low density lipoprotein receptor related-2

Overview
Namelow density lipoprotein receptor related-2 (AFJ24815.1)
Smed IDSMED30035485
Length (bp)1080
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of low density lipoprotein receptor related-2 (SMED30035485) t-SNE clustered cells

Violin plots show distribution of expression levels for low density lipoprotein receptor related-2 (SMED30035485) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of low density lipoprotein receptor related-2 (SMED30035485) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for low density lipoprotein receptor related-2 (SMED30035485) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035485

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30035485SMESG000009332.1 SMESG000009320.1 Contig505GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30035485SMESG000009332.1 SMESG000009320.1 Contig505GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
secretory cellSMED30035485SMESG000009332.1 SMESG000009320.1 Contig505GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30035485SMESG000009332.1 SMESG000009320.1 Contig505GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30035485SMESG000009332.1 SMESG000009320.1 Contig505GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30035485SMESG000041448.1 Contig505GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30035485SMESG000041448.1 Contig505GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
secretory cellSMED30035485SMESG000041448.1 Contig505GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30035485SMESG000041448.1 Contig505GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30035485SMESG000041448.1 Contig505GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
tailSMED30035485SMESG000041448.1 SmedASXL_009700SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30035485SMESG000041448.1 dd_Smed_v4_3632_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035485SMESG000041448.1 dd_Smed_v4_3632_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30035485SMESG000041448.1 Contig42571newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30035485SMESG000041448.1 Contig42571newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of low density lipoprotein receptor related-2 vs. TrEMBL
Match: I1ZIG1 (Low density lipoprotein receptor related-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 3.785e-133
Identity = 256/269 (95.17%), Postives = 256/269 (95.17%), Query Frame = 1
Query:  199 DRKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDGKGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHCELKLCNPEICGKSDECCCITVCKKENSGKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGXXXXXXXXXXXXXXXXXXXXXXXTENKSSNTESKKFLXXXXXXXXXXXXXXLETDDCKTEKNECCATKMCC 1005
            D KDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFD KGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHCELKLCNPEICGKSDECCCITVCKKENSGKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGKFEECCCVKVCLEKKDSKDLKDKTENKSSNTE          DD CCIKICLETDDCKTEKNECCATKMCC
Sbjct:    1 DGKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDEKGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHCELKLCNPEICGKSDECCCITVCKKENSGKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGKFEECCCVKVCLEKKDSKDLKDKTENKSSNTEICCSS-----DDCCCIKICLETDDCKTEKNECCATKMCC 264          

HSP 2 Score: 74.7146 bits (182), Expect = 1.379e-11
Identity = 76/186 (40.86%), Postives = 96/186 (51.61%), Query Frame = 1
Query:  187 HCVMDRKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDGKGCAKSDECCGIRVCLDRNDRKEK----CQLKFCKTAICGKSDKCFGIKVCPDKEDGQ---NHCELKLCNPEICGKSDECCCITVC-----------KKENSGKFEE-------CCSIKVCLDKNDCKDEEDKIYQLKFC 669
            HC +   +   C  SD  CC        CK E S                K +ECC I+VCLD+ND K++     QLKFCK  ICGKSD+C  IKVC +++D Q   N C+ KLCNPEICGK +ECCC+ VC           K EN     E       CC IK+CL+ +DCK E+++    K C
Sbjct:   98 HCELKLCNPEICGKSDECCC-----ITVCKKENS---------------GKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGKFEECCCVKVCLEKKDSKDLKDKTENKSSNTEICCSSDDCCCIKICLETDDCKTEKNECCATKMC 263          
BLAST of low density lipoprotein receptor related-2 vs. Planmine SMEST
Match: SMESG000041448.1 (SMESG000041448.1)

HSP 1 Score: 353.214 bits (905), Expect = 2.067e-122
Identity = 242/270 (89.63%), Postives = 242/270 (89.63%), Query Frame = 1
Query:  196 MDRKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDGKGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHCELKLCNPEICGKSDECCCITVCKKENSGKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGXXXXXXXXXXXXXXXXXXXXXXXTENKSSNTESKKFLXXXXXXXXXXXXXXLETDDCKTEKNECCATKMCC 1005
            MD KDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFD KGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHCELKLCNP                 ENSGKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGKFEECCCVKVCLEKKDSKDLKDKTENKSSNTE        SSDD CCIKICLETDDCKTEKNECCATKMCC
Sbjct:    1 MDGKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDEKGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHCELKLCNP-----------------ENSGKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGKFEECCCVKVCLEKKDSKDLKDKTENKSSNTEICC-----SSDDCCCIKICLETDDCKTEKNECCATKMCC 248          
BLAST of low density lipoprotein receptor related-2 vs. Planmine SMEST
Match: SMESG000041448.1 (SMESG000041448.1)

HSP 1 Score: 297.36 bits (760), Expect = 6.674e-101
Identity = 197/270 (72.96%), Postives = 202/270 (74.81%), Query Frame = 1
Query:  196 MDRKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDGKGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHCELKLCNPEICGKSDECCCITVCKKENSGKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGXXXXXXXXXXXXXXXXXXXXXXXTENKSSNTESKKFLXXXXXXXXXXXXXXLETDDCKTEKNECCATKMCC 1005
            MD KDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFD KGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHCELKLCNP                 ENSGKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGK +ECCC+KVCLE+KD +D  +                                    TENKSSNTE        SSDD CCIKICLETDDCKTEKNECCATKMCC
Sbjct:    1 MDGKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDEKGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHCELKLCNP-----------------ENSGKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKFEECCCVKVCLEKKDSKDLKDK-----------------------------------TENKSSNTEICC-----SSDDCCCIKICLETDDCKTEKNECCATKMCC 213          
BLAST of low density lipoprotein receptor related-2 vs. Planmine SMEST
Match: SMESG000041448.1 (SMESG000041448.1)

HSP 1 Score: 265.003 bits (676), Expect = 3.741e-88
Identity = 180/270 (66.67%), Postives = 191/270 (70.74%), Query Frame = 1
Query:  196 MDRKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDGKGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHCELKLCNPEICGKSDECCCITVCKKENSGKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGXXXXXXXXXXXXXXXXXXXXXXXTENKSSNTESKKFLXXXXXXXXXXXXXXLETDDCKTEKNECCATKMCC 1005
            MD KDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFD KGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHCELKLCNPEICGKSDECCC                 IKVCL++ DC+D ++   + K C  EICGK +ECCC+KVCLE+KD +D  +                                    TENKSSNTE          DD CCIKICLETDDCKTEKNECCATKMCC
Sbjct:    1 MDGKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDEKGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHCELKLCNPEICGKSDECCC-----------------IKVCLERKDCQD-QNNTCKFKLCNPEICGKFEECCCVKVCLEKKDSKDLKDK-----------------------------------TENKSSNTEICCSS-----DDCCCIKICLETDDCKTEKNECCATKMCC 212          
BLAST of low density lipoprotein receptor related-2 vs. Planmine SMEST
Match: SMESG000041448.1 (SMESG000041448.1)

HSP 1 Score: 252.292 bits (643), Expect = 4.152e-83
Identity = 198/270 (73.33%), Postives = 202/270 (74.81%), Query Frame = 1
Query:  196 MDRKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDGKGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHCELKLCNPEICGKSDECCCITVCKKENSGKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGXXXXXXXXXXXXXXXXXXXXXXXTENKSSNTESKKFLXXXXXXXXXXXXXXLETDDCKTEKNECCATKMCC 1005
            MD KDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFD KGCAKSDECC                                GI+VC D+ D +  C+LK C                 K  NSGKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGKFEECCCVKVCLEKKDSKDLKDKTENKSSNTE        SSDD CCIKICLETDDCKTEKNECCATKMCC
Sbjct:    1 MDGKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDEKGCAKSDECC--------------------------------GIRVCLDRNDRKEKCQLKFC-----------------KTANSGKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGKFEECCCVKVCLEKKDSKDLKDKTENKSSNTEICC-----SSDDCCCIKICLETDDCKTEKNECCATKMCC 216          
BLAST of low density lipoprotein receptor related-2 vs. Planmine SMEST
Match: SMESG000041448.1 (SMESG000041448.1)

HSP 1 Score: 189.889 bits (481), Expect = 2.429e-59
Identity = 121/179 (67.60%), Postives = 134/179 (74.86%), Query Frame = 1
Query:  196 MDRKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDGKGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQ---NHCELKLCNPEICGKSDECCCITVC-----------KKENSGKFEE-------CCSIKVCLDKNDCKDEEDKIYQLKFC 669
            MD KDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFD KGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSD+C  IKVC +++D Q   N C+ KLCNPEICGK +ECCC+ VC           K EN     E       CC IK+CL+ +DCK E+++    K C
Sbjct:    1 MDGKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDEKGCAKSDECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGKFEECCCVKVCLEKKDSKDLKDKTENKSSNTEICCSSDDCCCIKICLETDDCKTEKNECCATKMC 179          

HSP 2 Score: 127.102 bits (318), Expect = 3.785e-35
Identity = 116/143 (81.12%), Postives = 121/143 (84.62%), Query Frame = 1
Query:  577 GKFEECCSIKVCLDKNDCKDEEDKIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGXXXXXXXXXXXXXXXXXXXXXXXTENKSSNTESKKFLXXXXXXXXXXXXXXLETDDCKTEKNECCATKMCC 1005
             K +ECC I+VCLD+ND K++     QLKFCK  ICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGKFEECCCVKVCLEKKDSKDLKDKTENKSSNTE          DD CCIKICLETDDCKTEKNECCATKMCC
Sbjct:   47 AKSDECCGIRVCLDRNDRKEK----CQLKFCKTAICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGKFEECCCVKVCLEKKDSKDLKDKTENKSSNTEICCSS-----DDCCCIKICLETDDCKTEKNECCATKMCC 180          
The following BLAST results are available for this feature:
BLAST of low density lipoprotein receptor related-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low density lipoprotein receptor related-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low density lipoprotein receptor related-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low density lipoprotein receptor related-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low density lipoprotein receptor related-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low density lipoprotein receptor related-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low density lipoprotein receptor related-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low density lipoprotein receptor related-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
I1ZIG13.785e-13395.17Low density lipoprotein receptor related-2 (Fragme... [more]
back to top
BLAST of low density lipoprotein receptor related-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low density lipoprotein receptor related-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low density lipoprotein receptor related-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low density lipoprotein receptor related-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low density lipoprotein receptor related-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low density lipoprotein receptor related-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041448.12.067e-12289.63SMESG000041448.1[more]
SMESG000041448.16.674e-10172.96SMESG000041448.1[more]
SMESG000041448.13.741e-8866.67SMESG000041448.1[more]
SMESG000041448.14.152e-8373.33SMESG000041448.1[more]
SMESG000041448.12.429e-5967.60SMESG000041448.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035485
GenBankAFJ24815.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035485 ID=SMED30035485|Name=low density lipoprotein receptor related-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1080bp
CAGTTAATCAATGGCAAACAAAACAGTTAATCAATGGCAAACACGTGAAA
AATTATTCCAATGTGAAATATGTGAAAATGTTCAATTGAATTTCCGATAT
TTTTATGATTAAATAAATTTCACATGTTTCACATGTTTCACATTGAACCG
GTATAAAAACAATACTGACATTCCATTGAAATTTATCATTGCGTAATGGA
CAGAAAAGACAAATCGTGCTGCGTTTCTTCGGACCGTAAATGTTGCAAAG
ATGGCGAAACTTCTGGTGATTGCAAGGATGAGCAAAGTGTTTGCGCAAAT
TTTTCGAAAATGTCTTTTGATGGAAAAGGATGTGCAAAATCTGATGAATG
CTGTGGTATTCGAGTTTGTTTGGACAGAAATGATCGAAAAGAAAAATGCC
AGTTGAAATTTTGTAAAACCGCAATATGTGGAAAATCTGATAAATGTTTT
GGTATCAAAGTTTGCCCAGACAAAGAAGATGGACAAAATCACTGTGAATT
AAAGCTTTGCAATCCTGAAATTTGTGGCAAATCTGACGAATGCTGCTGTA
TTACGGTTTGCAAAAAAGAAAACAGCGGCAAGTTTGAAGAATGCTGTAGT
ATTAAAGTTTGTCTAGATAAAAACGATTGTAAAGACGAAGAAGACAAAAT
ATATCAACTAAAATTTTGCAAATGCGAAATATGCGGAAAATCCGACGAAT
GCTGTTGTATTAAAGTTTGCTTGGAACGAAAAGACTGTCAAGATCAGAAT
AATACTTGCAAATTTAAATTGTGCAATCCAGAAATATGTGGCAAATTCGA
GGAATGTTGCTGTGTGAAGGTTTGTTTGGAGAAAAAAGATAGTAAAGATT
TAAAGGATAAAACCGAGAATAAATCAAGCAACACCGAAAGTAAAAAGTTT
CTCATTTGCTGTTCATCTGATGATAGTTGCTGTATTAAAATTTGTCTGGA
AACAGACGACTGCAAAACCGAAAAAAACGAATGCTGTGCAACAAAAATGT
GCTGTTGATTGAACTGAAATTAATTTTGTGTTAATTGAACATTAAATTTT
TATTATTTTTCAATAAAAGTATTTAACAAA
back to top

protein sequence of SMED30035485-orf-1

>SMED30035485-orf-1 ID=SMED30035485-orf-1|Name=SMED30035485-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=271bp
MDRKDKSCCVSSDRKCCKDGETSGDCKDEQSVCANFSKMSFDGKGCAKSD
ECCGIRVCLDRNDRKEKCQLKFCKTAICGKSDKCFGIKVCPDKEDGQNHC
ELKLCNPEICGKSDECCCITVCKKENSGKFEECCSIKVCLDKNDCKDEED
KIYQLKFCKCEICGKSDECCCIKVCLERKDCQDQNNTCKFKLCNPEICGK
FEECCCVKVCLEKKDSKDLKDKTENKSSNTESKKFLICCSSDDSCCIKIC
LETDDCKTEKNECCATKMCC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000105secretory cell
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0000421tail
PLANA:0003116parenchymal cell