SMED30035513

Overview
NameSMED30035513
Smed IDSMED30035513
Length (bp)761
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30035513 (SMED30035513) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30035513 (SMED30035513) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30035513 (SMED30035513) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30035513 (SMED30035513) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035513

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035513SMESG000012343.1 SmedASXL_011522SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035513SMESG000012343.1 dd_Smed_v6_10712_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30035513SMESG000012343.1 Contig49038newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035513SMESG000012343.1 Contig49038uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30035513SMESG000012343.1 dd_Smed_v4_10712_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30035513 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000001:225103..226660 -3761
Homology
BLAST of SMED30035513 vs. Ensembl Zebrafish
Match: irak1bp1 (interleukin-1 receptor-associated kinase 1 binding protein 1 [Source:NCBI gene;Acc:553809])

HSP 1 Score: 48.521 bits (114), Expect = 2.046e-6
Identity = 44/139 (31.65%), Postives = 70/139 (50.36%), Query Frame = 1
Query:  112 EVLGVCEYLCRPDICILNIQIENIKIKAADAKQAVVKRMLY----AKQCISSFHIKSKCFSDY--ISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKI-DISLEKSEETLREARQKASIGAVVDAKLKA 507
            EV G  E    PD   ++I ++N K    D   +V +R+ Y    A+Q      I S C   Y    I+S+   F  + ++V+ L DF+  Q+   +LIEKL+ S+ + D     S E+L   R++  + AV +A+LKA
Sbjct:   47 EVTGCAEISSPPDRACVSISVKNSKENVNDVTNSVTRRLEYILQTARQHDVKMRISSTCRLRYELYYISSIMMCFLYVQVLVVFL-DFEKMQQARTVLIEKLDKSVCVGDPYYSHSAESLSLLRRRVCLEAVDNARLKA 184          
BLAST of SMED30035513 vs. UniProt/SwissProt
Match: sp|A0P9L2|IKBP1_ONCMY (Interleukin-1 receptor-associated kinase 1-binding protein 1 homolog OS=Oncorhynchus mykiss OX=8022 GN=irak1bp1 PE=3 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 2.564e-9
Identity = 43/158 (27.22%), Postives = 78/158 (49.37%), Query Frame = 1
Query:  112 EVLGVCEYLCRPDICILNIQIENIKIKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKIDIS-LEKSEETLREARQKASIGAVVDAKLKAQSMNAT-GQKV-HVVIVKQIEETER 576
            +V G  E  C  D   +++  +N K    D   ++ +R+ Y  Q +   H+K +  +    I   D  +    L+++   DF   + +  +L+EKL+ S+ +       SEE L   R+   + AV +A+LKA  M++  GQ + H ++V++ E TER
Sbjct:   46 QVTGSAEVSCPADRATVSVSFKNSKESVNDVTNSISRRVEYILQTLRQHHVKGEELTVTRHIYRADDLYHMEALVMVVFSDFGQMERVCIVLLEKLDKSVCVSTPHFYHSEECLGLLRRSVCVAAVENARLKASEMSSMLGQTLGHPLLVREEEATER 203          
BLAST of SMED30035513 vs. UniProt/SwissProt
Match: sp|Q08AV8|IKBP1_XENLA (Interleukin-1 receptor-associated kinase 1-binding protein 1 homolog OS=Xenopus laevis OX=8355 GN=irak1bp1 PE=2 SV=1)

HSP 1 Score: 49.6766 bits (117), Expect = 6.499e-6
Identity = 35/134 (26.12%), Postives = 65/134 (48.51%), Query Frame = 1
Query:  112 EVLGVCEYLCRPDICILNIQIENIKIKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKIDIS-LEKSEETLREARQKASIGAVVDAKLKAQ 510
            +V G  E    PD   + I + + K  AA+AK +V +R+ Y  Q +    +  +  +       +  +++   ++ +   DF   Q   NLL+EKL+ S+ I       + + L + R++  +GAV +A+ KAQ
Sbjct:   44 QVSGSAELSAAPDRAQVCIAVSSSKGTAAEAKSSVQRRLEYIAQSLRQGGVTEENITVSKEFQRLSNTYKMEAVVCVVFSDFDKLQSNCNLLVEKLDSSVNISPPHFYHTADCLEKLRREVCLGAVANARRKAQ 177          
BLAST of SMED30035513 vs. TrEMBL
Match: V4BW21 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_119569 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 7.447e-10
Identity = 43/141 (30.50%), Postives = 82/141 (58.16%), Query Frame = 1
Query:  115 VLGVCEYLCRPDICILNIQIENIKIKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLR------LKDFKIAQEISNLLIEKLEHSIKIDIS-LEKSEETLREARQKASIGAVVDAKLKAQSM 516
            V  V E + RP+ C ++I +   K +A +AK +V +R+ Y KQC+ ++ I S+      +++  ++  R   L++++        DF   QE SNL+IEKL+ ++++ +   +  ++ +   R++AS+ A+ +AKLKAQ M
Sbjct:   36 VSAVGEAILRPNKCKISISVTGRKEEAQEAKSSVSRRVEYIKQCLFNYGITSE------NVDIFERLMREGKLVIMKCDITAVFTDFNKCQEFSNLVIEKLDQNVQVSLPEFQHDDKFIESLRKEASLLAIHNAKLKAQEM 170          
BLAST of SMED30035513 vs. TrEMBL
Match: A0A2T7P5X1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11419 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.573e-9
Identity = 48/181 (26.52%), Postives = 96/181 (53.04%), Query Frame = 1
Query:  112 EVLGVCEYLCRPDICILNIQIENIKIKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKIDIS-LEKSEETLREARQKASIGAVVDAKLKAQSMNATGQKVHVVIVKQ--IEETERPLRDSKLNQEILQFNWTTEIDNQ 645
            +V GV E    PD   + I++ ++K  A DAK +V +R+ Y +Q + + H+K      Y  +  V+        + +   D ++ Q ++NLL+EKL+ ++ + +     S+ +L+ AR+K ++ A+ +AK KA+ M    + VH+++ +   I ET+    ++   +E L+ +    I N+
Sbjct:   40 QVTGVGEVSVPPDRFSITIKVSSLKNSADDAKNSVKRRLDYIQQTLENHHVKDSDIQQYKHMKRVESKVVFDAELHVEFSDLQLCQAVANLLVEKLDSNVSVSLPECFHSKSSLQIARKKCALLAIHNAKEKAKEM---ARFVHLIVGRPLSISETDTKENENDKTEEALELDHFLAIQNK 217          
BLAST of SMED30035513 vs. TrEMBL
Match: A0A4W5Q6G1 (Interleukin-1 receptor-associated kinase 1 binding protein 1 OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.084e-7
Identity = 44/158 (27.85%), Postives = 78/158 (49.37%), Query Frame = 1
Query:  112 EVLGVCEYLCRPDICILNIQIENIKIKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKIDIS-LEKSEETLREARQKASIGAVVDAKLKAQSMNAT-GQKV-HVVIVKQIEETER 576
            +V G  E  C  D   +++   N K    D   ++ +R+ Y  Q +   H+K +  +    I   D  +    L+++   DF   + +  +L+EKL+ S+ + I     SEE L   R+   + AV +A+LKA  M++  GQ + H ++V++ E TER
Sbjct:   46 QVTGSAEVSCPADRATVSVSFRNSKESVNDVTNSISRRVEYILQTLRQHHVKGEELTVTRHIYRADDLYHMEALVIVVFSDFGQMERVCIVLLEKLDKSVCVSIPHFYHSEECLSLLRRSVCVAAVENARLKASEMSSMLGQTLGHPLLVREEEATER 203          
BLAST of SMED30035513 vs. TrEMBL
Match: A0A504Z5W4 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_00502 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 7.459e-7
Identity = 49/170 (28.82%), Postives = 83/170 (48.82%), Query Frame = 1
Query:  103 SLN---EVLGVCEYLCRPDICILNIQIENIKIKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKI-DISLEKSEETLREARQKASIGAVVDAKLKAQSMNAT-GQKVHVVIVKQIEETERPLRDSKL 597
            SLN    V G+CE +  PD+C   + I   K  A  A+Q+V +R  YA+Q I +   ++   S++    S +  F      V+  +D    +++   L  KL + +         S E L +AR+ A   AV DAK KA+++ A  GQ++  ++   + ETE  ++ S +
Sbjct:    7 SLNGQISVTGICELILEPDVCAFEVTIYATKQHANAAEQSVRRRAEYARQEIKNILSRNTAVSEFFDSQSSEDGFSASWKFVVLREDVSRMEKLVAHLKTKLGNYVDFGSYEFYVSPEKLSKARRAAIQQAVSDAKTKAETIAAAFGQRIRGLV--SVVETETSVQPSNV 174          
BLAST of SMED30035513 vs. TrEMBL
Match: A0A060Y203 (Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00013029001 PE=4 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 7.599e-7
Identity = 43/158 (27.22%), Postives = 78/158 (49.37%), Query Frame = 1
Query:  112 EVLGVCEYLCRPDICILNIQIENIKIKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKIDIS-LEKSEETLREARQKASIGAVVDAKLKAQSMNAT-GQKV-HVVIVKQIEETER 576
            +V G  E  C  D   +++  +N K    D   ++ +R+ Y  Q +   H+K +  +    I   D  +    L+++   DF   + +  +L+EKL+ S+ +       SEE L   R+   + AV +A+LKA  M++  GQ + H ++V++ E TER
Sbjct:   46 QVTGSAEVSCPADRATVSVSFKNSKESVNDVTNSISRRVEYILQTLRQHHVKGEELTVTRHIYRADDLYHMEALVMVVFSDFGQMERVCIVLLEKLDKSVCVSTPHFYHSEECLGLLRRSVCVAAVENARLKASEMSSMLGQTLGHPLLVREEEATER 203          
BLAST of SMED30035513 vs. Ensembl Cavefish
Match: irak1bp1 (interleukin 1 receptor associated kinase 1 binding protein 1 [Source:NCBI gene;Acc:103035792])

HSP 1 Score: 50.0618 bits (118), Expect = 6.259e-7
Identity = 42/145 (28.97%), Postives = 69/145 (47.59%), Query Frame = 1
Query:  112 EVLGVCEYLCRPDICILNIQIENIKIKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSV--DKSFRCL-GLIVLRLKDFKIAQEISNLLIEKLEHSIKI-DISLEKSEETLREARQKASIGAVVDAKLKAQSM-NATGQ 531
            EV G  E    PD   L + + + K    DA  +V +R+ Y  Q +    +K +   D +    +  ++   C+   + +   DF+  Q + ++LIEKL+ S+ I D     SEE L   R++  + AV  A+LKA  + N  GQ
Sbjct:   47 EVTGSAELRSPPDRAALIVSVTSSKNSVNDAANSVTRRLEYILQTLRQHAVKEE---DTVVTKHIQREEDLYCVQAEVSVVFSDFEKMQNVRSVLIEKLDRSVYIGDPQFSHSEECLSLLRRRVCVAAVETARLKATEVCNVLGQ 188          
BLAST of SMED30035513 vs. Ensembl Nematostella
Match: EDO32163 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVU7])

HSP 1 Score: 48.9062 bits (115), Expect = 5.599e-7
Identity = 32/104 (30.77%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  199 DAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKIDIS-LEKSEETLREARQKASIGAVVDAKLKA 507
            + K +V +R+ Y  Q + S+ IK  C+     +   +K++     I++   DF   +E+SNLL+EKL+ ++ +       S E L   R +A + AV +AK KA
Sbjct:   71 EVKTSVNRRVEYILQTLKSYRIKDTCYKINRILTRQEKTYFYETEIIVEFSDFLKCEEVSNLLVEKLDETVTVSPPVFYHSTERLANLRCQACVSAVKNAKNKA 174          
BLAST of SMED30035513 vs. Planmine SMEST
Match: SMESG000012343.1 (SMESG000012343.1)

HSP 1 Score: 444.891 bits (1143), Expect = 9.232e-161
Identity = 220/220 (100.00%), Postives = 220/220 (100.00%), Query Frame = 1
Query:   25 MTSKNFQILDLPTFDSAYQYKDDKCGSLNEVLGVCEYLCRPDICILNIQIENIKIKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKIDISLEKSEETLREARQKASIGAVVDAKLKAQSMNATGQKVHVVIVKQIEETERPLRDSKLNQEILQFNWTTEIDNQSLLILSKVQLSFK 684
            MTSKNFQILDLPTFDSAYQYKDDKCGSLNEVLGVCEYLCRPDICILNIQIENIKIKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKIDISLEKSEETLREARQKASIGAVVDAKLKAQSMNATGQKVHVVIVKQIEETERPLRDSKLNQEILQFNWTTEIDNQSLLILSKVQLSFK
Sbjct:    1 MTSKNFQILDLPTFDSAYQYKDDKCGSLNEVLGVCEYLCRPDICILNIQIENIKIKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKIDISLEKSEETLREARQKASIGAVVDAKLKAQSMNATGQKVHVVIVKQIEETERPLRDSKLNQEILQFNWTTEIDNQSLLILSKVQLSFK 220          
BLAST of SMED30035513 vs. Planmine SMEST
Match: SMESG000012343.1 (SMESG000012343.1)

HSP 1 Score: 328.561 bits (841), Expect = 1.387e-115
Identity = 166/166 (100.00%), Postives = 166/166 (100.00%), Query Frame = 1
Query:  187 IKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKIDISLEKSEETLREARQKASIGAVVDAKLKAQSMNATGQKVHVVIVKQIEETERPLRDSKLNQEILQFNWTTEIDNQSLLILSKVQLSFK 684
            IKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKIDISLEKSEETLREARQKASIGAVVDAKLKAQSMNATGQKVHVVIVKQIEETERPLRDSKLNQEILQFNWTTEIDNQSLLILSKVQLSFK
Sbjct:    7 IKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRCLGLIVLRLKDFKIAQEISNLLIEKLEHSIKIDISLEKSEETLREARQKASIGAVVDAKLKAQSMNATGQKVHVVIVKQIEETERPLRDSKLNQEILQFNWTTEIDNQSLLILSKVQLSFK 172          
The following BLAST results are available for this feature:
BLAST of SMED30035513 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035513 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035513 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035513 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
irak1bp12.046e-631.65interleukin-1 receptor-associated kinase 1 binding... [more]
back to top
BLAST of SMED30035513 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035513 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035513 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|A0P9L2|IKBP1_ONCMY2.564e-927.22Interleukin-1 receptor-associated kinase 1-binding... [more]
sp|Q08AV8|IKBP1_XENLA6.499e-626.12Interleukin-1 receptor-associated kinase 1-binding... [more]
back to top
BLAST of SMED30035513 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4BW217.447e-1030.50Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2T7P5X11.573e-926.52Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A4W5Q6G11.084e-727.85Interleukin-1 receptor-associated kinase 1 binding... [more]
A0A504Z5W47.459e-728.82Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A060Y2037.599e-727.22Uncharacterized protein OS=Oncorhynchus mykiss OX=... [more]
back to top
BLAST of SMED30035513 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
irak1bp16.259e-728.97interleukin 1 receptor associated kinase 1 binding... [more]
back to top
BLAST of SMED30035513 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035513 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035513 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO321635.599e-730.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30035513 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035513 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000012343.19.232e-161100.00SMESG000012343.1[more]
SMESG000012343.11.387e-115100.00SMESG000012343.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035513 ID=SMED30035513|Name=SMED30035513|organism=Schmidtea mediterranea sexual|type=transcript|length=761bp
TTACCTTGGTTATGTTATATTTAAATGACTTCTAAGAATTTTCAAATATT
AGATCTACCAACTTTTGATAGTGCATATCAATACAAAGATGATAAATGTG
GGTCACTAAATGAAGTTCTTGGAGTGTGTGAGTATCTCTGCCGACCTGAT
ATATGTATTCTAAACATTCAAATTGAAAATATTAAGATCAAAGCAGCCGA
TGCTAAACAAGCTGTTGTCAAACGCATGTTATATGCTAAACAATGCATAT
CATCATTTCATATCAAATCTAAATGTTTCTCAGATTACATTTCAATAAAC
TCGGTTGATAAGAGTTTTCGATGCCTTGGTTTAATTGTTTTGAGATTGAA
GGATTTCAAGATTGCTCAAGAAATTTCAAATTTATTAATTGAAAAATTGG
AGCATTCAATAAAAATTGACATCAGTCTCGAGAAATCCGAGGAAACCTTA
AGAGAGGCTCGTCAAAAGGCGAGCATCGGTGCTGTTGTCGATGCAAAATT
AAAAGCTCAGTCAATGAATGCCACTGGCCAGAAAGTCCATGTAGTCATTG
TCAAACAAATCGAAGAGACAGAGCGTCCTCTTCGTGATAGCAAATTGAAT
CAGGAAATACTACAATTCAATTGGACAACAGAGATTGATAATCAGTCGCT
TCTGATTCTCAGCAAAGTCCAATTATCTTTCAAATGATCTTTTTATTTGA
CACCTCTCAATTGGTTGTAAAGCAACCAATCAGATAATGTCATAGCGGCT
TTCAGAGTTTT
back to top

protein sequence of SMED30035513-orf-1

>SMED30035513-orf-1 ID=SMED30035513-orf-1|Name=SMED30035513-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=221bp
MTSKNFQILDLPTFDSAYQYKDDKCGSLNEVLGVCEYLCRPDICILNIQI
ENIKIKAADAKQAVVKRMLYAKQCISSFHIKSKCFSDYISINSVDKSFRC
LGLIVLRLKDFKIAQEISNLLIEKLEHSIKIDISLEKSEETLREARQKAS
IGAVVDAKLKAQSMNATGQKVHVVIVKQIEETERPLRDSKLNQEILQFNW
TTEIDNQSLLILSKVQLSFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR030312IRAK1BP1
IPR007497DUF541
Vocabulary: biological process
TermDefinition
GO:0007249I-kappaB kinase/NF-kappaB signaling
GO:0016310phosphorylation
GO:0006955immune response
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007497Protein of unknown function DUF541PFAMPF04402SIMPLcoord: 33..181
e-value: 1.0E-9
score: 39.1
IPR030312Interleukin-1 receptor-associated kinase 1-binding protein 1PANTHERPTHR18842INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 1-BINDING PROTEIN 1coord: 30..219