTTATTTTTT
CTCCTGATGCAATAAAAATTACCATAAAACCGAATTCATCCATAATGGAA
AACCAAACAATAATATTAACCTGCAGTGTTTCAGAATCGCATCCAGTGTC
AGAATTAAAATGGGTAAAGATAAATAAAGGAATATTTAATGAAGATGTCA
CTGCACATGCTTCATTGAAAACGATGACAGGCTTTTATGGAGGGCAACAG
CTAAAAAGTGAACTGATAGTTCACGAAACTAGCAGGAGCTCTCAAAATGT
GGAATACAAATGTTTATCTTTTCATTCAAAAACAGGGGTAACCATATCAG
ATAGTTTTGTCCTGAATATACTATATAATCCATCAGTGAAAATTTTTCCG
TCTTCTAATAAAATTAAAGAAAGTGATTATGTGGAGCTGAGATGTAATTT
GATTCAAGGAAATCCAAAATTTATTATCAAAAATTATTCCTGGATGTTTT
GTGAATCTAGGAAATCAACTTTTGCTAAAGAAAATTCTAACTGCAAAGAA
ATTATTTCAAATTCTCTGTCAGACATTTCATTCCAAACGGTTACCCCAAA
GGATAGTGGCAAGTATCAGTGTCTTATCACGGATGTATCCGGAAAGGGTT
TTAGTGGCGAATTCTTTCTTGAAGTTGAATTTCAACCTAGATTACTTAGC
ACCTTTAAGAAAGTGATTAAAACCCTTCCTAAAGAACCAATAAATTTTGT
GGTTCAATTTATTTCCAAACCAAAAAAAGTCGAAATTTCATGGTTTTTGA
TATCTGACAACAAGGATTCGTTGTCTATTTGGAATAATGAAAAATTTGAA
AGAATTTTGGACTTTTCTACTATAATTGTTTCGGAAGGAAGATTTCATTC
ATCATTCAATGAGAACGGATTTACCACTTTATCTATTTCTGAAATTGTAG
AAAACGATTTCGGACTGTACGTTTGTAAGATATCAAATGAAATTGGTTTC
GTGTACTCTTATTTTTGGTTGGTCTCGGAAAATTCTTGTGTCATTCCGCA
GGAGAGCATAACTGTGTTGCTGGATAAAAACAAAGCTGCCATTACCTATC
AACCGCCGAAAGTCGGTCATTATTCTCATGTTTTGTTAACCATGTGTGAA
ATCCAATTTTCCAATTCATGTCAGGATATTCAGATTCCACATCCAAGCAC
GGGAAATGTAATTTCACCCGTCTTGGCAAATATTGAAAATTACTCATTTT
ACTTGTCTGTTTTCCAAAATTCAGAATTAAAATATAAAACTGAATCTATT
CGGAGTTTTAAAAATTTGAACATTCGGAATTCAGTTACAATAAACTTTAC
GATCATAATTGTCGTCCTATGTTGTTTTGGAATTCTTATCCTCGTCTTGG
GGATCTCCGCGTTCATGATTAGGAAATACAAACGACAAGCCAAAAAAACT
ACTCTATTTAACGGCAATTCTTTCAATGAACACCTGTGTCAAGAAAAACA
GCTTCTACACCTTAGAAATAGGTCTGGTTTATTACAATCAACTTCTTCAA
TGTTGTCACCACCAAAAAGTCAGTCAAGTCTTCTCTCTCAAAATTCATAT
CAAATGAATTTTGTTCCACACGAATACCCAGTTTCAGACAGTAAAAGTCA
TGTCTATATGAATATGACGCCAAAAGGTCATAGTCTGGATGGGTTCTCAA
ATAAAAGTTCTAACATGGAAACAATTAAGAGTCAGGAAACCAGTTTCACA
TGTTTATCAAATCTTAGCCCTTCCAAATCTCAAAAACTACTGACTATGTC
TGATATAAACAAATTTAATCATTACGAGAATTGTGATTCTTATCAGAACA
AAATGTTGTTGAACGGACTTTACAATGATGAAATTTATAACTTTCCGGAA
GTAAATCAAAATATTCCAAATAATTAGAATGTTGTTGCAACTGAAGATTA
AAATGTTTAAATAAAGCGATGACACATGTAA
back to top

protein sequence of SMED30035538-orf-1

>SMED30035538-orf-1 ID=SMED30035538-orf-1|Name=SMED30035538-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1075bp
MEQKIFCCVFDISCTQIQRIIYQCLTCAFLWFYLFETVHSHKNIKLQVKE
SKENISDFYTIPHGETRDLYCVINKPVVVGDVFLICPLSPGLCLINCRGS
NEYTKAIDCKTEQQSHETIFHYKIKFFEKHQGKWICQFRDWLSEPLAFRV
KRNLSIESLTYYPNPIISGNNLTLTCSAIKLKNVKLKFLFNIIETSTNKT
SHFDGIATDDWSAYLFISQVDWRLSVTAECLVYEKSNMIAFQRIPLVIHS
LPSKVNIQLLGLKPENEIGDVLSIECSSVGGFPVPNYEIYIMREGKDFET
FTEKTIILTKEDNNLLMKCRALQAGTHNFIESNVFMIHVFYPPDGLEMQI
IPEKEIIENKKIKSICFTKSGSNPPATIQWTFMDKNYKNHSLHFRSKFKT
FTKRFGEAITSSVVDFIANKNQSGIIINCDAIYKNNIIPGPEKLLNVIFS
PDAIKITIKPNSSIMENQTIILTCSVSESHPVSELKWVKINKGIFNEDVT
AHASLKTMTGFYGGQQLKSELIVHETSRSSQNVEYKCLSFHSKTGVTISD
SFVLNILYNPSVKIFPSSNKIKESDYVELRCNLIQGNPKFIIKNYSWMFC
ESRKSTFAKENSNCKEIISNSLSDISFQTVTPKDSGKYQCLITDVSGKGF
SGEFFLEVEFQPRLLSTFKKVIKTLPKEPINFVVQFISKPKKVEISWFLI
SDNKDSLSIWNNEKFERILDFSTIIVSEGRFHSSFNENGFTTLSISEIVE
NDFGLYVCKISNEIGFVYSYFWLVSENSCVIPQESITVLLDKNKAAITYQ
PPKVGHYSHVLLTMCEIQFSNSCQDIQIPHPSTGNVISPVLANIENYSFY
LSVFQNSELKYKTESIRSFKNLNIRNSVTINFTIIIVVLCCFGILILVLG
ISAFMIRKYKRQAKKTTLFNGNSFNEHLCQEKQLLHLRNRSGLLQSTSSM
LSPPKSQSSLLSQNSYQMNFVPHEYPVSDSKSHVYMNMTPKGHSLDGFSN
KSSNMETIKSQETSFTCLSNLSPSKSQKLLTMSDINKFNHYENCDSYQNK
MLLNGLYNDEIYNFPEVNQNIPNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR013162CD80_C2-set
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0030246carbohydrate binding
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 566..659
e-value: 0.0044
score: 26.2
coord: 459..557
e-value: 8.2
score: 12.2
coord: 669..776
e-value: 2.3
score: 17.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 563..667
e-value: 8.5E-8
score: 34.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 670..776
e-value: 3.3E-7
score: 32.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 453..562
e-value: 9.5E-11
score: 43.9
NoneNo IPR availablePANTHERPTHR23278SIDESTEP PROTEINcoord: 449..767
NoneNo IPR availableTMHMMTMhelixcoord: 884..906
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 560..651
score: 9.264
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 662..787
score: 6.905
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 451..549
score: 10.608
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 559..663
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 451..560
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 655..773