BED-type domain-containing protein

Overview
NameBED-type domain-containing protein
Smed IDSMED30035514
Length (bp)2912
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BED-type domain-containing protein (SMED30035514) t-SNE clustered cells

Violin plots show distribution of expression levels for BED-type domain-containing protein (SMED30035514) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BED-type domain-containing protein (SMED30035514) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BED-type domain-containing protein (SMED30035514) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035514

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035514SMESG000004641.1 SmedASXL_016041SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30035514SMESG000004641.1 dd_Smed_v6_13156_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30035514SMESG000017256.1 Contig5884newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035514SMESG000017256.1 Contig5884uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30035514SMESG000004641.1 dd_Smed_v4_13156_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BED-type domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 56.6102 bits (135), Expect = 2.618e-13
Identity = 76/339 (22.42%), Postives = 133/339 (39.23%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS 1605
            +G   IV++LL++ A+P   T  +  TPLH S     +D                   +S +LE        TK     L +      LD  +       +    +      N +  +   ++ + +++  +LL    + + T     + L +A + N + + S LL  G++ NI   Q +T L  + Q+ H  M  LL++ GANI+ +    L           S+H+A           L   GA+          ++  T +    L +     ++  +NFLL+ G N+ +KT  G TP   A +       N+LL  G   NA  A   + L ++
Sbjct:  412 LGKTEIVQLLLQHMAHPDAATT-NGYTPLHISAREGQVD------------------VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKL-----LLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLT----------SLHLAAQEDKVNVADILTKHGAD----------QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA 706          

HSP 2 Score: 40.0466 bits (92), Expect = 2.618e-13
Identity = 24/79 (30.38%), Postives = 42/79 (53.16%), Query Frame = 2
Query:  317 NPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 553
            +PLH+    DH++C+K L+Q  K  ++  + +   TAL +A          +LL+  ANPN   +  ++ L  AA+ G+
Sbjct:  305 SPLHMAAQGDHVECVKHLLQH-KAPVDDVT-LDYLTALHVAAHCGHYRVTKLLLDKRANPNARALRGETALHMAARAGQ 381          
BLAST of BED-type domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 56.9954 bits (136), Expect = 1.745e-12
Identity = 76/339 (22.42%), Postives = 133/339 (39.23%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS 1605
            +G   IV++LL++ A+P   T  +  TPLH S     +D                   +S +LE        TK     L +      LD  +       +    +      N +  +   ++ + +++  +LL    + + T     + L +A + N + + S LL  G++ NI   Q +T L  + Q+ H  M  LL++ GANI+ +    L           S+H+A           L   GA+          ++  T +    L +     ++  +NFLL+ G N+ +KT  G TP   A +       N+LL  G   NA  A   + L ++
Sbjct:  486 LGKTEIVQLLLQHMAHPDAATT-NGYTPLHISAREGQVD------------------VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKL-----LLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLT----------SLHLAAQEDKVNVADILTKHGAD----------QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA 780          

HSP 2 Score: 36.5798 bits (83), Expect = 1.745e-12
Identity = 24/94 (25.53%), Postives = 44/94 (46.81%), Query Frame = 2
Query:  275 KFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 556
            K+  S   +      P+H+     HL+ + +L+Q         + I  +TAL +A    ++E V  LL +GA  +      ++PL  A++ G+T
Sbjct:  398 KYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGAS--PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKT 489          
BLAST of BED-type domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 57.3806 bits (137), Expect = 1.827e-12
Identity = 76/339 (22.42%), Postives = 133/339 (39.23%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS 1605
            +G   IV++LL++ A+P   T  +  TPLH S     +D                   +S +LE        TK     L +      LD  +       +    +      N +  +   ++ + +++  +LL    + + T     + L +A + N + + S LL  G++ NI   Q +T L  + Q+ H  M  LL++ GANI+ +    L           S+H+A           L   GA          +++  T +    L +     ++  +NFLL+ G N+ +KT  G TP   A +       N+LL  G   NA  A   + L ++
Sbjct:  486 LGKTEIVQLLLQHMAHPDAATT-NGYTPLHISAREGQVD------------------VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKL-----LLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLT----------SLHLAAQEDKVNVADILTKHGA----------DQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA 780          

HSP 2 Score: 36.1946 bits (82), Expect = 1.827e-12
Identity = 24/94 (25.53%), Postives = 44/94 (46.81%), Query Frame = 2
Query:  275 KFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 556
            K+  S   +      P+H+     HL+ + +L+Q         + I  +TAL +A    ++E V  LL +GA  +      ++PL  A++ G+T
Sbjct:  398 KYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGAS--PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKT 489          
BLAST of BED-type domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 56.9954 bits (136), Expect = 2.177e-12
Identity = 76/339 (22.42%), Postives = 133/339 (39.23%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS 1605
            +G   IV++LL++ A+P   T  +  TPLH S     +D                   +S +LE        TK     L +      LD  +       +    +      N +  +   ++ + +++  +LL    + + T     + L +A + N + + S LL  G++ NI   Q +T L  + Q+ H  M  LL++ GANI+ +    L           S+H+A           L   GA+          ++  T +    L +     ++  +NFLL+ G N+ +KT  G TP   A +       N+LL  G   NA  A   + L ++
Sbjct:  478 LGKTEIVQLLLQHMAHPDAATT-NGYTPLHISAREGQVD------------------VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKL-----LLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLT----------SLHLAAQEDKVNVADILTKHGAD----------QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA 772          

HSP 2 Score: 36.5798 bits (83), Expect = 2.177e-12
Identity = 24/94 (25.53%), Postives = 44/94 (46.81%), Query Frame = 2
Query:  275 KFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 556
            K+  S   +      P+H+     HL+ + +L+Q         + I  +TAL +A    ++E V  LL +GA  +      ++PL  A++ G+T
Sbjct:  390 KYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGAS--PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKT 481          
BLAST of BED-type domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 56.6102 bits (135), Expect = 2.287e-12
Identity = 76/339 (22.42%), Postives = 133/339 (39.23%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS 1605
            +G   IV++LL++ A+P   T  +  TPLH S     +D                   +S +LE        TK     L +      LD  +       +    +      N +  +   ++ + +++  +LL    + + T     + L +A + N + + S LL  G++ NI   Q +T L  + Q+ H  M  LL++ GANI+ +    L           S+H+A           L   GA+          ++  T +    L +     ++  +NFLL+ G N+ +KT  G TP   A +       N+LL  G   NA  A   + L ++
Sbjct:  522 LGKTEIVQLLLQHMAHPDAATT-NGYTPLHISAREGQVD------------------VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKL-----LLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLT----------SLHLAAQEDKVNVADILTKHGAD----------QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA 816          

HSP 2 Score: 36.5798 bits (83), Expect = 2.287e-12
Identity = 24/94 (25.53%), Postives = 44/94 (46.81%), Query Frame = 2
Query:  275 KFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 556
            K+  S   +      P+H+     HL+ + +L+Q         + I  +TAL +A    ++E V  LL +GA  +      ++PL  A++ G+T
Sbjct:  434 KYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGAS--PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKT 525          
BLAST of BED-type domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.6102 bits (135), Expect = 1.161e-7
Identity = 81/360 (22.50%), Postives = 142/360 (39.44%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCI--SNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVET--NVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVD 1659
            GH+ + ++LL+ GAN      RH I+PLH +      N+ NL                       ++RG I  ++    L  +  +A    D   +  + +   + ++ K   N +  +   +  +  +    LL HR  +++      + L +A     + +   LL R +DPN       T L  + +K   K+ ELL+ Y A I               +    +HVA          +L+ +GAN           +VET    T LHLA   ++N  + +  L+  G  ++++  +  TP   A R    +   LLL  G + NA    N S L ++A +   ++   LL +  D
Sbjct:  238 GHENVGQLLLEKGANVNY-QARHNISPLHVATKWGRTNMANLL----------------------LSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTK---NGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT----------ESGLTPLHVAAFMGAINIVIYLLQQGAN----------PDVETVRGETPLHLAA--RANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD 549          

HSP 2 Score: 45.8246 bits (107), Expect = 5.061e-6
Identity = 30/79 (37.97%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  320 PLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 553
            PLHL    +  D +++LI+  AKV  ++R +   +T L +A  L   + V +LL++GAN N     N SPL  AAK G+
Sbjct:  461 PLHLAARANQTDVVRVLIRNGAKVDAQAREL---QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          

HSP 3 Score: 24.6386 bits (52), Expect = 5.061e-6
Identity = 14/36 (38.89%), Postives = 21/36 (58.33%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNN 699
            G+  +V +LL+ G    I  K +Q+TPLH +   NN
Sbjct:  568 GNLEVVRLLLERGTPVDIEGK-NQVTPLHVAAHYNN 602          
BLAST of BED-type domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.6102 bits (135), Expect = 1.161e-7
Identity = 81/360 (22.50%), Postives = 142/360 (39.44%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCI--SNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVET--NVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVD 1659
            GH+ + ++LL+ GAN      RH I+PLH +      N+ NL                       ++RG I  ++    L  +  +A    D   +  + +   + ++ K   N +  +   +  +  +    LL HR  +++      + L +A     + +   LL R +DPN       T L  + +K   K+ ELL+ Y A I               +    +HVA          +L+ +GAN           +VET    T LHLA   ++N  + +  L+  G  ++++  +  TP   A R    +   LLL  G + NA    N S L ++A +   ++   LL +  D
Sbjct:  238 GHENVGQLLLEKGANVNY-QARHNISPLHVATKWGRTNMANLL----------------------LSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTK---NGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT----------ESGLTPLHVAAFMGAINIVIYLLQQGAN----------PDVETVRGETPLHLAA--RANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD 549          

HSP 2 Score: 45.8246 bits (107), Expect = 5.061e-6
Identity = 30/79 (37.97%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  320 PLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 553
            PLHL    +  D +++LI+  AKV  ++R +   +T L +A  L   + V +LL++GAN N     N SPL  AAK G+
Sbjct:  461 PLHLAARANQTDVVRVLIRNGAKVDAQAREL---QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          

HSP 3 Score: 24.6386 bits (52), Expect = 5.061e-6
Identity = 14/36 (38.89%), Postives = 21/36 (58.33%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNN 699
            G+  +V +LL+ G    I  K +Q+TPLH +   NN
Sbjct:  568 GNLEVVRLLLERGTPVDIEGK-NQVTPLHVAAHYNN 602          
BLAST of BED-type domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 53.9138 bits (128), Expect = 7.500e-7
Identity = 81/360 (22.50%), Postives = 142/360 (39.44%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCV--LEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVET--NVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVD 1659
            GH+ + ++LL+ GAN      RH I+PLH +                        W  + +  L ++RG I  ++    L  +  +A    D   +  + +   + ++ K   N +  +   +  +  +    LL HR  +++      + L +A     + +   LL R +DPN       T L  + +K   K+ ELL+ Y A I       L            +HVA          +L+ +GAN           +VET    T LHLA   ++N  + +  L+  G  ++++  +  TP   A R    +   LLL  G + NA    N S L ++A +   ++   LL +  D
Sbjct:  238 GHENVGQLLLEKGANVNY-QARHNISPLHVAT----------------------KWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTK---NGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLT----------PLHVAAFMGAINIVIYLLQQGANP----------DVETVRGETPLHLAA--RANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD 549          

HSP 2 Score: 47.3654 bits (111), Expect = 7.731e-6
Identity = 30/79 (37.97%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  320 PLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 553
            PLHL    +  D +++LI+  AKV  ++R +   +T L +A  L   + V +LL++GAN N     N SPL  AAK G+
Sbjct:  461 PLHLAARANQTDVVRVLIRNGAKVDAQAREL---QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          

HSP 3 Score: 22.3274 bits (46), Expect = 7.731e-6
Identity = 13/32 (40.62%), Postives = 19/32 (59.38%), Query Frame = 1
Query:  604 IVEVLLKYGANPRIGTKRHQITPLHASCISNN 699
            +V +LL+ G    I  K +Q+TPLH +   NN
Sbjct:  572 VVRLLLERGTPVDIEGK-NQVTPLHVAAHYNN 602          
BLAST of BED-type domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 53.9138 bits (128), Expect = 7.500e-7
Identity = 81/360 (22.50%), Postives = 142/360 (39.44%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCV--LEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVET--NVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVD 1659
            GH+ + ++LL+ GAN      RH I+PLH +                        W  + +  L ++RG I  ++    L  +  +A    D   +  + +   + ++ K   N +  +   +  +  +    LL HR  +++      + L +A     + +   LL R +DPN       T L  + +K   K+ ELL+ Y A I       L            +HVA          +L+ +GAN           +VET    T LHLA   ++N  + +  L+  G  ++++  +  TP   A R    +   LLL  G + NA    N S L ++A +   ++   LL +  D
Sbjct:  238 GHENVGQLLLEKGANVNY-QARHNISPLHVAT----------------------KWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTK---NGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLT----------PLHVAAFMGAINIVIYLLQQGANP----------DVETVRGETPLHLAA--RANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD 549          

HSP 2 Score: 47.3654 bits (111), Expect = 7.731e-6
Identity = 30/79 (37.97%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  320 PLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 553
            PLHL    +  D +++LI+  AKV  ++R +   +T L +A  L   + V +LL++GAN N     N SPL  AAK G+
Sbjct:  461 PLHLAARANQTDVVRVLIRNGAKVDAQAREL---QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          

HSP 3 Score: 22.3274 bits (46), Expect = 7.731e-6
Identity = 13/32 (40.62%), Postives = 19/32 (59.38%), Query Frame = 1
Query:  604 IVEVLLKYGANPRIGTKRHQITPLHASCISNN 699
            +V +LL+ G    I  K +Q+TPLH +   NN
Sbjct:  572 VVRLLLERGTPVDIEGK-NQVTPLHVAAHYNN 602          
BLAST of BED-type domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 53.9138 bits (128), Expect = 7.550e-7
Identity = 81/360 (22.50%), Postives = 142/360 (39.44%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCV--LEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVET--NVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVD 1659
            GH+ + ++LL+ GAN      RH I+PLH +                        W  + +  L ++RG I  ++    L  +  +A    D   +  + +   + ++ K   N +  +   +  +  +    LL HR  +++      + L +A     + +   LL R +DPN       T L  + +K   K+ ELL+ Y A I       L            +HVA          +L+ +GAN           +VET    T LHLA   ++N  + +  L+  G  ++++  +  TP   A R    +   LLL  G + NA    N S L ++A +   ++   LL +  D
Sbjct:  238 GHENVGQLLLEKGANVNY-QARHNISPLHVAT----------------------KWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTK---NGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLT----------PLHVAAFMGAINIVIYLLQQGANP----------DVETVRGETPLHLAA--RANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD 549          

HSP 2 Score: 47.3654 bits (111), Expect = 7.860e-6
Identity = 30/79 (37.97%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  320 PLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 553
            PLHL    +  D +++LI+  AKV  ++R +   +T L +A  L   + V +LL++GAN N     N SPL  AAK G+
Sbjct:  461 PLHLAARANQTDVVRVLIRNGAKVDAQAREL---QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          

HSP 3 Score: 22.3274 bits (46), Expect = 7.860e-6
Identity = 13/32 (40.62%), Postives = 19/32 (59.38%), Query Frame = 1
Query:  604 IVEVLLKYGANPRIGTKRHQITPLHASCISNN 699
            +V +LL+ G    I  K +Q+TPLH +   NN
Sbjct:  572 VVRLLLERGTPVDIEGK-NQVTPLHVAAHYNN 602          
BLAST of BED-type domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 64.6994 bits (156), Expect = 2.738e-10
Identity = 62/253 (24.51%), Postives = 116/253 (45.85%), Query Frame = 1
Query:  967 KELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSN------VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQ 1668
            +E++ +LL H  ++N  +    + L++A Q N   +V  LL  G++ ++      T L  ++Q+ H K+  +L+             +  A  ++     L+L N         +    +H+A  Y +Q     LI KGA++  +         + N++ LH+A   K    N ++ LLE G NIE+KT  G TP   A R    +  ++LL RG   +A      + L ++A  ++ D  + LL ++  +++
Sbjct:   90 EEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSA--------KHNISPLHVAA--KWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDE 332          
BLAST of BED-type domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 64.6994 bits (156), Expect = 3.859e-10
Identity = 62/253 (24.51%), Postives = 116/253 (45.85%), Query Frame = 1
Query:  967 KELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSN------VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQ 1668
            +E++ +LL H  ++N  +    + L++A Q N   +V  LL  G++ ++      T L  ++Q+ H K+  +L+             +  A  ++     L+L N         +    +H+A  Y +Q     LI KGA++  +         + N++ LH+A   K    N ++ LLE G NIE+KT  G TP   A R    +  ++LL RG   +A      + L ++A  ++ D  + LL ++  +++
Sbjct:   90 EEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSA--------KHNISPLHVAA--KWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDE 332          
BLAST of BED-type domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303117)

HSP 1 Score: 64.6994 bits (156), Expect = 4.949e-10
Identity = 63/253 (24.90%), Postives = 116/253 (45.85%), Query Frame = 1
Query:  967 KELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQ 1668
            +E++ +LL H  ++N  +    + L++A Q N   +V  LL  G++ ++      T L  ++Q+ H K+  +L+             +  A  ++     L+L N    +  S      +H+A  Y +Q     LI KGA++            + N++ LH+A   K    N ++ LLE G NIE+KT  G TP   A R    +  ++LL RG   +A      + L ++A  ++ D  + LL ++  +++
Sbjct:   90 EEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADV--------NYSAKHNISPLHVAA--KWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDE 332          
BLAST of BED-type domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303121)

HSP 1 Score: 64.6994 bits (156), Expect = 4.952e-10
Identity = 63/253 (24.90%), Postives = 116/253 (45.85%), Query Frame = 1
Query:  967 KELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQ 1668
            +E++ +LL H  ++N  +    + L++A Q N   +V  LL  G++ ++      T L  ++Q+ H K+  +L+             +  A  ++     L+L N    +  S      +H+A  Y +Q     LI KGA++            + N++ LH+A   K    N ++ LLE G NIE+KT  G TP   A R    +  ++LL RG   +A      + L ++A  ++ D  + LL ++  +++
Sbjct:   90 EEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADV--------NYSAKHNISPLHVAA--KWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDE 332          
BLAST of BED-type domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303123)

HSP 1 Score: 64.6994 bits (156), Expect = 4.958e-10
Identity = 63/253 (24.90%), Postives = 116/253 (45.85%), Query Frame = 1
Query:  967 KELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQ 1668
            +E++ +LL H  ++N  +    + L++A Q N   +V  LL  G++ ++      T L  ++Q+ H K+  +L+             +  A  ++     L+L N    +  S      +H+A  Y +Q     LI KGA++            + N++ LH+A   K    N ++ LLE G NIE+KT  G TP   A R    +  ++LL RG   +A      + L ++A  ++ D  + LL ++  +++
Sbjct:   90 EEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADV--------NYSAKHNISPLHVAA--KWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDE 332          
BLAST of BED-type domain-containing protein vs. Ensembl Zebrafish
Match: asb2a.1 (ankyrin repeat and SOCS box containing 2a, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-5355])

HSP 1 Score: 53.1434 bits (126), Expect = 1.657e-13
Identity = 29/81 (35.80%), Postives = 46/81 (56.79%), Query Frame = 2
Query:  308 DAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 550
            D W PLH    + H++CLK+L++     I  R+    +T LILA     +  V  LLE GA+PN+ +   ++PL+ A ++G
Sbjct:  155 DGWLPLHECACNGHVECLKVLLKAKPDTINKRTH-RNQTPLILAVGRKHVACVEHLLEQGADPNIANNQWETPLYKACEKG 234          

HSP 2 Score: 43.5134 bits (101), Expect = 1.657e-13
Identity = 76/334 (22.75%), Postives = 143/334 (42.81%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKR--HQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDG-----VSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPF----LFAIRYSKIEACNLLLFRGCD 1560
            G++ IVE+LL+YGA P   TK     +TPLH +  +  ++                    SC + I+ G       N + +  L +A   + V        +NYL+ +   +INS    D       S N   +++ ILL+ R + N+ N      + +A +     +V+ L+ + S   + R+  I+ L F+ ++    + E+LI  G ++N  +  D    +    + A ++ A++  + E    L++ GA+  L  D+ +            L + ++  ++  +  L++ G N+ +      T F    +F +RY  I     LL  GCD
Sbjct:  234 GNEEIVELLLRYGATP---TKACVQGLTPLHEAVRNKMLE--------------------SCKMLIHAG-AKLWAQNVYGIDSLFTAAQCNAVDV------LNYLIHKGG-NINSKANDDATALFEASKNGHVQVVKILLSKRADANKANKSGLLPIHIASKNGHESIVAMLIPKTSTTKVRRSG-ISPLHFAAERNRDDVLEILIEAGYDVNAMLSDDWSKLHEDRRSTA-LYSAVVNRNIEAAIMLLEAGADPNL--DIFNP-----------LLVAVRKGNIEMVTLLVKYGANVNAMLPTHPTSFPAALVFCMRY--IMMMKYLLDNGCD 519          

HSP 3 Score: 59.6918 bits (143), Expect = 1.328e-8
Identity = 63/232 (27.16%), Postives = 107/232 (46.12%), Query Frame = 1
Query:  958 NNGKELIDILLAHRIN-INETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGL--ILSAIKKNHDIMKCLL 1644
            N   E + +LL  + + IN+   +N++ L LAV    +  V +LL +G+DPNI  NQ  T L  + +K ++++ ELL+ YGA   +     L            +H A+     E+ + LI  GA L+           +    +  L    + N+++ +N+L+  G NI SK +   T    A +   ++   +LL +  D    N  N+SGL  I  A K  H+ +  +L
Sbjct:  166 NGHVECLKVLLKAKPDTINKRTHRNQTPLILAVGRKHVACVEHLLEQGADPNIANNQWETPLYKACEKGNEEIVELLLRYGATPTKACVQGLT----------PLHEAVRNKMLESCKMLIHAGAKLW----------AQNVYGIDSLFTAAQCNAVDVLNYLIHKGGNINSKANDDATALFEASKNGHVQVVKILLSKRAD---ANKANKSGLLPIHIASKNGHESIVAML 374          
BLAST of BED-type domain-containing protein vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 48.521 bits (114), Expect = 6.485e-12
Identity = 37/143 (25.87%), Postives = 67/143 (46.85%), Query Frame = 2
Query:  149 CKFVKAWLHGLLYESTGWQLLDKSELIE-----PVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 559
            C + ++     L+  TG+  L  +   E      ++L++ +   F  K  +S T +LL+  +P+H+    DH+DC++ L+Q  A++       +   T L +A        V VLL+ GA  N   ++  +PL  A K+   R
Sbjct:  243 CTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK--VSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMR 380          

HSP 2 Score: 42.743 bits (99), Expect = 6.485e-12
Identity = 74/377 (19.63%), Postives = 140/377 (37.14%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPR--IGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHI----KKINYLLSEYKVDINSVCTVDG-----VSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYAY 1686
            +GH  IV+ LL+ GA+P   I +  +  TPLH +  + + +     +Q                   N  Q++    +             D    +C      K++  LL E+K + +S  T         +     +   ILL       +   K  + L +A +   + +   LL RG++PN      +T L  ++   +  + +LL++ G + +          +       ++H+A   +  E    L+  GAN           E    +T LHLA   +    + +  L+    N+      G TP     +   +   ++L+ +G    A + +  + L ++    N  ++K LLQ Q  +N K    Y
Sbjct:  409 MGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQ-------------------NNAQVDAKAKD-------------DQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPH----------STARNGYTALHIAAKQNQLEVASSLLQYGANA--------NSESLQGITPLHLAS--QEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGY 733          
BLAST of BED-type domain-containing protein vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 48.521 bits (114), Expect = 7.149e-12
Identity = 37/143 (25.87%), Postives = 67/143 (46.85%), Query Frame = 2
Query:  149 CKFVKAWLHGLLYESTGWQLLDKSELIE-----PVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 559
            C + ++     L+  TG+  L  +   E      ++L++ +   F  K  +S T +LL+  +P+H+    DH+DC++ L+Q  A++       +   T L +A        V VLL+ GA  N   ++  +PL  A K+   R
Sbjct:  216 CTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK--VSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMR 353          

HSP 2 Score: 42.743 bits (99), Expect = 7.149e-12
Identity = 75/380 (19.74%), Postives = 141/380 (37.11%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHI----KKINYLLSEYKVDINSVCTVDG-----VSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYAY-PCRQ 1698
            +GH  IV+ LL+ GA+P     + + TPLH +  + + +     +Q                   N  Q++    +             D    +C      K++  LL E+K + +S  T         +     +   ILL       +   K  + L +A +   + +   LL RG++PN      +T L  ++   +  + +LL++ G + +          +       ++H+A   +  E    L+  GAN           E    +T LHLA   +    + +  L+    N+      G TP     +   +   ++L+ +G    A + +  + L ++    N  ++K LLQ Q  +N K    Y P  Q
Sbjct:  382 MGHLNIVKSLLQRGASPNASNVKVE-TPLHMAARAGHCEVAQFLLQ-------------------NNAQVDAKAKD-------------DQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPH----------STARNGYTALHIAAKQNQLEVASSLLQYGANA--------NSESLQGITPLHLAS--QEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQ 708          
BLAST of BED-type domain-containing protein vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 48.521 bits (114), Expect = 8.909e-12
Identity = 37/143 (25.87%), Postives = 67/143 (46.85%), Query Frame = 2
Query:  149 CKFVKAWLHGLLYESTGWQLLDKSELIE-----PVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 559
            C + ++     L+  TG+  L  +   E      ++L++ +   F  K  +S T +LL+  +P+H+    DH+DC++ L+Q  A++       +   T L +A        V VLL+ GA  N   ++  +PL  A K+   R
Sbjct:  231 CTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK--VSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMR 368          

HSP 2 Score: 42.3578 bits (98), Expect = 8.909e-12
Identity = 74/377 (19.63%), Postives = 140/377 (37.14%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPR--IGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHI----KKINYLLSEYKVDINSVCTVDG-----VSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYAY 1686
            +GH  IV+ LL+ GA+P   I +  +  TPLH +  + + +     +Q                   N  Q++    +             D    +C      K++  LL E+K + +S  T         +     +   ILL       +   K  + L +A +   + +   LL RG++PN      +T L  ++   +  + +LL++ G + +          +       ++H+A   +  E    L+  GAN           E    +T LHLA   +    + +  L+    N+      G TP     +   +   ++L+ +G    A + +  + L ++    N  ++K LLQ Q  +N K    Y
Sbjct:  397 MGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQ-------------------NNAQVDAKAKD-------------DQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPH----------STARNGYTALHIAAKQNQLEVASSLLQYGANA--------NSESLQGITPLHLAS--QEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGY 721          
BLAST of BED-type domain-containing protein vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 48.1358 bits (113), Expect = 8.977e-12
Identity = 37/143 (25.87%), Postives = 67/143 (46.85%), Query Frame = 2
Query:  149 CKFVKAWLHGLLYESTGWQLLDKSELIE-----PVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 559
            C + ++     L+  TG+  L  +   E      ++L++ +   F  K  +S T +LL+  +P+H+    DH+DC++ L+Q  A++       +   T L +A        V VLL+ GA  N   ++  +PL  A K+   R
Sbjct:  221 CTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK--VSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMR 358          

HSP 2 Score: 42.743 bits (99), Expect = 8.977e-12
Identity = 75/380 (19.74%), Postives = 141/380 (37.11%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHI----KKINYLLSEYKVDINSVCTVDG-----VSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYAY-PCRQ 1698
            +GH  IV+ LL+ GA+P     + + TPLH +  + + +     +Q                   N  Q++    +             D    +C      K++  LL E+K + +S  T         +     +   ILL       +   K  + L +A +   + +   LL RG++PN      +T L  ++   +  + +LL++ G + +          +       ++H+A   +  E    L+  GAN           E    +T LHLA   +    + +  L+    N+      G TP     +   +   ++L+ +G    A + +  + L ++    N  ++K LLQ Q  +N K    Y P  Q
Sbjct:  387 MGHLNIVKSLLQRGASPNASNVKVE-TPLHMAARAGHCEVAQFLLQ-------------------NNAQVDAKAKD-------------DQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPH----------STARNGYTALHIAAKQNQLEVASSLLQYGANA--------NSESLQGITPLHLAS--QEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQ 713          
BLAST of BED-type domain-containing protein vs. Ensembl Xenopus
Match: gart (phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase [Source:Xenbase;Acc:XB-GENE-993017])

HSP 1 Score: 62.003 bits (149), Expect = 5.217e-9
Identity = 68/277 (24.55%), Postives = 126/277 (45.49%), Query Frame = 1
Query:  877 HIKKINYLLSEYKVDINSVCTVDG------VSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANIN-ENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYAY 1686
            H+K +N L+     +IN  C  DG       +     E++  LL     ++  ++ + + L  A       +V NLL  G++ N   N+  T+L+ +    H+++ E L+ +GA IN E+V     LS   L   AS   A + S       LI++GA     VD  D+        +  L +      ++ ++ LLE G +++   + G TP L A         N LLF G   +++++   + L +++ + N ++++ LL   +D N +D+  +
Sbjct:  578 HVKVVNCLIG-CGANINH-CDHDGWTALRSAAWGGHTEVVSALLYAGAKVDCADADSRTALRAAAWGGHEDIVLNLLQHGAEVNKADNEGRTALIAAAYMGHREIVEHLLGHGAEINHEDVDGRTALSVAALCVPASKGHASVVS------LLIEQGAE----VDHCDKD------GMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNNGRTPLLAAASMGHAAVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDENHRDDAGW 836          
BLAST of BED-type domain-containing protein vs. Ensembl Xenopus
Match: gorasp1 (golgi reassembly stacking protein 1 [Source:Xenbase;Acc:XB-GENE-976361])

HSP 1 Score: 59.6918 bits (143), Expect = 2.590e-8
Identity = 64/261 (24.52%), Postives = 110/261 (42.15%), Query Frame = 1
Query:  973 LIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINE------------------NVCFDLVLSNVKL-----TNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYAY 1686
            ++ +LL H  N++     + + L LA Q     +V  L  R ++PN       T+L  +    H K+ +LLI+ GAN+N                    V   L+     L     +N  ++H+A +  +    + LI  GAN        D +  + + T LHLA       +  IN L + G NI+S+     TP   A+RYS+    + LL  G D         + L L+  +     +  L++++ D+N K+ + +
Sbjct:  440 IVRLLLDHSANVDSKERDDWTALHLAAQNGYENVVRVLFTRHTNPNSQEVNGKTALHLATYFGHYKLVKLLISQGANVNSIQNDQRTALHIAADKGYFRVAQHLIQKGANLNFPDQSNYTALHMAAVKGNSMICKLLIKHGANA-------DAKSFQ-DWTPLHLATYKGHTEI--INLLKDGGSNIDSEGDLKWTPLHLAVRYSEELVVSHLLTLGADPEIAEMSGWTALHLAVQRGAFCSVINLIEHKADVNAKNAFGW 690          
BLAST of BED-type domain-containing protein vs. Ensembl Xenopus
Match: pan3 (poly(A) specific ribonuclease subunit PAN3 [Source:Xenbase;Acc:XB-GENE-5731378])

HSP 1 Score: 58.9214 bits (141), Expect = 3.351e-8
Identity = 91/372 (24.46%), Postives = 146/372 (39.25%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQ-----------FNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKD 1674
            GH   V+VLL+ GA          +TPLH +   NN  N+   ++++       Y      + +   Q N    N  + ++LK+   +D V               H+K +  LL E    I+S       + NN           R NIN TN    + L LA +L        L+ +G+  ++      T+L  ++Q     +T+LLI  G NIN     D             +HVA  ++ QE    LI  GAN+ +    L         T LH+A   +  +L+    LL    N+ +K  +  TP   A      E   LLL    D N+     ++ L ++A   + +I+  +L+ +     KD
Sbjct:   95 GHGEAVKVLLRAGAFI-YSLDDDSLTPLHLAA-ENNHQNV---VKILLQEEGRQYKNRHNFIHMAATQGN----NKLMQLLLKNKAPVDAVDEKSQTALLYAVSGGHLKTVKMLL-EAGASIDSSIIDAAFATNN----------ERTNINATNDIQYTPLLLAAELGKTESAQALIEKGAQLDVRTPNMSTALHLAVQGGDASITKLLIRKGININIAGPGDQT----------PLHVAAFHNKQELADILIAAGANVNVVTKEL--------FTPLHIAS--QRGNLHVAQSLLHHKANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEKDKKTPLHIAAAAGHIEIVNVMLKGRARCAVKD 426          
BLAST of BED-type domain-containing protein vs. Ensembl Xenopus
Match: ANKRD29 (ankyrin repeat domain 29 [Source:NCBI gene;Acc:100496526])

HSP 1 Score: 55.4546 bits (132), Expect = 1.717e-7
Identity = 52/217 (23.96%), Postives = 92/217 (42.40%), Query Frame = 1
Query:  997 RININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQ 1647
            R++++  +S   + L +A        V  L+++G+D NI R    T+L F+ Q+ H  + +LL  +GA+  E    D            ++  A  Y      + L+  GAN+          ++    T L LA   +   +N +  LL  G  +      G TP   A +    E   +LL RG D++A      + L  +A K   ++++ LL+
Sbjct:   37 RVDVDCRDSTGATALMVASYAGHFDCVRELVLQGADINIQRESGSTALFFAAQQGHNDIVKLLFEFGAS-TEFTTKD---------GGTALLAASQYGHTRVVETLLKNGANI--------HDQLYDGATALFLAA--QGGYINVVRLLLTSGAKVNQPRQDGTTPLWIASQMGHNELVRVLLLRGADRDAARNDGTTPLFKAASKGFCEVIEELLK 233          
BLAST of BED-type domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 48.1358 bits (113), Expect = 2.571e-7
Identity = 86/369 (23.31%), Postives = 152/369 (41.19%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTK-RHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDV----------QFNCHIKKINYLLSEYKVDINSVCTVDGVS------NNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNA-VNAINESGLILSAIKKNHDIMKCLL 1644
            G+  +V++LL  G+  +I  K R  +TPLH  C + +       + L + AP  +  K+   L           +NC  L +L+  V +DDV            +C   K+  +L + K + N+   ++G +        N  +++++LL H  +I        + + +A  +  + +VS L   G+ PN    +  T+L  + +    ++   L+  GA +      D             +H++      +  Q L+ +GA          +    +  T LHL+   +    +  + LLE G +    T KG TP   A +Y KIE   LLL     KNA  +A  +SGL    +  ++D  K  L
Sbjct:  253 GNANMVKLLLDRGS--KIDAKTRDGLTPLH--CGARSGHEQVVGMLLDRGAP--ILSKTKNGLSPLHMATQGDHLNCVQL-LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKA-LNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQT----------PLHISARLGKADIVQQLLKQGA--------YPDAATTSGYTPLHLSS--REGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLL----QKNASPDAAGKSGLTPLHVAAHYDNQKVAL 589          

HSP 2 Score: 28.1054 bits (61), Expect = 2.571e-7
Identity = 21/77 (27.27%), Postives = 35/77 (45.45%), Query Frame = 2
Query:  323 LHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 550
            LH+    D      +L+Q +    +ES+S     T L +A     +    +LL  GA  +    ++ +PL  A+KRG
Sbjct:  180 LHIAARKDDTKAAALLLQNDHNADVESKSGF---TPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRG 253          
BLAST of BED-type domain-containing protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 56.9954 bits (136), Expect = 1.973e-12
Identity = 76/339 (22.42%), Postives = 132/339 (38.94%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS 1605
            +G   IV++LL++ A+P   T  +  TPLH S     +D                   +S +LE        TK     L +      LD  +       +    +      N +  +   ++ + +++  +LL    + + T     + L +A + N + + S LL  G++ N    Q +T L  + Q+ H  M  LL++ GANI+ +    L           S+H+A           L   GA          +R+  T +    L +     ++  +NFLL+ G N+ +KT  G TP   A +       N+LL  G   NA  A   + L ++
Sbjct:  486 LGKTEIVQLLLQHMAHPDAATT-NGYTPLHISAREGQVD------------------VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKL-----LLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLT----------SLHLAAQEDKVNVADILTKHGA----------DRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA 780          

HSP 2 Score: 36.1946 bits (82), Expect = 1.973e-12
Identity = 24/94 (25.53%), Postives = 44/94 (46.81%), Query Frame = 2
Query:  275 KFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 556
            K+  S   +      P+H+     HL+ + +L+Q         + I  +TAL +A    ++E V  LL +GA  +      ++PL  A++ G+T
Sbjct:  398 KYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGAS--PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKT 489          
BLAST of BED-type domain-containing protein vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 49.2914 bits (116), Expect = 4.431e-12
Identity = 87/376 (23.14%), Postives = 145/376 (38.56%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSS---CVLEINRGQI------NCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVC-TVDG-----VSNNNGK-ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQ 1668
            +GH  IV+ LL+ GA+P +   + + TPLH +  + + +     +Q    A        +   C   I    +      N    N   L        L       H+     LL +   + +  C T  G     V+   GK  L ++LL H  + N       + L +AV  N L +V  LL RG  P+       T L  + ++   ++   L+ YG + N             +     +H+A      E    L+ K AN  L          ++ +T LHL  + +   +   + L++ G+ +++ T  G TP   A  Y  I+    LL    D NA   +  S L  +A + + DI+  LL+N    N+
Sbjct:  410 MGHLPIVKNLLQRGASPNVSNVKVE-TPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPN---LATTAGHTPLHTAAREGHVDTALALLEK---EASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAE----------SVQGVTPLHLAAQEGHTEMVALLLSKQANGNLG--------NKSGLTPLHL--VSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNE 758          

HSP 2 Score: 42.743 bits (99), Expect = 4.431e-12
Identity = 36/132 (27.27%), Postives = 59/132 (44.70%), Query Frame = 2
Query:  206 LLDKSELIEPVILSKSSKPIFCQKFN--ISDTYVLLD-----------AWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 559
            LLD+   IE     + + P+ C   N  +  + +LLD             +P+H+    DHLDC+++L+Q  A++       +   T L +A          VLL+ GA PN   ++  +PL  A K+   R
Sbjct:  254 LLDRGAQIETRTKDELT-PLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEI---DDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIR 381          

HSP 3 Score: 43.1282 bits (100), Expect = 2.580e-10
Identity = 31/111 (27.93%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  227 IEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 556
            +  V+L K +KP              L+ + PLH+    +H+  +++L++  A +   + S +   T L +A  +  L  V  LL+ GA+PNV ++  ++PL  AA+ G T
Sbjct:  349 VAKVLLDKGAKP----------NSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGL---TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHT 446          

HSP 4 Score: 42.743 bits (99), Expect = 2.580e-10
Identity = 74/339 (21.83%), Postives = 132/339 (38.94%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS 1605
            IGH  +V++LL+ GA+P + T     TPLH +    ++D   A ++   S         +C+    +G         +  V L   +   D   N   K             N +  +    ++N  +++ +LL    + +       + L +A + N + +  +LL  G   N    Q +T L  + Q+ H +M  LL++  AN N        L N   +    +H+            LI  G    +TVD           T LH+A      ++  + FLL+   ++ +KT  G +P   A +    +   LLL  G   N V++   + L ++
Sbjct:  476 IGHTGMVKLLLENGASPNLATTAGH-TPLHTAAREGHVDTALALLEKEAS--------QACM--TKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGK-------------NGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGN--------LGNK--SGLTPLHLVSQEGHVPVADVLIKHG----VTVDAT----TRMGYTPLHVAS--HYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 770          

HSP 5 Score: 56.6102 bits (135), Expect = 1.969e-7
Identity = 63/254 (24.80%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  970 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYG-------------ANINENVCFDLVLSN------VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGL--ILSAIKKNH-DIMKCLLQNQVDLN 1665
            E++  L+ +  N+N  + K  + L++A Q N L +V  LL  G++ N+      T L  ++Q+ H+ +   LINYG             A  ++     ++L N      +  T    +H+A  Y +    Q L+++GA++  T         +  +T LH+A   +  ++  +  LL+ G  IE++T    TP   A R   +    +LL  G     + A  ++GL  I  A + +H D ++ LLQ   +++
Sbjct:   88 EVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFT--------PQNGITPLHIAS--RRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGA---PIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEID 328          
BLAST of BED-type domain-containing protein vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 49.6766 bits (117), Expect = 4.498e-12
Identity = 87/376 (23.14%), Postives = 145/376 (38.56%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSS---CVLEINRGQI------NCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVC-TVDG-----VSNNNGK-ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQ 1668
            +GH  IV+ LL+ GA+P +   + + TPLH +  + + +     +Q    A        +   C   I    +      N    N   L        L       H+     LL +   + +  C T  G     V+   GK  L ++LL H  + N       + L +AV  N L +V  LL RG  P+       T L  + ++   ++   L+ YG + N             +     +H+A      E    L+ K AN  L          ++ +T LHL  + +   +   + L++ G+ +++ T  G TP   A  Y  I+    LL    D NA   +  S L  +A + + DI+  LL+N    N+
Sbjct:  418 MGHLPIVKNLLQRGASPNVSNVKVE-TPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPN---LATTAGHTPLHTAAREGHVDTALALLEK---EASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAE----------SVQGVTPLHLAAQEGHTEMVALLLSKQANGNLG--------NKSGLTPLHL--VSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNE 766          

HSP 2 Score: 42.3578 bits (98), Expect = 4.498e-12
Identity = 36/132 (27.27%), Postives = 59/132 (44.70%), Query Frame = 2
Query:  206 LLDKSELIEPVILSKSSKPIFCQKFN--ISDTYVLLD-----------AWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 559
            LLD+   IE     + + P+ C   N  +  + +LLD             +P+H+    DHLDC+++L+Q  A++       +   T L +A          VLL+ GA PN   ++  +PL  A K+   R
Sbjct:  262 LLDRGAQIETRTKDELT-PLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEI---DDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIR 389          

HSP 3 Score: 44.2838 bits (103), Expect = 9.738e-11
Identity = 31/108 (28.70%), Postives = 55/108 (50.93%), Query Frame = 2
Query:  236 VILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 556
            V+L K +KP              L+ + PLH+    +H+  +++L++  A +   + S +   T L +A  +  L  V  LL+ GA+PNV ++  ++PL  AA+ G T
Sbjct:  360 VLLDKGAKP----------NSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGL---TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHT 454          

HSP 4 Score: 42.743 bits (99), Expect = 9.738e-11
Identity = 73/333 (21.92%), Postives = 130/333 (39.04%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSS-CVLEINRGQINCTKVNCFLLVILKSAV-------CLDDVQFNCH---IKKINYLL----SEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLL 1542
            IGH  +V++LL+ GA+P + T     TPLH +    ++D   A ++  K A +    K     L +        KV    L++   A         L  +    H   +  +  LL    S +    N    +   +  N  E+   LL +  + N  + +  + L LA Q     +V+ LL + ++ N+G    +T L    Q+ H  + ++LI +G  ++                   +HVA  Y + +  +FL+   A++     L          + LH A   +    + +  LL+ G +    +S G TP   A R   I   ++L
Sbjct:  484 IGHTGMVKLLLENGASPNLATTAGH-TPLHTAAREGHVDTALALLE--KEASQACMTKKGFTPLHV---AAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYT----------PLHVASHYGNIKLVKFLLQHQADVNAKTKL--------GYSPLHQAA--QQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 790          

HSP 5 Score: 56.225 bits (134), Expect = 2.182e-7
Identity = 63/254 (24.80%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  970 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYG-------------ANINENVCFDLVLSN------VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGL--ILSAIKKNH-DIMKCLLQNQVDLN 1665
            E++  L+ +  N+N  + K  + L++A Q N L +V  LL  G++ N+      T L  ++Q+ H+ +   LINYG             A  ++     ++L N      +  T    +H+A  Y +    Q L+++GA++  T         +  +T LH+A   +  ++  +  LL+ G  IE++T    TP   A R   +    +LL  G     + A  ++GL  I  A + +H D ++ LLQ   +++
Sbjct:   96 EVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFT--------PQNGITPLHIAS--RRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGA---PIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEID 336          
BLAST of BED-type domain-containing protein vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 48.9062 bits (115), Expect = 4.966e-12
Identity = 87/376 (23.14%), Postives = 145/376 (38.56%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSS---CVLEINRGQI------NCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVC-TVDG-----VSNNNGK-ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQ 1668
            +GH  IV+ LL+ GA+P +   + + TPLH +  + + +     +Q    A        +   C   I    +      N    N   L        L       H+     LL +   + +  C T  G     V+   GK  L ++LL H  + N       + L +AV  N L +V  LL RG  P+       T L  + ++   ++   L+ YG + N             +     +H+A      E    L+ K AN  L          ++ +T LHL  + +   +   + L++ G+ +++ T  G TP   A  Y  I+    LL    D NA   +  S L  +A + + DI+  LL+N    N+
Sbjct:  418 MGHLPIVKNLLQRGASPNVSNVKVE-TPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPN---LATTAGHTPLHTAAREGHVDTALALLEK---EASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAE----------SVQGVTPLHLAAQEGHTEMVALLLSKQANGNLG--------NKSGLTPLHL--VSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNE 766          

HSP 2 Score: 42.743 bits (99), Expect = 4.966e-12
Identity = 36/132 (27.27%), Postives = 59/132 (44.70%), Query Frame = 2
Query:  206 LLDKSELIEPVILSKSSKPIFCQKFN--ISDTYVLLD-----------AWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 559
            LLD+   IE     + + P+ C   N  +  + +LLD             +P+H+    DHLDC+++L+Q  A++       +   T L +A          VLL+ GA PN   ++  +PL  A K+   R
Sbjct:  262 LLDRGAQIETRTKDELT-PLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEI---DDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIR 389          

HSP 3 Score: 43.5134 bits (101), Expect = 2.915e-10
Identity = 31/111 (27.93%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  227 IEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 556
            +  V+L K +KP              L+ + PLH+    +H+  +++L++  A +   + S +   T L +A  +  L  V  LL+ GA+PNV ++  ++PL  AA+ G T
Sbjct:  357 VAKVLLDKGAKP----------NSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGL---TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHT 454          

HSP 4 Score: 42.3578 bits (98), Expect = 2.915e-10
Identity = 74/339 (21.83%), Postives = 132/339 (38.94%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS 1605
            IGH  +V++LL+ GA+P + T     TPLH +    ++D   A ++   S         +C+    +G         +  V L   +   D   N   K             N +  +    ++N  +++ +LL    + +       + L +A + N + +  +LL  G   N    Q +T L  + Q+ H +M  LL++  AN N        L N   +    +H+            LI  G    +TVD           T LH+A      ++  + FLL+   ++ +KT  G +P   A +    +   LLL  G   N V++   + L ++
Sbjct:  484 IGHTGMVKLLLENGASPNLATTAGH-TPLHTAAREGHVDTALALLEKEAS--------QACM--TKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGK-------------NGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGN--------LGNK--SGLTPLHLVSQEGHVPVADVLIKHG----VTVDAT----TRMGYTPLHVAS--HYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 778          

HSP 5 Score: 56.225 bits (134), Expect = 2.410e-7
Identity = 63/254 (24.80%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  970 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYG-------------ANINENVCFDLVLSN------VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGL--ILSAIKKNH-DIMKCLLQNQVDLN 1665
            E++  L+ +  N+N  + K  + L++A Q N L +V  LL  G++ N+      T L  ++Q+ H+ +   LINYG             A  ++     ++L N      +  T    +H+A  Y +    Q L+++GA++  T         +  +T LH+A   +  ++  +  LL+ G  IE++T    TP   A R   +    +LL  G     + A  ++GL  I  A + +H D ++ LLQ   +++
Sbjct:   96 EVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFT--------PQNGITPLHIAS--RRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGA---PIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEID 336          
BLAST of BED-type domain-containing protein vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 48.9062 bits (115), Expect = 5.139e-12
Identity = 87/376 (23.14%), Postives = 145/376 (38.56%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSS---CVLEINRGQI------NCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVC-TVDG-----VSNNNGK-ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQ 1668
            +GH  IV+ LL+ GA+P +   + + TPLH +  + + +     +Q    A        +   C   I    +      N    N   L        L       H+     LL +   + +  C T  G     V+   GK  L ++LL H  + N       + L +AV  N L +V  LL RG  P+       T L  + ++   ++   L+ YG + N             +     +H+A      E    L+ K AN  L          ++ +T LHL  + +   +   + L++ G+ +++ T  G TP   A  Y  I+    LL    D NA   +  S L  +A + + DI+  LL+N    N+
Sbjct:  447 MGHLPIVKNLLQRGASPNVSNVKVE-TPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPN---LATTAGHTPLHTAAREGHVDTALALLEK---EASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAE----------SVQGVTPLHLAAQEGHTEMVALLLSKQANGNLG--------NKSGLTPLHL--VSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNE 795          

HSP 2 Score: 42.743 bits (99), Expect = 5.139e-12
Identity = 36/132 (27.27%), Postives = 59/132 (44.70%), Query Frame = 2
Query:  206 LLDKSELIEPVILSKSSKPIFCQKFN--ISDTYVLLD-----------AWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 559
            LLD+   IE     + + P+ C   N  +  + +LLD             +P+H+    DHLDC+++L+Q  A++       +   T L +A          VLL+ GA PN   ++  +PL  A K+   R
Sbjct:  291 LLDRGAQIETRTKDELT-PLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEI---DDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIR 418          

HSP 3 Score: 43.5134 bits (101), Expect = 2.992e-10
Identity = 31/111 (27.93%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  227 IEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 556
            +  V+L K +KP              L+ + PLH+    +H+  +++L++  A +   + S +   T L +A  +  L  V  LL+ GA+PNV ++  ++PL  AA+ G T
Sbjct:  386 VAKVLLDKGAKP----------NSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGL---TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHT 483          

HSP 4 Score: 42.3578 bits (98), Expect = 2.992e-10
Identity = 74/339 (21.83%), Postives = 132/339 (38.94%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS 1605
            IGH  +V++LL+ GA+P + T     TPLH +    ++D   A ++   S         +C+    +G         +  V L   +   D   N   K             N +  +    ++N  +++ +LL    + +       + L +A + N + +  +LL  G   N    Q +T L  + Q+ H +M  LL++  AN N        L N   +    +H+            LI  G    +TVD           T LH+A      ++  + FLL+   ++ +KT  G +P   A +    +   LLL  G   N V++   + L ++
Sbjct:  513 IGHTGMVKLLLENGASPNLATTAGH-TPLHTAAREGHVDTALALLEKEAS--------QACM--TKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGK-------------NGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGN--------LGNK--SGLTPLHLVSQEGHVPVADVLIKHG----VTVDAT----TRMGYTPLHVAS--HYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 807          

HSP 5 Score: 56.225 bits (134), Expect = 2.390e-7
Identity = 63/254 (24.80%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  970 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYG-------------ANINENVCFDLVLSN------VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGL--ILSAIKKNH-DIMKCLLQNQVDLN 1665
            E++  L+ +  N+N  + K  + L++A Q N L +V  LL  G++ N+      T L  ++Q+ H+ +   LINYG             A  ++     ++L N      +  T    +H+A  Y +    Q L+++GA++  T         +  +T LH+A   +  ++  +  LL+ G  IE++T    TP   A R   +    +LL  G     + A  ++GL  I  A + +H D ++ LLQ   +++
Sbjct:  125 EVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFT--------PQNGITPLHIAS--RRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGA---PIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEID 365          
BLAST of BED-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q01484|ANK2_HUMAN (Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4)

HSP 1 Score: 56.9954 bits (136), Expect = 1.039e-10
Identity = 75/341 (21.99%), Postives = 138/341 (40.47%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEI--NRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS 1605
            +G   IV++LL++ A+P   T  +  TPLH S     +D +A+ +    +A  +   K    L +    G ++  K+      +L+     D                      N +  +   ++ + +++  +LL    + + T     + L +A + N + + S LL  G++ NI   Q +T L  + Q+ H  M  LL++ GANI+ +            +   S+H+A           L   GA          +++  T +    L +     ++  +NFLL+ G N+ +KT  G TP   A +       N+LL  G   NA  A   + L ++
Sbjct:  507 LGKTEIVQLLLQHMAHPDAATT-NGYTPLHISAREGQVD-VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKL------LLQRRAAAD------------------SAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMST----------KSGLTSLHLAAQEDKVNVADILTKHGA----------DQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA 801          

HSP 2 Score: 33.113 bits (74), Expect = 1.039e-10
Identity = 24/94 (25.53%), Postives = 44/94 (46.81%), Query Frame = 2
Query:  275 KFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 556
            K+  S   +      P+H+     HL+ + +L+Q         + I  +TAL +A    ++E V  LL +GA  +      ++PL  A++ G+T
Sbjct:  419 KYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGAS--PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKT 510          
BLAST of BED-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q02357|ANK1_MOUSE (Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV=2)

HSP 1 Score: 43.5134 bits (101), Expect = 1.881e-9
Identity = 31/111 (27.93%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  227 IEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 556
            +  V+L K +KP              L+ + PLH+    +H+  +++L++  A +   + S +   T L +A  +  L  V  LL+ GA+PNV ++  ++PL  AA+ G T
Sbjct:  349 VAKVLLDKGAKP----------NSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGL---TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHT 446          

HSP 2 Score: 42.3578 bits (98), Expect = 1.881e-9
Identity = 74/339 (21.83%), Postives = 132/339 (38.94%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS 1605
            IGH  +V++LL+ GA+P + T     TPLH +    ++D   A ++   S         +C+    +G         +  V L   +   D   N   K             N +  +    ++N  +++ +LL    + +       + L +A + N + +  +LL  G   N    Q +T L  + Q+ H +M  LL++  AN N        L N   +    +H+            LI  G    +TVD           T LH+A      ++  + FLL+   ++ +KT  G +P   A +    +   LLL  G   N V++   + L ++
Sbjct:  476 IGHTGMVKLLLENGASPNLATTAGH-TPLHTAAREGHVDTALALLEKEAS--------QACM--TKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGK-------------NGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGN--------LGNK--SGLTPLHLVSQEGHVPVADVLIKHG----VTVDAT----TRMGYTPLHVAS--HYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 770          

HSP 3 Score: 56.225 bits (134), Expect = 1.745e-6
Identity = 63/254 (24.80%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  970 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYG-------------ANINENVCFDLVLSN------VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGL--ILSAIKKNH-DIMKCLLQNQVDLN 1665
            E++  L+ +  N+N  + K  + L++A Q N L +V  LL  G++ N+      T L  ++Q+ H+ +   LINYG             A  ++     ++L N      +  T    +H+A  Y +    Q L+++GA++  T         +  +T LH+A   +  ++  +  LL+ G  IE++T    TP   A R   +    +LL  G     + A  ++GL  I  A + +H D ++ LLQ   +++
Sbjct:   88 EVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFT--------PQNGITPLHIAS--RRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGA---PIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEID 328          
BLAST of BED-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5UPG5|YL093_MIMIV (Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L93 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.600e-9
Identity = 51/196 (26.02%), Postives = 93/196 (47.45%), Query Frame = 1
Query: 1093 RGSDPNIGRNQPITSLMFSIQKRHK----KMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQ 1668
            RG+D NI     +T+LM + +  +     ++ +LL++ GA+IN                  ++  A  Y++ E  + L+DK A      D+  + ++     +L        NS+  I  LL+ G +I +   +G T  +FA +Y+ IEA  LLL +  D NA +    + L+ + +  N + +K LL  + D+N+
Sbjct:  240 RGADTNIKDKIGLTALMLACKYANTPNSIEIIKLLLDKGADINTG----------NGEGWTALMFACKYANIEAIKLLLDKNA------DINAKDKIGLTALMLACKYANTPNSIEIIKLLLDKGADINTGNGEGWTALMFACKYANIEAIKLLLDKNADINAKDKDGWTPLMFACVYANIETIKLLLDKRADINE 419          

HSP 2 Score: 55.4546 bits (132), Expect = 1.885e-6
Identity = 63/247 (25.51%), Postives = 102/247 (41.30%), Query Frame = 1
Query: 1093 RGSDPNIGRNQPITSLMFSIQKRHK----KMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQ----ETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLK----SNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSA---------------IKKNHDI----------------------MKCLLQNQVDLNQKDNYAY 1686
            R +D N   NQ   S M++ Q  +     K  +LL+N G+NI+E       L N   T   ++ +A  Y++     +T + L+D+GA          +  ++  + L  L +  K     NS+  I  LL+ G +I +   +G T  +FA +Y+ IEA  LLL +  D NA + I  + L+L+                + K  DI                      +K LL    D+N KD   +
Sbjct:  166 RDADINKKDNQGKNSFMWACQYSNTTSNIKTVKLLLNRGSNIDE-------LDNNGWT---ALMIACKYANTTSNIKTIKLLLDRGA----------DTNIKDKIGLTALMLACKYANTPNSIEIIKLLLDKGADINTGNGEGWTALMFACKYANIEAIKLLLDKNADINAKDKIGLTALMLACKYANTPNSIEIIKLLLDKGADINTGNGEGWTALMFACKYANIEAIKLLLDKNADINAKDKDGW 392          
BLAST of BED-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9ULJ7|ANR50_HUMAN (Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4)

HSP 1 Score: 63.929 bits (154), Expect = 7.021e-9
Identity = 59/240 (24.58%), Postives = 114/240 (47.50%), Query Frame = 1
Query:  970 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANIN-ENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYAY 1686
            E++  LL   + ++  ++ + + L  A       +V NLL  G++ N   N+  T+L+ +    H+++ E L+++GA +N E+V     LS   L   AS   A + S       LID+GA     VD  D+        +  L +      ++ ++ LLE G +++   + G TP L A         N LLF G   +++++   + L +++ + N ++++ LL   +D N +D+  +
Sbjct:  625 EVVSALLYAGVKVDCADADSRTALRAAAWGGHEDIVLNLLQHGAEVNKADNEGRTALIAAAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAALCVPASKGHASVVS------LLIDRGAE----VDHCDKD------GMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNNGRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDENHRDDAGW 848          
BLAST of BED-type domain-containing protein vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 43.1282 bits (100), Expect = 1.093e-8
Identity = 31/111 (27.93%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  227 IEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 556
            +  V+L K +KP              L+ + PLH+    +H+  +++L++  A +   + S +   T L +A  +  L  V  LL+ GA+PNV ++  ++PL  AA+ G T
Sbjct:  353 VAKVLLDKGAKP----------NSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGL---TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHT 450          

HSP 2 Score: 40.0466 bits (92), Expect = 1.093e-8
Identity = 72/333 (21.62%), Postives = 131/333 (39.34%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSS-CVLEINRGQINCTKVNCFLLVILKSAVC-------LDDVQFNCH---IKKINYLL----SEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLL 1542
            IGH  +V++LL+  ANP + T     TPLH +    +++ + A ++  K A +    K     L +        KV    L++ + A         L  +    H   +  +  LL    S +    N    +   +  N  E+   LL +  + N  + +  + L LA Q     +V+ LL + ++ N+G    +T L    Q+ H  + ++LI +G  ++                   +HVA  Y + +  +FL+   A++     L          + LH A   +    + +  LL+ G +    +S G TP   A R   I   ++L
Sbjct:  480 IGHTNMVKLLLENNANPNLATTAGH-TPLHIAAREGHVETVLALLE--KEASQACMTKKGFTPLHV---AAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYT----------PLHVASHYGNIKLVKFLLQHQADVNAKTKL--------GYSPLHQAA--QQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 3 Score: 57.3806 bits (137), Expect = 7.070e-7
Identity = 64/254 (25.20%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  970 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYG-------------ANINENVCFDLVLSN------VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGL--ILSAIKKNH-DIMKCLLQNQVDLN 1665
            E++  L+ +  N+N  + K  + L++A Q N L +V  LL  G++ N+      T L  ++Q+ H+ +   LINYG             A  ++     ++L N      +  T    +H+A  Y +    Q L+++GA++  T         +  +T LH+A   +  ++  +  LL+ G  IE+KT    TP   A R   +    +LL  G     + A  ++GL  I  A + +H D ++ LLQ   +++
Sbjct:   92 EVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFT--------PQNGITPLHIAS--RRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGA---PIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEID 332          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A4C1TIA5 (BED-type domain-containing protein OS=Eumeta variegata OX=151549 GN=EVAR_7656_1 PE=4 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 8.056e-53
Identity = 110/257 (42.80%), Postives = 159/257 (61.87%), Query Frame = 3
Query: 1713 LWNNFTRMKDGNSAVCKRCNTMIKCTGGSTSGLHNHLIRKHSIILLKRETLNIEAVESCN---------SKISPNISVSDDINSRTKISNYFIQIKTIDNSFPAVLARLTARDCLSFKKICTSYDLQELFKSKGYDIPKSPMTIKRIVMDYGDKIRQQTVIELSERISRGELFSLTLDEWTSLKNRRFMNVNVHSYDD---IYWNLGLVRIEGAMAADKCITYLQNKLQEFNIP-TENVISITTDGAAIMKKVERLI 2444
            +W +F + +DG SA CKRC T+IK T  ST GLH HL  KH I     E LN +  ++           S +SP +      + RTKI+++F  I+  +NS    +AR+TA+D L      TS DL+ELFK+KG+ +P+S  TI+ +VM+YG  +R + V ELS+    G  FSLT DEWTS  NRR++N+N H+Y +   ++WNLGL RI G+M A  C+  L+ KL++F I   E++++ITTDGA++M K   L+
Sbjct:   16 VWEHFLKSEDGLSAKCKRCKTVIKTTARSTKGLHVHLKAKHQI-----EDLNKKVPKNAVSSSSVSTNLSMLSPELPSP---SKRTKITHHF-PIQNSENSMEERVARMTAKDGLPLSVFATSEDLRELFKAKGFLLPRSSTTIRMMVMNYGMTLRMKVVNELSQLKETGHRFSLTFDEWTSSSNRRYLNINAHTYANDRALFWNLGLTRIFGSMPATVCVETLRKKLKKFEIDLDEDIVAITTDGASVMVKTGSLV 263          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A4C1SVE1 (AC transposase OS=Eumeta variegata OX=151549 GN=EVAR_3373_1 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 7.497e-51
Identity = 104/247 (42.11%), Postives = 153/247 (61.94%), Query Frame = 3
Query: 1707 LDLWNNFTRMKDGNSAVCKRCNTMIKCTGGSTSGLHNHLIRKHSIILLKRETLNIEAVESCNSKISPNISVSDDINSRTKISNYFIQIKTIDNSFPAVLARLTARDCLSFKKICTSYDLQELFKSKGYDIPKSPMTIKRIVMDYGDKIRQQTVIELSERISRGELFSLTLDEWTSLKNRRFMNVNVHSYDDIYWNLGLVRIEGAMAADKCITYLQNKLQEFNIPTE-NVISITTDGAAIMKKVERLI 2444
            + +W+ F   KDGNSA CKRC +++K  GGST GLH HL  KH          NI+ + +  S+ + N++ +     R K+ +YF + K+ D++   VLAR+ A D   F    TS +L++L  +K  D+PKS +TI++ VM+Y +KI++Q   EL    S GE FSL+ DEWTS+ N+R+M +NVHSY   +WNLGLV I G M A+ C+  L  +L +F+I  E ++ +I TDG  +M KV RL+
Sbjct:   15 MSVWSYFLVAKDGNSAKCKRCPSILKTLGGSTKGLHTHLSTKH----------NIKVISASTSQDTENLNTAPPPAKR-KLDDYFTKTKSDDDNLDDVLARMIALDGFPFSVFITSDNLRKLLLAKYTDLPKSAVTIQKRVMNYSEKIKKQVTSELKHLKSAGERFSLSFDEWTSMSNKRYMALNVHSYKK-FWNLGLVPIYGNMTAENCLRILNERLSKFDISLETDIAAIVTDGPNVMIKVGRLV 249          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A4C1TWT2 (BED-type domain-containing protein OS=Eumeta variegata OX=151549 GN=EVAR_14781_1 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 6.624e-50
Identity = 104/252 (41.27%), Postives = 153/252 (60.71%), Query Frame = 3
Query: 1707 LDLWNNFTRMKDGNSAVCKRCNTMIKCTGGSTSGLHNHLIRKHSIILLKRETLNIEAVESCNSKISPNISVSDDINSRTKISNYFIQIKTIDNSFPAVLARLTARDCLSFKKICTSYDLQELFKSKGYDIPKSPMTIKRIVMDYGDKIRQQTVIELSERISRGELFSLTLDEWTSLK-----NRRFMNVNVHSYDDIYWNLGLVRIEGAMAADKCITYLQNKLQEFNIPTE-NVISITTDGAAIMKKVERLI 2444
            + +W+ F   KDGNSA CKRC +++K  GGST GLH HL  K++I ++   T   +  E+ N+   P         ++ K+ +YF + K+ D++   VLAR+ A D   F    TS +L++L  +K  D+PKS +TIK+ VM+Y  KI++Q   EL    S GE FSL+ DEWTS+      N+R+M +NVHSY   +WNLGLV I G M A+ C+  L  +L +F+I  E ++++I TDG  +M KV RL+
Sbjct:   15 MSVWSYFLVAKDGNSAKCKRCPSILKTLGGSTKGLHTHLSTKYNIKVISAST--SQDTENLNTAPPP---------AKRKLDDYFTKTKSDDDNLDDVLARMIALDGFPFSVFITSDNLRKLLLAKYTDLPKSAVTIKKRVMNYSKKIKKQVTSELKHLKSAGERFSLSFDEWTSMSIDFNVNKRYMALNVHSYKK-FWNLGLVPIYGNMTAENCLRILNERLSKFDISLETDIVAIVTDGPNVMIKVGRLV 254          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A4C1UW23 (BED-type domain-containing protein OS=Eumeta variegata OX=151549 GN=EVAR_76179_1 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 5.510e-49
Identity = 109/249 (43.78%), Postives = 158/249 (63.45%), Query Frame = 3
Query: 1713 LWNNFTRMKDGNSAVCKRCNTMIKCTGGSTSGLHNHLIRKHSIILL-KRETLNIEAVESCNSKISPNISVSDDINSRTKISNYFIQIKTIDNSFPAVLARLTARDCLSFKKICTSYDLQELFKSKGYDIPKSPMTIKRIVMDYGDKIRQQTVIELSERISRGELFSLTLDEWTSLKNRRFMNVNVHSYDD---IYWNLGLVRIEGAMAADKCITYLQNKLQEFNIP-TENVISITTDGAAIMKKVERLI 2444
            +W +F + +DG SA CKRC T+IK T  ST GLH HL  KH I  L K+   N  +  S ++ +S   S     + RTK +++F  I+  +NS    +AR+TA+D L      TS DL+ELFK+KG+ +P+S  TI+ +VM+YG  +R + V ELS+    G  FSLT DEWTS  NRR++N+N H+Y +   ++WNLGL RI G+M A  C+  L+ KL++F I   E++++ITTDGA++M K   L+
Sbjct:   16 VWEHFLKSEDGLSAKCKRCKTVIKTTARSTKGLHVHLKAKHQIEDLNKKVPKNAVSSSSVSTNLSMLSSELPSPSKRTKKTHHF-PIRNSENSMEERVARMTAKDGLPLSVFATSEDLRELFKAKGFLLPRSSTTIRMMVMNYGMTLRMKVVNELSQLKETGHRFSLTFDEWTSSSNRRYLNINAHTYANDRALFWNLGLTRIFGSMPATVCVETLRKKLKKFEIDLDEDIVAITTDGASVMVKTGSLV 263          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A4C1U5M1 (BED-type domain-containing protein OS=Eumeta variegata OX=151549 GN=EVAR_16198_1 PE=4 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 6.204e-49
Identity = 101/247 (40.89%), Postives = 149/247 (60.32%), Query Frame = 3
Query: 1707 LDLWNNFTRMKDGNSAVCKRCNTMIKCTGGSTSGLHNHLIRKHSIILLKRETLNIEAVESCNSKISPNISVSDDINSRTKISNYFIQIKTIDNSFPAVLARLTARDCLSFKKICTSYDLQELFKSKGYDIPKSPMTIKRIVMDYGDKIRQQTVIELSERISRGELFSLTLDEWTSLK-----NRRFMNVNVHSYDDIYWNLGLVRIEGAMAADKCITYLQNKLQEFNIPTE-NVISITTDGAAIMKK 2429
            + +W+ F   KDGNSA CKRC +++K  GGST GLH HL  KH+I ++   T   +  E+ N+   P         ++ K+ +YF + K+ D++   VLAR+ A D   F    TS +L++L  +K  D+PKS +TIK+ VM+Y +KI++Q   EL    S GE FSL+ DEWTS+      N+R+M +NVHSY   +WNLGLV I G M A+ C+  L  +L +F+I  E ++++I TDG  +  K
Sbjct:    1 MSVWSYFLVAKDGNSAKCKRCPSILKTLGGSTKGLHTHLSTKHNIKVISAST--SQDTENLNTAPPP---------AKRKLDDYFTKTKSDDDNLDDVLARMIALDGFPFSVFITSDNLRKLLLAKYTDLPKSAVTIKKRVMNYSEKIKKQVTSELKHLKSAGERFSLSFDEWTSMSIDFNVNKRYMALNVHSYKK-FWNLGLVPIYGNMTAENCLRILNERLSKFDISLETDIVAIVTDGPNVYDK 235          
BLAST of BED-type domain-containing protein vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 45.8246 bits (107), Expect = 1.178e-10
Identity = 82/384 (21.35%), Postives = 154/384 (40.10%), Query Frame = 1
Query:  595 HDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLD----DVQFNCHI------KKINYLLSEYKVDINSVCTVDG-----VSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYAY-PCRQ 1698
            H  ++++LLK+ A+    T+   +TPLH +    ++ N+   +    ++P     K    L +     +C +V  FLL   ++A  +D    D Q + H       K++  LL E+K + NS  T         +     + + ILL       +   K  + L +A +   + +   LL RG++PN      +T L  ++   +  +  LL++ G + +          +        +H+A   +  E    L+  GA+           E    VT LHLA   +    + ++ L+    N+      G TP     +   +   ++L+ +G    A   +  + L ++    N  ++K LLQ Q ++N K    Y P  Q
Sbjct:  355 HLRVMDLLLKHSASLEAVTES-GLTPLHVASFMGHL-NIVKILLQKGASPNASNVKVETPLHMASRAGHC-EVAEFLL---QNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPH----------SAARNGYTPLHIASKQNQVEVASSLLQYGASA--------NAESLQGVTPLHLAA--QEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQ 712          

HSP 2 Score: 40.817 bits (94), Expect = 1.178e-10
Identity = 24/82 (29.27%), Postives = 40/82 (48.78%), Query Frame = 2
Query:  317 NPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 559
            +P+H+    DH+DC++ L+Q  A++       +   T L +A          VLL+ GA PN   ++  +PL  A K+   R
Sbjct:  279 SPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLR 357          
BLAST of BED-type domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 56.9954 bits (136), Expect = 8.005e-10
Identity = 86/370 (23.24%), Postives = 148/370 (40.00%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLL--SEYKVDINSVCTVDGVSNNNGKEL-----------------IDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLL 1644
            G+  +V++LL  GA     TK   +TPLH  C + +       + L + AP  +  K+   L           +NC  L +L+  V +DDV  N ++  ++       YKV   +   VD  +N N K L                 +++LL H  ++        + + +A  +    +V  L   G+ PN    +  T+L  + +     +   L+  GA ++     D            ++H+A      E  Q L+ KGA               +  T LHLA+  +       + LLE G ++ + T KG TP   A +Y +IEA  LLL +   + A +   ++GL    +  ++D  +  L
Sbjct:  281 GNGNMVKLLLDRGAKIDAKTK-DGLTPLH--CGARSGHEQVVEMLLDRGAP--ILSKTKNGLSPLHMATQGDHLNCVQL-LLQHDVPVDDVT-NDYLTALHVAAHCGHYKV---AKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQT----------ALHIASRLGKAEIVQLLLQKGA--------WASAATTSGYTPLHLAV--REGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQK---RAAPDTAGKTGLTPLHVAAHYDNQRVAL 617          

HSP 2 Score: 26.9498 bits (58), Expect = 8.005e-10
Identity = 22/77 (28.57%), Postives = 35/77 (45.45%), Query Frame = 2
Query:  323 LHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 550
            LH+    D      +L+Q +    +ES+S     T L +A     +    +LL  GA  +    ++ +PL  AAKRG
Sbjct:  208 LHIAARKDDTKSAALLLQNDHNADVESKSGF---TPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRG 281          
BLAST of BED-type domain-containing protein vs. Ensembl Cavefish
Match: ANKRD50 (ankyrin repeat domain 50 [Source:NCBI gene;Acc:103026486])

HSP 1 Score: 63.1586 bits (152), Expect = 1.634e-9
Identity = 50/198 (25.25%), Postives = 95/198 (47.98%), Query Frame = 1
Query: 1096 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANIN-ENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYAY 1686
            G++ N   N+  T+L+ +    H+++ E L+++GA +N E+V     LS   L   AS   A + S       LID+GA     VD  D+        +  L +      ++ ++ LLE G +++   + G TP L A         N LLF G   +++++   + L +++ + N ++++ LL   +D N +D+  +
Sbjct:  661 GAEVNKADNEGRTALIAAAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAALCVPASKGHASVVS------LLIDRGAE----VDHCDKD------CMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNNGRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDENHRDDAGW 842          
BLAST of BED-type domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 56.6102 bits (135), Expect = 4.523e-9
Identity = 86/370 (23.24%), Postives = 148/370 (40.00%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLL--SEYKVDINSVCTVDGVSNNNGKEL-----------------IDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLL 1644
            G+  +V++LL  GA     TK   +TPLH  C + +       + L + AP  +  K+   L           +NC  L +L+  V +DDV  N ++  ++       YKV   +   VD  +N N K L                 +++LL H  ++        + + +A  +    +V  L   G+ PN    +  T+L  + +     +   L+  GA ++     D            ++H+A      E  Q L+ KGA               +  T LHLA+  +       + LLE G ++ + T KG TP   A +Y +IEA  LLL +   + A +   ++GL    +  ++D  +  L
Sbjct:  253 GNGNMVKLLLDRGAKIDAKTK-DGLTPLH--CGARSGHEQVVEMLLDRGAP--ILSKTKNGLSPLHMATQGDHLNCVQL-LLQHDVPVDDVT-NDYLTALHVAAHCGHYKV---AKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQT----------ALHIASRLGKAEIVQLLLQKGA--------WASAATTSGYTPLHLAV--REGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQK---RAAPDTAGKTGLTPLHVAAHYDNQRVAL 589          

HSP 2 Score: 24.6386 bits (52), Expect = 4.523e-9
Identity = 23/83 (27.71%), Postives = 36/83 (43.37%), Query Frame = 2
Query:  323 LHLVVIHDHLDCLKMLIQ-------EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 550
            LH+    D      +L+Q       E+KV   + +  S  T L +A     +    +LL  GA  +    ++ +PL  AAKRG
Sbjct:  172 LHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTH-SGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRG 253          
BLAST of BED-type domain-containing protein vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 58.5362 bits (140), Expect = 3.441e-8
Identity = 63/248 (25.40%), Postives = 110/248 (44.35%), Query Frame = 1
Query:  964 GKELIDILLAH-RININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYG-------------ANINENVCFDLVLSN------VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQ 1647
            G+E +   L H   N+N  + K  S L++A Q N L +V  LL  G++ ++      T L  ++Q+ H+ +  LLINYG             A  ++     ++L N      +  T    +H+A  Y +    Q L+++GAN+  T         +  +T LH+A   +  ++  +  LL+ G  I+++T    TP   A R   +    +LL +G     + A  ++GL    +    D M C+ Q
Sbjct:   64 GQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFT--------PKNGITPLHIAA--RRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGA---PIQAKTKNGLSPIHMAAQGDHMDCVRQ 298          
BLAST of BED-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 3.404e-14
Identity = 81/389 (20.82%), Postives = 149/389 (38.30%), Query Frame = 1
Query:  604 IVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEI--NRGQINCTKVNCFLLVILKSAVCLD----DVQFNCHIKK-----------INYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETN------VTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYAY-PCRQ 1698
            ++E+LLKYGA+    T+   +TP+H S    N+ N+   +    ++P     +    L +    GQ    +       +L++   +D    + Q   HI             + ++ S      N    +   +    +++  ILL H  ++  T  K  + L +A +   + + S LL R + P+      +T L  +    ++K+  LL++ GA+ +                   +H+A      E    L++ GA              ETN      V  LHL    +    +  + LL    ++   T  G +P   A +  K+    +L+  G   NA   +  + LI++    N  ++  LLQ+  D+N K    Y P  Q
Sbjct:  120 VMELLLKYGASIEAVTES-GLTPMHVSAFMGNL-NIVLILLQGGASPNATNVRGETALHMAARAGQTEVVR------SLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATA----------KNGYTPLHIAAKKDQLEIATTLLEYGA--------------ETNAITRQGVAPLHLGA--QEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQ 474          

HSP 2 Score: 48.1358 bits (113), Expect = 3.404e-14
Identity = 29/82 (35.37%), Postives = 44/82 (53.66%), Query Frame = 2
Query:  317 NPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 559
            +PLH+    DH++C+++L+Q  A V       +   TAL +A       T  VLL+ GANPNV  ++  +PL  A K+   R
Sbjct:   41 SPLHMATQGDHVECVQVLMQYRAPV---DDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIR 119          

HSP 3 Score: 53.5286 bits (127), Expect = 2.402e-7
Identity = 53/234 (22.65%), Postives = 97/234 (41.45%), Query Frame = 1
Query:  970 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNV---TLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDL 1662
            E + +L+ +R  +++      + L +A           LL +G++PN+      T L  + +K   ++ ELL+ YGA+I            V  +    +HV+    +      L+  GA+              TNV   T LH+A   ++     +  LL  G  +++K  +  TP   A R  K+E   LLL      +A  +   + L ++A + + D+   LL++   L
Sbjct:   53 ECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEA----------VTESGLTPMHVSAFMGNLNIVLILLQGGAS-----------PNATNVRGETALHMAA--RAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASL 263          
BLAST of BED-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 4.901e-12
Identity = 56/194 (28.87%), Postives = 82/194 (42.27%), Query Frame = 1
Query: 1093 RGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNV---TLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLN 1665
            RG +PN       T L  + +K   K+ ELL+ +GA+I+      L            IHVA         Q L+  GA+              TNV   T LH+A   ++  L  +  LL+ G  +  K  +  TP   A R  K E   LLL RG D NA  A   + L  ++ + + D+   LL+N  D++
Sbjct:  359 RGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLT----------PIHVASFMGHLNVVQLLLQNGAS-----------SNATNVRGETPLHMAS--RAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADIS 529          
BLAST of BED-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 5.702e-12
Identity = 56/194 (28.87%), Postives = 82/194 (42.27%), Query Frame = 1
Query: 1093 RGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNV---TLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLN 1665
            RG +PN       T L  + +K   K+ ELL+ +GA+I+      L            IHVA         Q L+  GA+              TNV   T LH+A   ++  L  +  LL+ G  +  K  +  TP   A R  K E   LLL RG D NA  A   + L  ++ + + D+   LL+N  D++
Sbjct:  366 RGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLT----------PIHVASFMGHLNVVQLLLQNGAS-----------SNATNVRGETPLHMAS--RAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADIS 536          
BLAST of BED-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 3.126e-8
Identity = 63/272 (23.16%), Postives = 117/272 (43.01%), Query Frame = 1
Query:  868 FNCHIKKINYLLS-----EYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQ 1668
            +  H++ + +LL      E+K D      ++   + +  E+  +LL     +N      ES L LA     + L + L+ RG++     ++  T LM + ++ H++M  LL+  GANIN         +  + T   ++ +A      E   FLI  GA+L          E+  +  L+  A   +   L  + +LL  G N+ + T+ GDT   +A      +  +LLL  G D    +    + L+ +A   +   ++ L+    D+N+
Sbjct:  276 YKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGH-VEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANIN---------AQTEETQETALTLACCGGFLEVADFLIKAGADL----------ELGCSTPLMEAA---QEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNR 524          

HSP 2 Score: 48.9062 bits (115), Expect = 6.446e-6
Identity = 62/237 (26.16%), Postives = 103/237 (43.46%), Query Frame = 1
Query:  970 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSK--GDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINE-SGLILSAIKKNHDIMKCLLQNQVDLNQK 1671
            +L+DI   H      T S +++ L LA       LV+ L+ RG++      +  T L+ +    H  + ELL++ GA+I          +  + T    + +A     QE  + LI +GAN        + R V ++ T L LA       +N I  LL  G  I S+T    G +P + A       A  LLL  G D NA    N  + L L+  +  H+++  L++ + ++  +
Sbjct:  920 DLVDIDCIH------TESNHDTALTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIE---------AQSERTKDTPLSLACSGGRQEVVELLIARGAN-------KEHRNV-SDYTPLSLAA--SGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHR 1131          
BLAST of BED-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ankfy1 (ankyrin repeat and FYVE domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-041222-1])

HSP 1 Score: 55.4546 bits (132), Expect = 7.207e-8
Identity = 69/252 (27.38%), Postives = 104/252 (41.27%), Query Frame = 1
Query:  982 ILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPI---------------------TSLMFSIQKRHKKMTELLINYGANI-----NENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVD 1659
             L+AH  +IN TNS+ E+ L  A    L  L + LL RG++PN  +  P                      T L  +I   H ++  + +   AN      N  +  D  L + K      + +AL     +    L+  GA        ++ER  +   TLLH AIL K NS   + FLLE   +I  +T++G TP   AIR       + L  RG D    +   +  L ++    N DI   L+++  D
Sbjct:  474 FLVAHGASINHTNSRGETPLHTACHFGLAQLTAELLHRGANPN-AQTGPAYAPSQSQTPSLVPSDDEMHAQTPLHLAIYHNHPEVVAVFLEQKANALNGVNNLQIIPDFSLKDSKEQTV--LGLALWTGMHKIAAQLLGSGA-------AINERSSDGQ-TLLHAAIL-KRNSDGAL-FLLEHNADINIRTAEGQTPLQLAIRQQLPLVVDALCTRGADMTVRDPAGDPPLWVALQGGNDDIASTLVRHGCD 712          
BLAST of BED-type domain-containing protein vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 49.6766 bits (117), Expect = 1.156e-6
Identity = 25/85 (29.41%), Postives = 47/85 (55.29%), Query Frame = 2
Query:  308 DAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 559
            D ++PLH     +H+D ++ML+   A V +     I R   +I A +   +E+  VLL +GA+ N+ +   ++ L +A +RG ++
Sbjct:   28 DGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSK 112          
BLAST of BED-type domain-containing protein vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 43.8986 bits (102), Expect = 4.269e-10
Identity = 78/371 (21.02%), Postives = 144/371 (38.81%), Query Frame = 1
Query:  589 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVD----GVSNNNGK-ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYAY 1686
            +GH  IV++LL+ GA+P     + + TPLH +  S + +   A   L  +AP     K            + T ++C   +  K  V                LL E+K + NS  T       ++   G  + + +LL       +   K  + L +A +   + +   LL RG++PN      +T L  ++   +  +  LL++ G + +          +       ++H+A   +  E    L+  GA+           E    VT LHLA   +    + ++ L+    N+      G TP     +   +   ++L+ +G    A   +  + L ++    N  ++K LLQ Q ++N K    Y
Sbjct:  352 MGHLNIVKILLQKGASPSASNVKVE-TPLHMASRSGHFE--VAEFLLQNAAPVDAKAKD-----------DQTPLHCAARMGHKELV---------------KLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPH----------SAARNGYTALHIAAKQNQVEVANSLLQHGASA--------NAESLQGVTPLHLAS--QEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEY 673          

HSP 2 Score: 40.817 bits (94), Expect = 4.269e-10
Identity = 25/85 (29.41%), Postives = 41/85 (48.24%), Query Frame = 2
Query:  308 DAWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 559
            +  +P+H+    DH+DC+K L+Q  A++       +   T L +A          VLL+ GA PN   ++  +PL  A K+   R
Sbjct:  242 NGLSPIHMAAQGDHMDCVKQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLR 323          

HSP 3 Score: 53.5286 bits (127), Expect = 1.170e-6
Identity = 60/241 (24.90%), Postives = 109/241 (45.23%), Query Frame = 1
Query:  967 KELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANIN------ENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQK 1671
            ++++  L+ +  N+N  + K  + L++A Q N L +V  LL  G++ +I      T L  ++Q+ H+ +  LLI+YG           + CF L      +T    +H+A  Y +    Q L+++GAN        DE      +T LH A   ++     I  LL+ G  I++KT  G +P   A +   ++    LL    + + +   + + L ++A   +H + K LL      N +
Sbjct:   86 EQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFL-----SVTGFTPLHIAAHYENLNVAQLLLNRGAN--------DE------LTPLHCAA--RNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSR 305          
BLAST of BED-type domain-containing protein vs. Ensembl Medaka
Match: ankrd29 (ankyrin repeat domain 29 [Source:NCBI gene;Acc:101171068])

HSP 1 Score: 59.3066 bits (142), Expect = 4.427e-9
Identity = 53/217 (24.42%), Postives = 92/217 (42.40%), Query Frame = 1
Query:  997 RININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQ 1647
            R++ +  +S   + L +A        V  L+++G+D N  R    ++L FS Q  +  + +LL  +GA+      F        LT      VA  Y   +    L+  GAN+          ++    T L LA   +   +  I  LL  G  +      G TP   A +    +   +LL RG D++AV     + L  +A+K ++D+++ LL+
Sbjct:   29 RVDADCRDSVGTTALMVASHGGHYDCVKELIMQGADINYQRETGSSALFFSSQHGYHDVVKLLFEFGASTE----FQTKDGGTALT------VACQYGHSKVVDLLLRNGANV--------HDQLNDGATPLFLAA--QGGHVTVIRHLLSCGAKVNQPREDGTTPLWIAAQMGHSQVVKVLLSRGADRDAVRQDGSTALFKAAMKGHNDVIEELLK 225          
BLAST of BED-type domain-containing protein vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 56.9954 bits (136), Expect = 9.905e-8
Identity = 62/248 (25.00%), Postives = 111/248 (44.76%), Query Frame = 1
Query:  964 GKE-LIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYG-------------ANINENVCFDLVLSN------VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQ 1647
            G+E ++  L+ +  N+N  + K  S L++A Q N L +V  LL  G++ ++      T L  ++Q+ H+ +  LLINYG             A  ++     ++L N      +  T    +H+A  Y +    Q L+++GAN+  T         +  +T LH+A   +  ++  +  LL+ G  I+++T    TP   A R   +    +LL  G     + A  ++GL    +    D M C+ Q
Sbjct:   87 GQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFT--------PKNGITPLHIAS--RRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGA---PIQAKTKNGLSPIHMAAQGDHMDCVRQ 321          

HSP 2 Score: 56.225 bits (134), Expect = 2.085e-7
Identity = 79/357 (22.13%), Postives = 143/357 (40.06%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVS------NNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLL 1644
            GH  I+E+LL++GA  +  TK + ++P+H +   +++D                     CV ++ +       +    L  L  A        +C   ++  +L +     N+   ++G +        N    +D+LL H  ++        + L +A  +  L +V NLL RG+ PN    +  T L  + +  H ++ + L+   A ++     D             +H A     +E  + L+D  AN         +       T LH+A   +   ++ I  LL+ G      T KG TP   A +Y K++   LLL RG + NA      + L ++    N D++K L+
Sbjct:  281 GHVRIIEILLEHGAPIQAKTK-NGLSPIHMAAQGDHMD---------------------CVRQLLQYNAEIDDITLDHLTPLHVAA-------HCGHHRMAKVLLDKGAKANARA-LNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQT----------PLHCAARMGHKELVKLLLDHKAN--------PDSATTAGHTPLHIAA--REGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 587          
BLAST of BED-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000006308.2 (pep primary_assembly:ASM223467v1:1:12516834:12530692:1 gene:ENSORLG00000005003.2 transcript:ENSORLT00000006308.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.083e-7
Identity = 63/252 (25.00%), Postives = 108/252 (42.86%), Query Frame = 1
Query:  967 KELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINY-------------GANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLN 1665
            KE++ +L++   ++N  +    + L++A Q N L +V   L    + +I      T L  ++Q+ H  +  LL+ +              A  ++     L+L N    +  S      +H+A  Y +      L+++GA +  T            +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R     A  LLL RG    A      S L +SA   + + +K LLQ+Q  ++
Sbjct:   66 KEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEHDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTA--------RNGITPLHVAS--KRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVD 307          
BLAST of BED-type domain-containing protein vs. Ensembl Medaka
Match: ankrd50l (ankyrin repeat domain 50 [Source:NCBI gene;Acc:101161928])

HSP 1 Score: 49.6766 bits (117), Expect = 6.641e-7
Identity = 30/79 (37.97%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  323 LHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 559
            L+L+V+ DHL+   +LI++  V +ESR    R TAL +A     +E V++LL+ GA PN  D   + PL   A  G  +
Sbjct:  971 LYLLVLEDHLNMASLLIEKGGVPLESRDSEGR-TALHVASWRGTVEIVDLLLKHGAKPNAQDSEGRPPLHSVAWTGHAK 1048          

HSP 2 Score: 24.2534 bits (51), Expect = 6.641e-7
Identity = 9/16 (56.25%), Postives = 13/16 (81.25%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANP 639
            GH  IV++LL+ G+NP
Sbjct: 1079 GHANIVKMLLEKGSNP 1094          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000004641.1 (SMESG000004641.1)

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 362/364 (99.45%), Postives = 363/364 (99.73%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYA 1683
            GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQLNLLGLV+NLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNY 
Sbjct:  161 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQLNLLGLVNNLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYG 524          

HSP 2 Score: 229.565 bits (584), Expect = 0.000e+0
Identity = 111/112 (99.11%), Postives = 111/112 (99.11%), Query Frame = 2
Query:  215 KSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 550
            KSELIEPVILSKSS PIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG
Sbjct:   50 KSELIEPVILSKSSTPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 161          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000004641.1 (SMESG000004641.1)

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 362/364 (99.45%), Postives = 363/364 (99.73%), Query Frame = 1
Query:  592 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYA 1683
            GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQLNLLGLV+NLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNY 
Sbjct:  161 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQLNLLGLVNNLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYG 524          

HSP 2 Score: 229.565 bits (584), Expect = 0.000e+0
Identity = 111/112 (99.11%), Postives = 111/112 (99.11%), Query Frame = 2
Query:  215 KSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 550
            KSELIEPVILSKSS PIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG
Sbjct:   50 KSELIEPVILSKSSTPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 161          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000004641.1 (SMESG000004641.1)

HSP 1 Score: 493.426 bits (1269), Expect = 4.468e-160
Identity = 257/259 (99.23%), Postives = 258/259 (99.61%), Query Frame = 1
Query:  907 EYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYA 1683
            EYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQLNLLGLV+NLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNY 
Sbjct:    3 EYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQLNLLGLVNNLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYG 261          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000004641.1 (SMESG000004641.1)

HSP 1 Score: 493.041 bits (1268), Expect = 8.554e-160
Identity = 257/259 (99.23%), Postives = 258/259 (99.61%), Query Frame = 1
Query:  907 EYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYA 1683
            EYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQLNLLGLV+NLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNY 
Sbjct:    3 EYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKNESILFLAVQLNLLGLVNNLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYG 261          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000010058.1 (SMESG000010058.1)

HSP 1 Score: 149.058 bits (375), Expect = 4.283e-42
Identity = 86/97 (88.66%), Postives = 88/97 (90.72%), Query Frame = 3
Query: 1791 GGSTSGLHNHLIRKHSIILLKRETLNIEAVESCNSKISPNISVSDDINSRTKISNYFIQIKTIDNSFPAVLARLTARDCLSFKKICTSYDLQELFKS 2081
             GSTSGLHNHLIRKHSI LLKRETLNIEA ES NSKIS NIS+SDD NS TKISNYFIQIKTIDNSFPAVLARLTAR+CLSFKKICTSYDL ELF S
Sbjct:    3 SGSTSGLHNHLIRKHSINLLKRETLNIEAFESRNSKISSNISISDDTNSWTKISNYFIQIKTIDNSFPAVLARLTARNCLSFKKICTSYDLHELFIS 99          
The following BLAST results are available for this feature:
BLAST of BED-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK22.618e-1322.42ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.745e-1222.42ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.827e-1222.42ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK22.177e-1222.42ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK22.287e-1222.42ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-441.161e-722.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.161e-722.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-447.500e-722.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-447.500e-722.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-447.550e-722.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank22.738e-1024.51gene:FBgn0261788 transcript:FBtr0334062[more]
Ank23.859e-1024.51gene:FBgn0261788 transcript:FBtr0303119[more]
Ank24.949e-1024.90gene:FBgn0261788 transcript:FBtr0303117[more]
Ank24.952e-1024.90gene:FBgn0261788 transcript:FBtr0303121[more]
Ank24.958e-1024.90gene:FBgn0261788 transcript:FBtr0303123[more]
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asb2a.11.657e-1335.80ankyrin repeat and SOCS box containing 2a, tandem ... [more]
BX640476.16.485e-1225.87ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
BX640476.17.149e-1225.87ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
BX640476.18.909e-1225.87ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
BX640476.18.977e-1225.87ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gart5.217e-924.55phosphoribosylglycinamide formyltransferase, phosp... [more]
gorasp12.590e-824.52golgi reassembly stacking protein 1 [Source:Xenbas... [more]
pan33.351e-824.46poly(A) specific ribonuclease subunit PAN3 [Source... [more]
ANKRD291.717e-723.96ankyrin repeat domain 29 [Source:NCBI gene;Acc:100... [more]
tpm42.571e-723.31tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank21.973e-1222.42ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank14.431e-1223.14ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank14.498e-1223.14ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank14.966e-1223.14ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank15.139e-1223.14ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
back to top
BLAST of BED-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01484|ANK2_HUMAN1.039e-1021.99Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=... [more]
sp|Q02357|ANK1_MOUSE1.881e-927.93Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV... [more]
sp|Q5UPG5|YL093_MIMIV2.600e-926.02Putative ankyrin repeat protein L93 OS=Acanthamoeb... [more]
sp|Q9ULJ7|ANR50_HUMAN7.021e-924.58Ankyrin repeat domain-containing protein 50 OS=Hom... [more]
sp|P16157|ANK1_HUMAN1.093e-827.93Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
back to top
BLAST of BED-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4C1TIA58.056e-5342.80BED-type domain-containing protein OS=Eumeta varie... [more]
A0A4C1SVE17.497e-5142.11AC transposase OS=Eumeta variegata OX=151549 GN=EV... [more]
A0A4C1TWT26.624e-5041.27BED-type domain-containing protein OS=Eumeta varie... [more]
A0A4C1UW235.510e-4943.78BED-type domain-containing protein OS=Eumeta varie... [more]
A0A4C1U5M16.204e-4940.89BED-type domain-containing protein OS=Eumeta varie... [more]
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a1.178e-1021.35ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3a8.005e-1023.24ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ANKRD501.634e-925.25ankyrin repeat domain 50 [Source:NCBI gene;Acc:103... [more]
ank3a4.523e-923.24ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank1b3.441e-825.40ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007446.13.404e-1420.82pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000000095.14.901e-1228.87pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.15.702e-1228.87pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000002048.13.126e-823.16pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 g... [more]
ankfy17.207e-827.38ankyrin repeat and FYVE domain containing 1 [Sourc... [more]
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO391131.156e-629.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a4.269e-1021.02ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
ankrd294.427e-924.42ankyrin repeat domain 29 [Source:NCBI gene;Acc:101... [more]
ank1b9.905e-825.00ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000006308.21.083e-725.00pep primary_assembly:ASM223467v1:1:12516834:125306... [more]
ankrd50l6.641e-737.97ankyrin repeat domain 50 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004641.10.000e+099.45SMESG000004641.1[more]
SMESG000004641.10.000e+099.45SMESG000004641.1[more]
SMESG000004641.14.468e-16099.23SMESG000004641.1[more]
SMESG000004641.18.554e-16099.23SMESG000004641.1[more]
SMESG000010058.14.283e-4288.66SMESG000010058.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035514 ID=SMED30035514|Name=BED-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2912bp
ATCTTATATGAGATTTTTTCTGGATAAATCTGAGGAGATTCCATTAAGAA
GAGATCATGTTAAAAAATACAAGACAGTAAACCCAGAAGATGTGAAAAGC
GATTTATCTTCCAGCGATACAATTTTTCAACATATCGCAAAGGGGGATTG
TAAATTTGTTAAAGCTTGGCTCCATGGACTTCTCTATGAATCTACAGGAT
GGCAATTATTAGATAAATCCGAACTAATCGAACCAGTTATATTAAGTAAA
TCATCAAAACCCATATTTTGCCAAAAATTCAATATTTCGGATACTTATGT
TTTGCTTGATGCTTGGAATCCTTTACATTTAGTAGTCATTCATGATCATC
TCGATTGTCTTAAAATGTTAATTCAAGAAGCCAAAGTCTTTATAGAATCT
CGATCAATAATCAGTAGAAAAACGGCATTGATTTTAGCGTGTGAATTGTG
CCGACTGGAAACTGTGAATGTTCTCCTAGAATCAGGTGCGAATCCAAATG
TTTGCGATATTTCTAACAAATCTCCATTGTTTTATGCTGCTAAAAGAGGT
GAAACTAGGGAATCCAATAGTGTTGTTATTCTTTTTAAATAGGTCACGAT
ACAATCGTTGAAGTTCTTTTGAAATATGGTGCTAATCCAAGAATTGGTAC
AAAGCGTCATCAAATAACTCCGCTACATGCTTCGTGCATATCAAACAATA
TCGATAATTTGGCAGCTACTATTCAGTTGATTAAGTCAGCACCAGAGGTT
GTTTATTGGAAATCCAGCTGTGTTTTAGAAATAAACAGAGGCCAAATAAA
TTGCACAAAAGTCAACTGTTTTCTCTTAGTGATTTTAAAATCTGCAGTTT
GTCTAGATGATGTGCAATTCAATTGTCATATCAAAAAAATTAATTATCTG
TTAAGTGAATATAAAGTCGACATAAATTCTGTTTGTACTGTCGACGGAGT
ATCAAATAATAATGGAAAGGAATTGATAGATATCCTATTAGCTCATCGGA
TTAATATTAATGAAACCAACTCAAAAAATGAATCAATTTTATTTTTAGCT
GTTCAACTTAACCTTTTAGGATTGGTAAGTAATCTTTTAATAAGAGGATC
TGATCCGAATATCGGCAGAAATCAGCCAATCACGTCGTTAATGTTTTCAA
TTCAGAAAAGACATAAAAAAATGACAGAACTATTAATCAATTATGGGGCA
AATATCAATGAAAATGTTTGCTTTGATTTGGTTTTGTCGAATGTTAAGCT
CACCAATTGCGCTTCCATACATGTTGCTTTGATTTACTCAGACCAAGAAA
CTTTTCAATTTCTCATCGATAAAGGAGCGAATCTGTTTCTAACTGTGGAT
TTATTAGATGAACGAGAGGTTGAGACTAATGTTACTCTGTTGCATTTAGC
AATTCTTTTAAAATCGAATTCCTTGAATTACATTAATTTTCTATTGGAAA
TGGGATTAAATATTGAATCAAAAACGTCAAAAGGAGATACCCCTTTTCTT
TTTGCCATACGGTATTCCAAAATTGAGGCTTGTAATCTTTTGTTATTCAG
GGGCTGTGATAAAAATGCTGTTAATGCTATCAATGAAAGTGGTCTAATTC
TGTCAGCAATTAAAAAAAATCATGATATAATGAAATGTTTACTTCAAAAC
CAAGTGGACTTAAATCAAAAAGACAATTATGCTTATCCATGTCGGCAGCA
AGAAAGTTAGATCTTTGGAATAATTTTACGCGCATGAAAGACGGGAATTC
AGCTGTATGCAAAAGGTGTAATACAATGATAAAATGCACAGGCGGAAGCA
CAAGTGGCCTGCATAATCACCTTATCAGAAAACACAGCATTATTCTTCTA
AAGAGAGAAACACTTAACATAGAAGCTGTTGAATCATGTAACTCTAAAAT
TAGTCCCAACATTTCCGTTTCGGATGATATTAATTCTCGGACCAAAATTT
CCAACTATTTCATACAAATTAAAACCATTGACAACTCATTTCCAGCTGTT
TTAGCGCGACTGACGGCACGTGATTGCTTGTCATTTAAAAAGATTTGCAC
TTCATACGATCTGCAAGAATTGTTTAAATCAAAAGGATATGATATCCCTA
AATCTCCAATGACGATAAAAAGAATAGTTATGGATTATGGTGACAAAATA
CGCCAACAAACCGTCATCGAATTGTCAGAAAGGATAAGTCGTGGTGAATT
ATTCAGTTTGACTTTAGACGAATGGACGTCTTTGAAGAATCGAAGGTTTA
TGAATGTAAATGTTCACTCGTATGATGATATATATTGGAATTTGGGTTTG
GTAAGGATTGAAGGGGCAATGGCTGCCGATAAATGTATCACGTATCTTCA
AAACAAACTTCAAGAATTCAATATTCCAACGGAGAATGTAATTTCAATTA
CTACGGATGGAGCCGCGATTATGAAAAAGGTAGAAAGATTGATTGATGTT
AGTCATCATCAGTATGTTTCGCCCACGGCATCCAGTTAGCCGTAATTAAA
GTGCTTGAAATGATTCAAACTTTTTCAAAGAGCGATTCCGCAACTATTGA
TACGGAATCTGAAATAGTGTGTGAAGAACCATAATTAACTATTGGATCTG
CGATTCCATCGACTTCTGCAGGAACATCTTCAGGGCTCTCAATGAAAGAA
AAACTAAATTTTGTTATTCAAAATAGGATTAATATAAATGCAGATGAAGA
GATCAGTGATCCGAAGACTCCATCTGGGCTTTTAAATATAATAAGAAAAG
AAATGTTATATTTTAAGAAACAAAATATTAAAGGCAAATATTTACAGAAA
GCCCTGAAATATATTTCAACAGTTCGCCCAGCTAGCTTAGAGTCATAAAG
GGCTTTCTCCGTCGCTGGTTTAATTTGCACAAGATCCAGATCCAGCATGA
ATGATGAAACCC
back to top

protein sequence of SMED30035514-orf-1

>SMED30035514-orf-1 ID=SMED30035514-orf-1|Name=SMED30035514-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=190bp
MFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYS
DQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINF
LLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINES
GLILSAIKKNHDIMKCLLQNQVDLNQKDNYAYPCRQQES*
back to top

protein sequence of SMED30035514-orf-2

>SMED30035514-orf-2 ID=SMED30035514-orf-2|Name=SMED30035514-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=197bp
SYMRFFLDKSEEIPLRRDHVKKYKTVNPEDVKSDLSSSDTIFQHIAKGDC
KFVKAWLHGLLYESTGWQLLDKSELIEPVILSKSSKPIFCQKFNISDTYV
LLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELC
RLETVNVLLESGANPNVCDISNKSPLFYAAKRGETRESNSVVILFK*
back to top

protein sequence of SMED30035514-orf-3

>SMED30035514-orf-3 ID=SMED30035514-orf-3|Name=SMED30035514-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=285bp
MFTSKPSGLKSKRQLCLSMSAARKLDLWNNFTRMKDGNSAVCKRCNTMIK
CTGGSTSGLHNHLIRKHSIILLKRETLNIEAVESCNSKISPNISVSDDIN
SRTKISNYFIQIKTIDNSFPAVLARLTARDCLSFKKICTSYDLQELFKSK
GYDIPKSPMTIKRIVMDYGDKIRQQTVIELSERISRGELFSLTLDEWTSL
KNRRFMNVNVHSYDDIYWNLGLVRIEGAMAADKCITYLQNKLQEFNIPTE
NVISITTDGAAIMKKVERLIDVSHHQYVSPTASS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR003656Znf_BED
IPR012337RNaseH-like_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding
GO:0005515protein binding
GO:0015459potassium channel regulator activity
GO:0030507spectrin binding
GO:0030674protein binding, bridging
GO:0044325ion channel binding
GO:0051117ATPase binding
Vocabulary: biological process
TermDefinition
GO:0002027regulation of heart rate
GO:0006874cellular calcium ion homeostasis
GO:0007165signal transduction
GO:0008104protein localization
GO:0010628positive regulation of gene expression
GO:0010881regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
GO:0010882regulation of cardiac muscle contraction by calcium ion signaling
GO:0031647regulation of protein stability
GO:0033292T-tubule organization
GO:0034394protein localization to cell surface
GO:0034613cellular protein localization
GO:0036309protein localization to M-band
GO:0036371protein localization to T-tubule
GO:0042981regulation of apoptotic process
GO:0043268positive regulation of potassium ion transport
GO:0050821protein stabilization
GO:0051924regulation of calcium ion transport
GO:0051928positive regulation of calcium ion transport
GO:0055117regulation of cardiac muscle contraction
GO:0060048cardiac muscle contraction
GO:0070972protein localization to endoplasmic reticulum
GO:0072659protein localization to plasma membrane
GO:0072661protein targeting to plasma membrane
GO:0086004regulation of cardiac muscle cell contraction
GO:0086014atrial cardiac muscle cell action potential
GO:0086015SA node cell action potential
GO:0086036regulation of cardiac muscle cell membrane potential
GO:0086066atrial cardiac muscle cell to AV node cell communication
GO:0086070SA node cell to atrial cardiac muscle cell communication
GO:0086091regulation of heart rate by cardiac conduction
GO:0098904regulation of AV node cell action potential
GO:0098907regulation of SA node cell action potential
GO:0098910regulation of atrial cardiac muscle cell action potential
GO:1901018positive regulation of potassium ion transmembrane transporter activity
GO:1901019regulation of calcium ion transmembrane transporter activity
GO:1901021positive regulation of calcium ion transmembrane transporter activity
GO:2001257regulation of cation channel activity
GO:2001259positive regulation of cation channel activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0014069postsynaptic density
GO:0014704intercalated disc
GO:0016020membrane
GO:0016324apical plasma membrane
GO:0030018Z disc
GO:0030054cell junction
GO:0030315T-tubule
GO:0031430M band
GO:0031672A band
GO:0042383sarcolemma
GO:0043034costamere
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:0048471perinuclear region of cytoplasm