PKD2-3

Overview
NamePKD2-3 (AKN21729.1)
Smed IDSMED30035484
Length (bp)2601
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PKD2-3 (SMED30035484) t-SNE clustered cells

Violin plots show distribution of expression levels for PKD2-3 (SMED30035484) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PKD2-3 (SMED30035484) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PKD2-3 (SMED30035484) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035484

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30035484SMESG000059487.1 SmedASXL_004680SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30035484SMESG000059487.1 SmedASXL_002641SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30035484SMESG000059487.1 SMESG000033381.1 dd_Smed_v4_17348_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035484SMESG000059487.1 SMESG000033381.1 dd_Smed_v4_17348_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035484SMESG000059487.1 SMESG000033381.1 dd_Smed_v4_17348_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035484SMESG000059487.1 SMESG000033381.1 dd_Smed_v4_17348_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035484SMESG000059487.1 SMESG000033381.1 dd_Smed_v6_17348_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
oocyteSMED30035484SMESG000080698.1 SMESG000059487.1 Contig43260newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30035484SMESG000080698.1 SMESG000059487.1 Contig43260uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30035484SMESG000080698.1 SMESG000059487.1 Contig43260newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30035484SMESG000080698.1 SMESG000059487.1 Contig43260uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035484SMESG000080698.1 SMESG000059487.1 Contig43260newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035484SMESG000080698.1 SMESG000059487.1 Contig43260uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035484SMESG000059487.1 Contig29082newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035484SMESG000059487.1 Contig29082uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PKD2-3 vs. Ensembl Human
Match: PKD2 (polycystin 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9009])

HSP 1 Score: 392.119 bits (1006), Expect = 2.237e-121
Identity = 252/704 (35.80%), Postives = 414/704 (58.81%), Query Frame = 3
Query:  381 LWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGN---LMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKK-------KISEAMNSEKDGSFKRQNSKSQINLRESDSN-------AIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            LW TR  ++ + +N + Y+ + LREL  YL+FL++L ++++G +++N +Y+   M   F++        +   F  LS+   +W++ +   L  L+W       +P   TE +    +++E  L+GV R+RQ+R +   C +P  L      CY+ YS+ ++D AP  P ++   W YTS +     +++G I+ Y G GY +DL+    +T   V+ LK+  W+DRGTRA F+DF V+N N+NLFC VR++ EFP  GGV+ S+   P KL+RY + F++F+  CEI+F  FI YY +E ILE R  K   F+++W+  D+V+V++S++ I  NIYR   V + +   +   +T+P F+ ++ +   F +  ++ +F   +K+FK+I FN+TM+ LS+T+ R  K++FGF++MF I+F+A+AQLAYL+FG+   D+S  Q  + +QFRIILGD ++  + EAN   G IYF  +VFF+FF+L+NMF+AII + Y +VK D       + +S+  +      + + K+K   + DI +++  G       L FDE R  +K KG+ D EIEA+F+KYD DGDQ L  +E +QM + LE E++        +   M+S    SF R    S+ +  E   +           V+ EE   L  R+D +E+++  I+ KID V+  +E +E  KL  ++V+G++L+
Sbjct:  200 LWGTRL-MEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDT--PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYW-----KMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP-RNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNV-EVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSR---SFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLD 886          
BLAST of PKD2-3 vs. Ensembl Human
Match: PKD2L1 (polycystin 2 like 1, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9011])

HSP 1 Score: 382.489 bits (981), Expect = 2.279e-119
Identity = 246/689 (35.70%), Postives = 403/689 (58.49%), Query Frame = 3
Query:  339 NSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEI---EAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIE 2396
            +S C  +C+ I   LW T T  +    N ++YI TTLREL +Y++FLV + L+++G  +++++Y+   M   F++   D G    + F  +S+   +W++     L  L+W   W N++       + +Y+E  L+GV R+RQ++ +   C +          CY+ YS   ++  P  P      WTY S       +++G ++ Y GGGY +DL      + + +  L+E  W+DRGTR VF+DF V+N N+NLFC +R+V EFP  GG + S+ I   KL+RY S +++FI+ CE++F +FI YY +E ILE    + +   + W+I D+VV+L+SI+ + F+I+R + VN+ +  ++   +TY  F+ ++ +   + +  ++NLF A +KIFKYI FNKTMT LSSTL R  K+I GF+VMF IVF A+AQL YL+FG+   ++S     + +QFRIILGDFDY A+  AN   G  YFV YVFFVFFVL+NMF+AII + Y +VK +       + +S+  K      + R +++ +++ D+Q  +  G+      + F+++  T+++ G+A+ EI    A F+K+D DG+++LD  EQ++M + LE E+     A+N+E +   +   S  Q       + A  +V+ EE   L  R+  LE  ++ ++ +ID V S ++ +E
Sbjct:   67 SSCCLHICQGIRG-LWGT-TLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDTG----VSFQAISSMADFWDFAQGPLLDSLYWT-KWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGT-AWTYHSQDELGGFSHWGRLTSYSGGGYYLDLPGSRQGSAEALRALQEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIVGCEVIFCVFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKERVSDVQKVLQGGEQE----IQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEKMRQDLEEERV----ALNTEIEKLGRSIVSSPQGKSGPEAARAGGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLE 739          
BLAST of PKD2-3 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 271.166 bits (692), Expect = 1.445e-79
Identity = 189/539 (35.06%), Postives = 317/539 (58.81%), Query Frame = 3
Query:  426 DIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQT-ISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYL-GFDE 2036
            ++ I TTL+EL +Y IFL+ L +++FG +N + +Y    M + F++        +   F  + +   +W++++   L+ L+WD  + N +       + +Y+E  L+GV R+RQ++ +   C++ S   S    CY KY+  N+D +     + N  W Y++S  +   ++        GG       S S   N+ + DL+  +WI RGTR +F+DF ++N N+NLFC +R+VAEFP  GG++TS+     KLLRY S ++YFI  CEI F IF+  +  + + + +E K   FK+ W+  +++++L+  + +SFN Y  + +   +  ++ S + Y  F  ++ +   + + I+I +F A +KIFK+I FNKTM+ LSSTL R  K+I GF++MF I+F A+AQL +L+FGS   D+S  Q S+ +QFRI+LGDF++  + +AN   G IYF+ ++FFVFFVL+NMF+AII + Y +VK D +I  +    + +  K     V+E+F++K  +  + +    +GDL   +   GFDE
Sbjct:   22 EVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVP--GEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGL-QINTEWRYSTSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFI-DLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKDEDKKTKGSGDLAEQARREGFDE 556          
BLAST of PKD2-3 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 270.781 bits (691), Expect = 1.490e-79
Identity = 189/539 (35.06%), Postives = 317/539 (58.81%), Query Frame = 3
Query:  426 DIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQT-ISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYL-GFDE 2036
            ++ I TTL+EL +Y IFL+ L +++FG +N + +Y    M + F++        +   F  + +   +W++++   L+ L+WD  + N +       + +Y+E  L+GV R+RQ++ +   C++ S   S    CY KY+  N+D +     + N  W Y++S  +   ++        GG       S S   N+ + DL+  +WI RGTR +F+DF ++N N+NLFC +R+VAEFP  GG++TS+     KLLRY S ++YFI  CEI F IF+  +  + + + +E K   FK+ W+  +++++L+  + +SFN Y  + +   +  ++ S + Y  F  ++ +   + + I+I +F A +KIFK+I FNKTM+ LSSTL R  K+I GF++MF I+F A+AQL +L+FGS   D+S  Q S+ +QFRI+LGDF++  + +AN   G IYF+ ++FFVFFVL+NMF+AII + Y +VK D +I  +    + +  K     V+E+F++K  +  + +    +GDL   +   GFDE
Sbjct:   22 EVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVP--GEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGL-QINTEWRYSTSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFI-DLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKDEDKKTKGSGDLAEQARREGFDE 556          
BLAST of PKD2-3 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 253.062 bits (645), Expect = 4.391e-73
Identity = 184/539 (34.14%), Postives = 304/539 (56.40%), Query Frame = 3
Query:  426 DIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQT-ISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYL-GFDE 2036
            ++ I TTL+EL +Y IFL+ L +++FG +N + +Y    M + F++        +   F  + +   +W++++   L+ L+WD  + N +       + +Y+E  L+GV R+RQ++ +   C++ S   S    CY KY+  N+D +     + N  W Y++S  +   ++        GG       S S   N+ + DL+  +WI RGTR +F+DF ++N N+NLFC +R+VAEFP  GG++TS+     KLLRY S ++YFI  CEI F IF+  +  + + + +E K   FK+ W+                      ++   +  ++ S + Y  F  ++ +   + + I+I +F A +KIFK+I FNKTM+ LSSTL R  K+I GF++MF I+F A+AQL +L+FGS   D+S  Q S+ +QFRI+LGDF++  + +AN   G IYF+ ++FFVFFVL+NMF+AII + Y +VK D +I  +    + +  K     V+E+F++K  +  + +    +GDL   +   GFDE
Sbjct:   22 EVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVP--GEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGL-QINTEWRYSTSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFI-DLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWN----------------------WLELLLLLLLKSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKDEDKKTKGSGDLAEQARREGFDE 534          
BLAST of PKD2-3 vs. Ensembl Celegans
Match: pkd-2 (Polycystin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U1S7])

HSP 1 Score: 205.297 bits (521), Expect = 1.323e-55
Identity = 174/633 (27.49%), Postives = 318/633 (50.24%), Query Frame = 3
Query:  522 SFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTY-TSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQ 2417
            S+Y++  M + F+      G      F   ++    W++L  V +  ++W ++  ++  E     N++Y+E +L+G  R+R ++     C +          C+  Y    +D   M  + S   + Y T+ ++          S  GGG       + S +    ++ LK   WIDRG+RA+ +DF ++N N+NLFC V+++ E P  GGV+T+  +    LL Y ++    ++  E +F  FI+Y+  E +      +      +W++ D+V++  S+  I  ++ R      ++++VI +  T   FD ++  +  + +  +  +F+A +K+FK+I  NKTM+ LSSTL RS K+I GF+VMF + F AFAQ  YL FG+   DYS +  S  +  R+ILGDF++ AL   N  FG  +F+ YVFFV F+L+NMF+AII ++YV+VK +         + ++F +K   + +R K   +     +DA             +++++L + + GYA+ +I   F++++V             M E +    +K++E +  E               + E   N +E     +   LN R+D ++ +V  I+ +I+ V +++++IE Q++  Q
Sbjct:   99 SYYYSKVMSDLFVAST---GASGAPAFGSCTSMDNIWDWLSQVLIPGIYWTETSNSTDNE-----NMIYYENRLLGEPRIRMLKVTNDSCTVMKSFQREIKECFANYEEKLEDKT-MVGDGSVDAFIYATAKELENLKTVGTIASYGGGGFVQRLPVAGSTEAQSAIATLKANRWIDRGSRAIIVDFALYNANINLFCVVKLLFELPASGGVITTPKLMTYDLLTYQTSGGTRMMIFEGIFCGFILYFIFEELFAIGRHRLHYLTQFWNLVDVVLLGFSVATIILSVNRTKTGVNRVNSVIENGLTNAPFDDVTSSENSYLNIKACVVFVAWVKVFKFISVNKTMSQLSSTLTRSAKDIGGFAVMFAVFFFAFAQFGYLCFGTQIADYSNLYNSAFALLRLILGDFNFSALESCNRFFGPAFFIAYVFFVSFILLNMFLAIINDSYVEVKAELARKKDGEGILDWFMNKVRGLTKRGK---RPDAPGEDAT------------YEDYKLMLYRAGYAEKDINEAFTRFNV-----------TSMTEHV---PEKVAEDIADE------------VARMTEQKRNYME--NHRDYANLNRRVDQMQESVFSIVDRIEGVNATLQTIEKQRVQQQ 679          
BLAST of PKD2-3 vs. Ensembl Celegans
Match: lov-1 (Location of vulva defective 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09624])

HSP 1 Score: 72.4034 bits (176), Expect = 1.355e-12
Identity = 101/502 (20.12%), Postives = 212/502 (42.23%), Query Frame = 3
Query:  582 NLKDLQFPDLSNTRQYWEYL-DNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSK-VIPCQMPSYLLSRNFPCYEKYSIFNDDS-----APMRPNKSNPG------WTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSA--------------FEYFILCCEILFVIFIIYYAIEVILEFR---EIKWQI-FKNY--WSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSD-DTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQD 1985
            N  D  F  + +   +W++  +++A   L    SW +  P       +     + +G+  +RQVR+K    C M          C E+ +  N++      A     +S  G      +TY +S+    +   G +  Y GGGY I ++    +   + + L  + WID  TRAV ++F  +N  +N F  V+++ E P  G  + +  +   +L++   +              F   I   EI+F ++  Y  I  +   R   +I +Q+   N+  W+  D++V  +++  +     R    N+ +     ++ ++Y    +   ++ +F + ++  +F    K+ + +RFN+ +  L++TL  +   I  F + FL   + F  + Y + G+    Y  +  +  +    +LG  D  ++   +  F  +  +LY+     +++ ++V II   + ++++D         + +  K KT   +   + K    V I D
Sbjct: 2718 NYGDNTFMSIQHADDFWDWARESLATALL---ASWYDGNPAYGMRAYMNDKVSRSMGIGTIRQVRTKKSAECTMFKQFQGYINDCGEELTSKNEEKTLYMQAGWTELESENGTDASDEYTYKTSEELSTETVSGLLYSYSGGGYTISMSGTQAEIITLFNKLDSERWIDDHTRAVIIEFSAYNAQINYFSVVQLLVEIPKSGIYLPNSWVESVRLIKSEGSDGTVVKYYEMLYIFFSVLIFVKEIVFYLYGRYKVITTMKPTRNPFKIVYQLALGNFSPWNFMDLIVGALAVASVLAYTIRQRTTNRAMEDFNANNGNSYINLTEQRNWEIVFSYCLAGAVFFTSCKMIRILRFNRRIGVLAATLDNALGAIVSFGIAFLFFSMTFNSVLYAVLGNKMGGYRSLMATFQTALAGMLGKLDVTSIQPIS-QFAFVVIMLYMIAGSKLVLQLYVTIIMFEFEEIRNDSEKQTNDYEIIDHIKYKTKRRLGLLEPKDFAPVSIAD 3215          
BLAST of PKD2-3 vs. Ensembl Fly
Match: Pkd2 (gene:FBgn0041195 transcript:FBtr0080365)

HSP 1 Score: 192.2 bits (487), Expect = 2.474e-50
Identity = 130/400 (32.50%), Postives = 212/400 (53.00%), Query Frame = 3
Query:  711 EGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNK---------SNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQI-FKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDET 1880
            EG +  +E  L+G  R+RQ+R +   C +    +     CY  YS   +D  PM             S P WT  +   +                Y ++L  D ++  +I++DLK+  W+DRG+R   ++F +FN N ++F  ++++AE P  GGV+    +   K+  + +     +    I + I +IYY I  I E R+   +I F +  +I D  ++L   + + +NI+    V   ++    SD TY   D +  ++ ++   ++I  F+  +KIFK+I FNKT+   ++TL R  K++ GFS+MF IVF+A+AQL  L+FG+   D+    TS+L+  R+ILGDF Y  + +AN   G IYF+ Y+  VFF+L+NMF+AII E Y  VK + T
Sbjct:  424 EGRVFLYENLLLGPPRLRQIRVRKESCYVNDAFIRYFNTCYAAYSSGAEDRKPMHKGSPFRTMHDLDSTPIWTVLAFYRTGG--------------YTVNLDYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNENTDIFQSIKLIAEIPPTGGVIPQAHLQTVKMYSFFTDRSMLMTVIYIFWYIMVIYYTIYEITEIRKSGIKIYFCSMLNILDCAILLGCYLALVYNIWHSFKV-MSLTARAHSDVTYQSLDVLCFWNIIYVDMMAILAFLVWIKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMFGIVFLAYAQLGLLLFGTKHPDFRNFITSILTMIRMILGDFQYNLIEQANRVLGPIYFLTYILLVFFILLNMFLAIIMETYNTVKGEIT 808          
BLAST of PKD2-3 vs. Ensembl Fly
Match: brv2 (gene:FBgn0036712 transcript:FBtr0331846)

HSP 1 Score: 62.7734 bits (151), Expect = 1.187e-9
Identity = 55/242 (22.73%), Postives = 110/242 (45.45%), Query Frame = 3
Query: 1026 LKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLL-----RYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKN------YWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLF---IAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLS 1709
            L++ +W+D+ T A+F+D  ++N + NLF  + +  E   FG  +    +    +L     R +S           L ++F+  Y + VIL  R +  +I+ +       W++ D+ + ++++      I R I  +  +   I+   T  Q+    +  RL Q    +  F   I  L+++K ++F     H + TL  + + +    V+ L+V +A      +  G+NA  +S M  SV++
Sbjct:  292 LRDYSWLDKNTSALFIDLTMYNADANLFTLITLRVENSPFGIQLPRVHVDSVSMLGNVETRSNSE----------LLILFV--YTVLVILFARGVFTKIWHHPAAAHEAWTMVDLAIYILNVFLTVLAIMRDIETDALLQ--IIETATKGQYLDFQRPLRLHQMLFIVKGFLVCITTLRLWKVLQFASVFQHFTQTLFSAWRAVASLGVIILVVLMAIGITLAVPNGNNAVVFSHMVQSVVT 519          
BLAST of PKD2-3 vs. Ensembl Fly
Match: brv2 (gene:FBgn0036712 transcript:FBtr0075242)

HSP 1 Score: 62.003 bits (149), Expect = 1.998e-9
Identity = 55/242 (22.73%), Postives = 110/242 (45.45%), Query Frame = 3
Query: 1026 LKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLL-----RYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKN------YWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLF---IAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLS 1709
            L++ +W+D+ T A+F+D  ++N + NLF  + +  E   FG  +    +    +L     R +S           L ++F+  Y + VIL  R +  +I+ +       W++ D+ + ++++      I R I  +  +   I+   T  Q+    +  RL Q    +  F   I  L+++K ++F     H + TL  + + +    V+ L+V +A      +  G+NA  +S M  SV++
Sbjct:  314 LRDYSWLDKNTSALFIDLTMYNADANLFTLITLRVENSPFGIQLPRVHVDSVSMLGNVETRSNSE----------LLILFV--YTVLVILFARGVFTKIWHHPAAAHEAWTMVDLAIYILNVFLTVLAIMRDIETDALLQ--IIETATKGQYLDFQRPLRLHQMLFIVKGFLVCITTLRLWKVLQFASVFQHFTQTLFSAWRAVASLGVIILVVLMAIGITLAVPNGNNAVVFSHMVQSVVT 541          
BLAST of PKD2-3 vs. Ensembl Fly
Match: brv3 (gene:FBgn0040333 transcript:FBtr0340092)

HSP 1 Score: 58.9214 bits (141), Expect = 1.740e-8
Identity = 91/428 (21.26%), Postives = 186/428 (43.46%), Query Frame = 3
Query:  741 LVGVARMRQVRSK-----VIPCQ------MPSYLLS-RNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKW---QIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTV-IVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKA------LSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVK--HDETINNQTISMSEFFKSKTAAVMERFK 1952
            L+GV R+RQ+R       + P +      MP + L  R     +KY    +   P++      G+ +  + +   D+     S     GY+  L   +  + +++  L E  W+   T AVF+DF ++N+++NLF    +  E   FGG+V    +  +KLL       Y  L   +++V+  I +A  + ++     W    + K+ W+  D+ + +V+++ +   + R   V   +  V   S   +  F + S+  +L    I   + I  L++++ ++F       + TL  +   +   ++  +I  I F      + G+ +++++ +   V S    +   F + A      L       G + + +  F +  +LIN+FV++I + +   K   D    N+ I+  EF   + + V+ RF+
Sbjct:  213 LLGVMRLRQLRVSNPQVGLGPPKFSDTYYMPDWQLPYRKLHYSDKYWRIYEPWIPIKM-----GFEFLDALLMNFDHVGSLNSYPELAGYVSLLARSAANSMKVIDYLSENHWLTLNTSAVFIDFTLYNVDVNLFSICTLRVEKTPFGGIVPDVQVDSAKLLENVDQMPYTGLLALLIYVLVFIQFAQTLAVKL----WYEPHLLKSVWNKLDLFIFMVNVLVVVLVVLRESLVASMMKKVEGASKMEFIDFRRPSRMHQLTTITIGFLICITTLRLWRVLQFASVFKLFTRTLYLAWSAVASTAIAIVIFLIGFCFAVVTINGNYSSNFNKL---VKSMVMCMCYSFGFSAQVKPSELFHGGKWLGILCYGVLAFVIIVLLINVFVSLINDYFTVAKTIRDSERENR-ITFFEFLVVEFSGVLGRFR 627          
BLAST of PKD2-3 vs. Ensembl Fly
Match: brv3 (gene:FBgn0040333 transcript:FBtr0300708)

HSP 1 Score: 58.9214 bits (141), Expect = 1.939e-8
Identity = 92/427 (21.55%), Postives = 186/427 (43.56%), Query Frame = 3
Query:  741 LVGVARMRQVRSK-----VIPCQ------MPSYLLS-RNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYA--IEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTV-IVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKA------LSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVK--HDETINNQTISMSEFFKSKTAAVMERFK 1952
            L+GV R+RQ+R       + P +      MP + L  R     +KY    +   P++      G+ +  + +   D+     S     GY+  L   +  + +++  L E  W+   T AVF+DF ++N+++NLF    +  E   FGG+V    +  +KLL       Y  L   +++V+  I +A  + V L +      + K+ W+  D+ + +V+++ +   + R   V   +  V   S   +  F + S+  +L    I   + I  L++++ ++F       + TL  +   +   ++  +I  I F      + G+ +++++ +   V S    +   F + A      L       G + + +  F +  +LIN+FV++I + +   K   D    N+ I+  EF   + + V+ RF+
Sbjct:  213 LLGVMRLRQLRVSNPQVGLGPPKFSDTYYMPDWQLPYRKLHYSDKYWRIYEPWIPIKM-----GFEFLDALLMNFDHVGSLNSYPELAGYVSLLARSAANSMKVIDYLSENHWLTLNTSAVFIDFTLYNVDVNLFSICTLRVEKTPFGGIVPDVQVDSAKLLENVDQMPYTGLLALLIYVLVFIQFAQTLAVKLWYEP---HLLKSVWNKLDLFIFMVNVLVVVLVVLRESLVASMMKKVEGASKMEFIDFRRPSRMHQLTTITIGFLICITTLRLWRVLQFASVFKLFTRTLYLAWSAVASTAIAIVIFLIGFCFAVVTINGNYSSNFNKL---VKSMVMCMCYSFGFSAQVKPSELFHGGKWLGILCYGVLAFVIIVLLINVFVSLINDYFTVAKTIRDSERENR-ITFFEFLVVEFSGVLGRFR 627          
BLAST of PKD2-3 vs. Ensembl Zebrafish
Match: pkd2 (polycystic kidney disease 2 [Source:NCBI gene;Acc:432387])

HSP 1 Score: 417.927 bits (1073), Expect = 5.598e-132
Identity = 257/716 (35.89%), Postives = 418/716 (58.38%), Query Frame = 3
Query:  333 KQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSR--PETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQ-----------EELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            +++  C +   +    LW TR   + N SN ++Y+ T LRE+  Y++FL+ L +I++G ++ N +Y+   M   F++     G  +   F  LS    +W++ +   L  ++W+  W N++  PE  +   L+Y+E  L+GV R+RQ+R +   C +   L    + CY  YS  N+D AP  P K+   W +         +Y+G +S YGGGGY  DL+    K+   + +LK   W+DRGTRAVFLDF ++N N+NLFC VR++ EFP  GG V S+     +LLRY S+++YF+  CE+ F +F++YY +E  LE R  + + FK+ W+  D+++V +S+  I  NI R   V+ ++  ++ +  TYP F+ +++    F +  +I +F++ +K+FK+I FNKTM  LS+T+ R  K++ GF++MF IVF+A+AQLAYL+FG+   D+S  Q  + +QFRIILGDFD+  + EA+   G IYF  +VFF+F +L+NMF+AII + Y +VK D       + +++  K      M + K+K   I DI D++          L FDE R  ++ KG++D EIEA+F+KYD+DGDQ L  +E +QM + LE E++ +    +S    +  R  S+SQ +  E D     + ++           EE   L  R+D +E+++  I+ KID V+  +E++E  K+  + V+G+IL+
Sbjct:  120 QEHRSCGKRILEKMRVLWDTRLLGESN-SNREMYLKTVLREMITYILFLLTLCIITYGMVSTNMYYYTKVMSQLFLDTPLSSG--EPTNFKSLSTMEDFWKFTEGPFLNGMYWE-LWYNNKSLPENQS---LIYYENLLLGVPRLRQLRVRNESCSVHEDLRDEVYDCYNVYSPANEDKAPFGP-KNGTAWRFKDESSLGESSYWGQVSTYGGGGYYQDLSRTREKSANQLQELKNNLWLDRGTRAVFLDFSIYNGNVNLFCIVRLLVEFPATGGAVPSWQFQTVRLLRYVSSWDYFVGMCEVSFCLFVLYYLVEEALEIRLHRLRYFKSLWNCLDVLIVALSVPAIIMNICRTSAVSHRLHFLLENHSTYPNFEPLARLQVHFNNLAAIIVFLSWVKLFKFINFNKTMNQLSTTMSRCAKDLMGFAIMFFIVFLAYAQLAYLVFGTQVNDFSTFQACIFTQFRIILGDFDFSEIEEADSVLGPIYFTTFVFFIFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKSYNRAMVKLKLKKSSINDIPDSLQQA----AGKLSFDELRQDLRGKGHSDAEIEAIFAKYDLDGDQELTEHEHQQMRDDLEKEREDLDLEHSSLPRPASGRSFSRSQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKMKRRDVLGRILD 823          
BLAST of PKD2-3 vs. Ensembl Zebrafish
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 402.134 bits (1032), Expect = 3.576e-127
Identity = 255/698 (36.53%), Postives = 405/698 (58.02%), Query Frame = 3
Query:  327 DEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFN-DDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQ 2417
            +E + S C     +    LW T  + D  K N ++ +   L+EL IY++FLV L L+++G  ++ ++Y+  AM + F+N     G    + F  +      W Y++   L  L+W   W N  P  +   + +Y+E  L+GV R+RQ++ K   C++P+        C++ Y+I   DD A    N +   W Y S +  +  +++G ++ Y G G+  DLT+  +++  ++ DL+E  W+DRGTR +F+DF  +N N+NLFC +R+V EFP  GG + S+ I   KL+RY + ++YFI+ CEI+F +FI+YY +E ILEFR  K   F + W+I D+VV+L++++ I F+ +R I V+  +  ++   D Y  F+ ++ +   + +  ++NLF A +KIFKYI FNKTMT L+STL R   +IFGF++MF IVF A+AQL YL+FG+    +S     + +QFRIILGDFDY A+  AN   G IYF  YVFFVFFVL+NMF+AII + Y +VK +         +++  K   A    + K+K +KI D+Q A+++G     S L F ++R  +K+ G++D EI A FSK+D DG+Q LD  EQ+ M ++LE ++  +S  +          ++ ++ +   E   N    V  E+   L  ++  LEN+V  I+ K+D V   ME + LQ  N +
Sbjct:   54 NEDKKSGCCSFFFRAIKGLWGTALRKD-TKENPELNVKANLKELLIYIVFLVDLCLLTYGMTSSATYYYTKAMTDLFVNLPGSNG----MSFSSIGCMNDVWTYMEGPLLDNLYWT-KWYNDEPLENGNQSFIYYENLLLGVPRVRQLKVKQNSCKVPTDFKKEISDCFDVYNIKKEDDGAFGLINGT--AWQYHSEKEIKGSSHWGLLTTYSGAGFYQDLTTTRDESAALLEDLRENLWLDRGTRVLFIDFTAYNANINLFCVIRLVVEFPATGGAIPSYQIRTVKLIRYVTTWDYFIIGCEIVFCVFILYYIVEEILEFRIHKLSHFTSIWNILDIVVILLAVVAIVFSAFRTIKVDGLLGNLLKQPDIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLTSTLARCALDIFGFAIMFFIVFFAYAQLGYLLFGTEVETFSTFNKCIFTQFRIILGDFDYDAIDRANRVLGPIYFFSYVFFVFFVLLNMFLAIINDTYSEVKSELASQKDEFQIADLIKQSYAKTFMKLKLKKEKISDVQKALDSG----ASELEFKDFRNALKEMGHSDREISAAFSKFDQDGNQTLDKQEQENMKQELEEKRDALSAEL----------RDLENSVEPAEEHRNT---VPPEDYQRLVHKVSQLENSVSAIMSKLDFV---MEKMRLQTFNTE 723          
BLAST of PKD2-3 vs. Ensembl Zebrafish
Match: pkd1l2a (polycystic kidney disease 1 like 2a [Source:ZFIN;Acc:ZDB-GENE-050208-89])

HSP 1 Score: 151.369 bits (381), Expect = 5.824e-37
Identity = 110/394 (27.92%), Postives = 204/394 (51.78%), Query Frame = 3
Query:  696 PETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRP--------NKSNP---GWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAII 1844
            P   T+GN      KLVG AR+RQVR +   C++ + +      C+  YS  ++D     P        N S      W Y +    +A+  +G ++LY GGG+++DL  D    ++++  L + TW+D  TRAVF++F V+N N+NLFC V ++ E    G       +    L + +  F  F++  E ++ IFI+YY +      ++ KW  FK+ W++ ++ ++++S   +S  + R I  N+ I     + D +  F++ +  D +  + I+  + +A +K++  +R N  +  ++STL R+  +I GF V+  I+F+A++    LM+G     Y  +  +  +   + LG F+Y  + + N   GA      + F+ FV++N+F+++I
Sbjct:  683 PGFITDGN-----SKLVGNARIRQVRVRRDTCKIANPMQYSVRDCHAPYSWESEDMGSYSPGWNQTRNVNGSKTVLKPWYYQTQAKLRANPVWGGLALYKGGGFVVDLGPDQKNASRLLQYLFDNTWLDVYTRAVFVEFTVYNANVNLFCIVTLIFETTGVGTFQYRSEVQAVHLYQSTGGFHVFVMASEAIYYIFILYYMVVQGKLMKQQKWAYFKSKWNLLELAIIILSWSALSVFVKRTILGNRDIEFYQNNKDMFVSFNETATADAVLGYLIAFLVLLATIKLWHLLRLNPKLHMITSTLQRAWTDISGFIVVMTIMFLAYSIACNLMYGWRLNSYRTLLEAAQTIICLQLGIFNYDEVLDYNPVLGAFLIGSCIIFMTFVVLNLFISVI 1071          
BLAST of PKD2-3 vs. Ensembl Zebrafish
Match: pkd1l2a (polycystic kidney disease 1 like 2a [Source:ZFIN;Acc:ZDB-GENE-050208-89])

HSP 1 Score: 150.214 bits (378), Expect = 2.555e-36
Identity = 110/394 (27.92%), Postives = 204/394 (51.78%), Query Frame = 3
Query:  696 PETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRP--------NKSNP---GWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAII 1844
            P   T+GN      KLVG AR+RQVR +   C++ + +      C+  YS  ++D     P        N S      W Y +    +A+  +G ++LY GGG+++DL  D    ++++  L + TW+D  TRAVF++F V+N N+NLFC V ++ E    G       +    L + +  F  F++  E ++ IFI+YY +      ++ KW  FK+ W++ ++ ++++S   +S  + R I  N+ I     + D +  F++ +  D +  + I+  + +A +K++  +R N  +  ++STL R+  +I GF V+  I+F+A++    LM+G     Y  +  +  +   + LG F+Y  + + N   GA      + F+ FV++N+F+++I
Sbjct: 2043 PGFITDGN-----SKLVGNARIRQVRVRRDTCKIANPMQYSVRDCHAPYSWESEDMGSYSPGWNQTRNVNGSKTVLKPWYYQTQAKLRANPVWGGLALYKGGGFVVDLGPDQKNASRLLQYLFDNTWLDVYTRAVFVEFTVYNANVNLFCIVTLIFETTGVGTFQYRSEVQAVHLYQSTGGFHVFVMASEAIYYIFILYYMVVQGKLMKQQKWAYFKSKWNLLELAIIILSWSALSVFVKRTILGNRDIEFYQNNKDMFVSFNETATADAVLGYLIAFLVLLATIKLWHLLRLNPKLHMITSTLQRAWTDISGFIVVMTIMFLAYSIACNLMYGWRLNSYRTLLEAAQTIICLQLGIFNYDEVLDYNPVLGAFLIGSCIIFMTFVVLNLFISVI 2431          
BLAST of PKD2-3 vs. Ensembl Zebrafish
Match: pkd1l2b (polycystic kidney disease 1 like 2b [Source:ZFIN;Acc:ZDB-GENE-141222-87])

HSP 1 Score: 146.747 bits (369), Expect = 1.520e-35
Identity = 125/493 (25.35%), Postives = 226/493 (45.84%), Query Frame = 3
Query:  504 GTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRP--------NKSNPG---WTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIIC-------ENYVKVKHDETINNQTISMSEFFKSKT 1928
            G  + N+FY    ++ +F ++G            D   T   + + + V LK LF         P   T+GN      KLVG AR+RQVR K   C++   +L     C   YS  N+D     P        N S  G   W Y S    +A   +G  +LY GGGY++DL  D       +  L   TW+D  TRAVF++F V+N N++LFC V ++ E    G       +    L     +F  F++   +++ +F++YY        +  KW  F+N W++ DM ++++S   +S  I + +  N  I       + +P F   +  D   ++ ++  + +  +K++  +R +  +  ++S+L R+  ++   +V+  I+ +A++    L+FG     Y  +  +  + F + +G F+Y  +  +N   GA+     V    FV++++F++II        EN+   + +ET+    + +  FF  K+
Sbjct:  539 GQQDPNAFYLTQHIQQSF-SKGIS----------DSMKTNDVFVWANTVLLKNLF------GQYPGFITDGN-----SKLVGNARIRQVRVKKDTCKVAKVMLHTVSQCNTPYSWGNEDMMSYGPGWEEFNSVNGSEEGITAWQYQSQSTLKALPVWGLTALYRGGGYVMDLGPDKQNATMKLQYLFNSTWLDEYTRAVFVEFTVYNANVDLFCIVTLILESSAVGAFQFRSVLQNVSLYSSVGSFMSFLMASRVIYFLFVVYYMFLQGKLLKRQKWAYFRNKWNLLDMAIIILSWSSLSLFIQKTVQGNIDIQYYQKHKNQFPSFHDTAAVDATLRYVMAFLVLLGCVKLWHLLRLSPKLYVIASSLQRAWDDMSTLTVVIFIILLAYSLACNLIFGWELYTYRTLPDAFTAIFSLQIGIFNYDEVMNSNPALGAVIISSCVLIATFVVLSLFISIILMAVTEERENHQPSEEEETVELVMMKIMSFFGIKS 1009          
BLAST of PKD2-3 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 387.111 bits (993), Expect = 2.341e-121
Identity = 245/700 (35.00%), Postives = 397/700 (56.71%), Query Frame = 3
Query:  381 LWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQ--FPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKS-----------QINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            LW TR   +   +  + Y+    REL  Y++FLV++ ++++  + +N FY+   M   F++        KD +  F  L     +W++ +   +  L+WD  W N+R       + +Y+E  L+GV R+RQ+R K   C +P  L      CY+ YS+ N+D+ P    ++   WTYT  +     + +G IS+Y G GY IDL+ +  ++   ++ LK   W+DRGTRAVF+DF V+N N+NLFC VR++ EFP  GG++TS+     KL+ Y S+FE+F+  CEI+F IFI+YY IE  LE        F++ W+  D+V++ +S+  I  ++Y++  V   ++  +   + +P  + ++ +   F    ++ +F A +K+FK+  FN+TMT LS+T+ R  K+I GF++MF I+F+A+AQ AYL+FG+   D+S  Q  + +QFRIILGDFD+  + EAN   G IYF  +VFF+FF+L+NMF+AII + Y +VK D       + + +  K   +  M + K+K   + DI ++I  G       L FDE R  +K KG+ D EIEA+F+KYD DGDQ L   E +QM + LE E++ +     S       R   +S             +      ++   V+ EE   L  R+D +E+++  I+ KID V+  +E++E  KL  ++V+G++L+
Sbjct:   15 LWGTRYT-EERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVS----KDERTNFKTLLTMDDFWKFTEGPLMDGLYWD-MWYNNRTMAENH-SFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGL-RNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKGCSKAMVKLKLKKTTVDDISESIRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKEREDLEMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLD 702          
BLAST of PKD2-3 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 385.956 bits (990), Expect = 4.709e-121
Identity = 233/657 (35.46%), Postives = 373/657 (56.77%), Query Frame = 3
Query:  510 INANSFYFAAAMENAFINEGFDFGNLKDLQ--FPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKS-----------QINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            + +N FY+   M   F++        KD +  F  L     +W++ +   +  L+WD  W N+R       + +Y+E  L+GV R+RQ+R K   C +P  L      CY+ YS+ N+D+ P    ++   WTYT  +     + +G IS+Y G GY IDL+ +  ++   ++ LK   W+DRGTRAVF+DF V+N N+NLFC VR++ EFP  GG++TS+     KL+ Y S+FE+F+  CEI+F IFI+YY IE  LE        F++ W+  D+V++ +S+  I  ++Y++  V   ++  +   + +P  + ++ +   F    ++ +F A +K+FK+  FN+TMT LS+T+ R  K+I GF++MF I+F+A+AQ AYL+FG+   D+S  Q  + +QFRIILGDFD+  + EAN   G IYF  +VFF+FF+L+NMF+AII + Y +VK D       + + +  K   +  M + K+K   + DI ++I  G       L FDE R  +K KG+ D EIEA+F+KYD DGDQ L   E +QM + LE E++ +     S       R   +S             +      ++   V+ EE   L  R+D +E+++  I+ KID V+  +E++E  KL  ++V+G++L+
Sbjct:   70 VTSNMFYYTKGMSQLFLDGPVS----KDERTNFKTLLTMDDFWKFTEGPLMDGLYWD-MWYNNRTMAENH-SFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPF-GLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKGCSKAMVKLKLKKTTVDDISESIRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKEREDLEMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLD 715          
BLAST of PKD2-3 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 386.726 bits (992), Expect = 8.148e-121
Identity = 247/714 (34.59%), Postives = 404/714 (56.58%), Query Frame = 3
Query:  339 NSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQ--FPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKS-----------QINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            +++  +   + T  LW TR   +   +  + Y+    REL  Y++FLV++ ++++  + +N FY+   M   F++        KD +  F  L     +W++ +   +  L+WD  W N+R       + +Y+E  L+GV R+RQ+R K   C +P  L      CY+ YS+ N+D+ P    ++   WTYT  +     + +G IS+Y G GY IDL+ +  ++   ++ LK   W+DRGTRAVF+DF V+N N+NLFC VR++ EFP  GG++TS+     KL+ Y S+FE+F+  CEI+F IFI+YY IE  LE        F++ W+  D+V++ +S+  I  ++Y++  V   ++  +   + +P  + ++ +   F    ++ +F A +K+FK+  FN+TMT LS+T+ R  K+I GF++MF I+F+A+AQ AYL+FG+   D+S  Q  + +QFRIILGDFD+  + EAN   G IYF  +VFF+FF+L+NMF+AII + Y +VK D       + + +  K K +  M + K+K   + DI ++I  G       L FDE R  +K KG+ D EIEA+F+KYD DGDQ L   E +QM + LE E++ +     S       R   +S             +      ++   V+ EE   L  R+D +E+++  I+ KID V+  +E++E  KL  ++V+G++L+
Sbjct:   39 HAQAREAGRRETRRLWGTRY-TEERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVS----KDERTNFKTLLTMDDFWKFTEGPLMDGLYWD-MWYNNRTMAENH-SFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPF-GLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIK-KVSKAMVKLKLKKTTVDDISESIRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKEREDLEMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLD 739          
BLAST of PKD2-3 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 387.882 bits (995), Expect = 4.174e-120
Identity = 247/724 (34.12%), Postives = 407/724 (56.22%), Query Frame = 3
Query:  309 NDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQ--FPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKS-----------QINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            N  +  D+   +  + + +  ++ LW TR   +   +  + Y+    REL  Y++FLV++ ++++  + +N FY+   M   F++        KD +  F  L     +W++ +   +  L+WD  W N+R       + +Y+E  L+GV R+RQ+R K   C +P  L      CY+ YS+ N+D+ P    ++   WTYT  +     + +G IS+Y G GY IDL+ +  ++   ++ LK   W+DRGTRAVF+DF V+N N+NLFC VR++ EFP  GG++TS+     KL+ Y S+FE+F+  CEI+F IFI+YY IE  LE        F++ W+  D+V++ +S+  I  ++Y++  V   ++  +   + +P  + ++ +   F    ++ +F A +K+FK+  FN+TMT LS+T+ R  K+I GF++MF I+F+A+AQ AYL+FG+   D+S  Q  + +QFRIILGDFD+  + EAN   G IYF  +VFF+FF+L+NMF+AII + Y +VK D       + + +  K   +  M + K+K   + DI ++I  G       L FDE R  +K KG+ D EIEA+F+KYD DGDQ L   E +QM + LE E++ +     S       R   +S             +      ++   V+ EE   L  R+D +E+++  I+ KID V+  +E++E  KL  ++V+G++L+
Sbjct:  154 NGLVACDKPSLAWATNLLDMPSHRLWGTRY-TEERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVS----KDERTNFKTLLTMDDFWKFTEGPLMDGLYWD-MWYNNRTMAENH-SFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPF-GLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKGCSKAMVKLKLKKTTVDDISESIRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKEREDLEMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLD 865          
BLAST of PKD2-3 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 385.571 bits (989), Expect = 4.367e-119
Identity = 245/700 (35.00%), Postives = 397/700 (56.71%), Query Frame = 3
Query:  381 LWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQ--FPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKS-----------QINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            LW TR   +   +  + Y+    REL  Y++FLV++ ++++  + +N FY+   M   F++        KD +  F  L     +W++ +   +  L+WD  W N+R       + +Y+E  L+GV R+RQ+R K   C +P  L      CY+ YS+ N+D+ P    ++   WTYT  +     + +G IS+Y G GY IDL+ +  ++   ++ LK   W+DRGTRAVF+DF V+N N+NLFC VR++ EFP  GG++TS+     KL+ Y S+FE+F+  CEI+F IFI+YY IE  LE        F++ W+  D+V++ +S+  I  ++Y++  V   ++  +   + +P  + ++ +   F    ++ +F A +K+FK+  FN+TMT LS+T+ R  K+I GF++MF I+F+A+AQ AYL+FG+   D+S  Q  + +QFRIILGDFD+  + EAN   G IYF  +VFF+FF+L+NMF+AII + Y +VK D       + + +  K   +  M + K+K   + DI ++I  G       L FDE R  +K KG+ D EIEA+F+KYD DGDQ L   E +QM + LE E++ +     S       R   +S             +      ++   V+ EE   L  R+D +E+++  I+ KID V+  +E++E  KL  ++V+G++L+
Sbjct:  181 LWGTRYT-EERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVS----KDERTNFKTLLTMDDFWKFTEGPLMDGLYWD-MWYNNRTMAENH-SFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPF-GLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKGCSKAMVKLKLKKTTVDDISESIRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKEREDLEMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLD 868          
BLAST of PKD2-3 vs. Ensembl Mouse
Match: Pkd2l1 (polycystic kidney disease 2-like 1 [Source:MGI Symbol;Acc:MGI:1352448])

HSP 1 Score: 389.808 bits (1000), Expect = 8.943e-123
Identity = 242/686 (35.28%), Postives = 400/686 (58.31%), Query Frame = 3
Query:  339 NSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIE 2396
            +S C  +C  I   LW T T  +    N ++Y+ TTLREL +Y++FLV + L+++G  +++++Y+   M   F++   D G    + F  +S+   +W++     L  L+W   W N++       + +Y+E  L+G  R+RQ+R +   C +          CY+ YS   +D  P  P ++   WTY S       +++G ++ Y GGGY +DL      + + +  L+E  W+DRGTR VF+DF V+N N+NLFC +R+V EFP  GG + S+ I   KL+RY + +++FI+ CE++F +FI YY +E ILE    + +   + W+I D+VV+L+SI+ + F+I+R + VN+ +  ++   DTY  F+ ++ +   + +  ++NLF A +KIFKYI FNKTMT LSSTL R  K+I GF++MF IVF A+AQL YL+FG+   ++S     + +QFRIILGDFDY A+  AN   G +YFV YVFFVFFVL+NMF+AII + Y +VK +       + +S+F K      + R +++ +++ D+Q  +  G    +  + F+++  T+++ G+ + EI A F+++D DGD +LD  EQ+QM + LE E+      +N+E +   +         L    +    +V+ EE   L  R+  L+  ++ ++ +ID V S ++ +E
Sbjct:   67 SSCCLHICRSIRG-LWGT-TLTENTAENRELYVKTTLRELVVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDSG----VSFQTISSMSDFWDFAQGPLLDSLYWT-KWYNNQSLGRGSHSFIYYENLLLGAPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGP-QNGTAWTYHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRVVFIDFSVYNANINLFCILRLVVEFPATGGTIPSWQIRTVKLIRYVNNWDFFIVGCEVVFCVFIFYYVVEEILEIHLHRLRYLSSVWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPDTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDQLQLSDFLKQSYNKTLLRLRLRKERVSDVQKVLKGG----EPEIQFEDFTSTLRELGHEEHEITAAFTRFDQDGDHILDEEEQEQMRQGLEEERV----TLNAEIENLGRSVGHSPPGELGAEAARGQSWVSGEEFDMLTRRVLQLQCVLEGVVSQIDAVGSKLKMLE 736          
BLAST of PKD2-3 vs. Ensembl Mouse
Match: Pkd2 (polycystin 2, transient receptor potential cation channel [Source:MGI Symbol;Acc:MGI:1099818])

HSP 1 Score: 389.808 bits (1000), Expect = 1.246e-120
Identity = 246/698 (35.24%), Postives = 410/698 (58.74%), Query Frame = 3
Query:  381 LWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEY-----------VTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            LW TR   + N +N + Y+ + LREL  YL FLV+L ++++G +++N +Y+   +   FI+        +   F  LS+   +W++ +   L  L+W     N     +   + +++E  L+GV R+RQ+R +   C +P  L      CY+ YS+ ++D AP  P ++   W YTS +     +++G I+ Y G GY +DL+    +T   ++ L+   W+DRGTRA F+DF V+N N+NLFC VR++AEFP  GGVV S+   P KL+RY +AF++F+  CEI+F  FIIYY +E ILE R  +   F+++W+  D+V+V++S++ +  NIYR+    + +   +   +++P F+ ++ +   F +  ++ +F+  +K+FK+I FN+TM+ LS+T+ R  K++FGF++MF I+F+A+AQLAYL+FG+   D+S  Q  + +QFRIILGD ++  + EAN   G +YF  +VFF+FF+L+NMF+AII ++Y +VK D       + +S+  +      + + K+K   +  I +++  G       L FDE R  +K KG+ D EIEA+F+KYD DGDQ L   E +QM + LE E++ +    +S       R   +S  +  E D     +           V+ EE   L  R+D +E+++  I+ KID V+  +E +E  KL  ++V+G++L+
Sbjct:  198 LWGTRLMEESN-ANREKYLKSVLRELVTYLFFLVVLCILTYGMMSSNVYYYTRTLSQLFIDT--PVSKTEKTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSNH--TQADNRSFIFYENLLLGVPRLRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP-RNGTAWMYTSEKELNGSSHWGIIASYSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLAEFPATGGVVPSWQFQPVKLIRYVTAFDFFLAACEIIFCFFIIYYVVEEILEIRIHRLSYFRSFWNCLDVVIVVLSVVAMVINIYRMSNA-EGLLQFLEDQNSFPNFEHVAYWQIQFNNISAVMVFLVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFTIMFSIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPLYFTTFVFFMFFILLNMFLAIINDSYSEVKSDLAQQKAEMELSDLIRKGCQKALVKLKLKRNTVDAISESLRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEREHQQMRDDLEKEREDLDLEHSSLPRPMSSRSFPRSLDDSEEEDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLD 884          
BLAST of PKD2-3 vs. Ensembl Mouse
Match: Pkd2l2 (polycystic kidney disease 2-like 2 [Source:MGI Symbol;Acc:MGI:1858231])

HSP 1 Score: 280.411 bits (716), Expect = 4.022e-83
Identity = 186/523 (35.56%), Postives = 317/523 (60.61%), Query Frame = 3
Query:  408 GNKSNADIY------IMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQT-ISMSEFFKSKTAAVMERFKM 1955
            G  S  D++      + TTL EL +Y IFL+ L +++FG +N + +Y    M + F++      + +   F  + +  ++W++++   +  L+WD  + N +  +    + +Y+E  L+G+ R+RQ+R +   C++     S    CY KY++ N+D +     K NP WT+T S  + A  ++G + +Y  GGYI+ L+   ++T     DL+   WI RGTRAVF+DF ++N N+NLFC +R++AEFP  GG++TS+     KLLRY S ++YFI  CE++F IF+  + I+ + +  E K   F++ W+  +M+++L+  + +SF  Y  +     +  ++ + D+YP F  ++ +   + + I+I +F A +KIFK+I FN+TM+ LSSTL R  K+I GF++MF I+F A+AQL +L+FGS   D+S  Q S+ +QFRI+LGDF++  + +AN   G IYF+ ++FFVFFVL+NMF+AII + Y +VK D +I  +    + +  +     V+E+ ++
Sbjct:   10 GGTSKHDLHYRREAEVNTTLEELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFVDTSLP--DDERSSFRSIRSITEFWKFMEGPLIDGLYWDSWYGNKQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENEDFSDFGL-KRNPEWTHTPSSRT-APWHWGFVGVYRDGGYIVTLSKSKSETKAKFVDLRLNNWISRGTRAVFIDFSLYNANVNLFCIIRLLAEFPATGGLLTSWQFYSVKLLRYVSYYDYFIASCEVIFCIFLFVFIIQELRKVNEFKSAYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQSFLLLGQLLKNTDSYPDFYFLAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSSTLSRCMKDIVGFAIMFFIIFSAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANWILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRPDFELGKIIQKSCFNVLEKLRL 528          
BLAST of PKD2-3 vs. Ensembl Mouse
Match: Pkd2l2 (polycystic kidney disease 2-like 2 [Source:MGI Symbol;Acc:MGI:1858231])

HSP 1 Score: 280.411 bits (716), Expect = 4.022e-83
Identity = 186/523 (35.56%), Postives = 317/523 (60.61%), Query Frame = 3
Query:  408 GNKSNADIY------IMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQT-ISMSEFFKSKTAAVMERFKM 1955
            G  S  D++      + TTL EL +Y IFL+ L +++FG +N + +Y    M + F++      + +   F  + +  ++W++++   +  L+WD  + N +  +    + +Y+E  L+G+ R+RQ+R +   C++     S    CY KY++ N+D +     K NP WT+T S  + A  ++G + +Y  GGYI+ L+   ++T     DL+   WI RGTRAVF+DF ++N N+NLFC +R++AEFP  GG++TS+     KLLRY S ++YFI  CE++F IF+  + I+ + +  E K   F++ W+  +M+++L+  + +SF  Y  +     +  ++ + D+YP F  ++ +   + + I+I +F A +KIFK+I FN+TM+ LSSTL R  K+I GF++MF I+F A+AQL +L+FGS   D+S  Q S+ +QFRI+LGDF++  + +AN   G IYF+ ++FFVFFVL+NMF+AII + Y +VK D +I  +    + +  +     V+E+ ++
Sbjct:   10 GGTSKHDLHYRREAEVNTTLEELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFVDTSLP--DDERSSFRSIRSITEFWKFMEGPLIDGLYWDSWYGNKQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENEDFSDFGL-KRNPEWTHTPSSRT-APWHWGFVGVYRDGGYIVTLSKSKSETKAKFVDLRLNNWISRGTRAVFIDFSLYNANVNLFCIIRLLAEFPATGGLLTSWQFYSVKLLRYVSYYDYFIASCEVIFCIFLFVFIIQELRKVNEFKSAYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQSFLLLGQLLKNTDSYPDFYFLAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSSTLSRCMKDIVGFAIMFFIIFSAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANWILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRPDFELGKIIQKSCFNVLEKLRL 528          
BLAST of PKD2-3 vs. Ensembl Mouse
Match: Pkd1l2 (polycystic kidney disease 1 like 2 [Source:MGI Symbol;Acc:MGI:2664668])

HSP 1 Score: 144.05 bits (362), Expect = 2.405e-34
Identity = 116/457 (25.38%), Postives = 222/457 (48.58%), Query Frame = 3
Query:  504 GTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDD----------SAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAII 1844
            G  + N+++F   +E +F ++GF          P L   R ++E+ +   +K L+         P   T+GN      KLVG A +RQVR +   C +   L      C+  YS+  +D          SA    N     W Y S    +    +G ++LYGGGGY++ L +D    ++I+  L + +W+D  TRAVF++F V+N N+NLFC V +  E    G   +  T+   +L  ++  +  F++  E+ + +F+ YY +      R+ KW  F + W++ ++ ++L S   +   + R I  ++ +       D    F + +  D    + I+  + ++ +K++  +R N  M  ++S L R+  +I GF  + LI+ +A++  + L+FG     Y  +  +  +   + LG F+Y+ + + +   G++     + F+ FV++N+F+++I
Sbjct: 1962 GQRDPNAYHFHRHLERSF-SQGFS---------PVLG-FRGFFEWANTTLVKNLY------GHHPGFVTDGN-----SKLVGSAHIRQVRVRESSCAVAQQLQDSLDGCHGPYSLGIEDLVDYGEGWNASAYNNSNGFPQAWRYQSQSQRRGYPMWGKLTLYGGGGYVVPLGTDHQSASRILQYLFDNSWLDALTRAVFVEFTVYNANVNLFCTVTLTLETSGLGTFFSHVTLQSLRLYPFTDGWHPFVVAAELTYFLFLFYYMVVQGKLMRKQKWGYFCSKWNLLEVAIILASWSALVVFVKRTILADRDLQRYREHRDEGISFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITSALRRAWGDISGFVAVILIMLLAYSFASNLVFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPILGSLLIGSCIVFMTFVVLNLFISVI 2396          
BLAST of PKD2-3 vs. UniProt/SwissProt
Match: sp|Q6IVV8|PKD2_DANRE (Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 4.226e-131
Identity = 257/716 (35.89%), Postives = 418/716 (58.38%), Query Frame = 3
Query:  333 KQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSR--PETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQ-----------EELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            +++  C +   +    LW TR   + N SN ++Y+ T LRE+  Y++FL+ L +I++G ++ N +Y+   M   F++     G  +   F  LS    +W++ +   L  ++W+  W N++  PE  +   L+Y+E  L+GV R+RQ+R +   C +   L    + CY  YS  N+D AP  P K+   W +         +Y+G +S YGGGGY  DL+    K+   + +LK   W+DRGTRAVFLDF ++N N+NLFC VR++ EFP  GG V S+     +LLRY S+++YF+  CE+ F +F++YY +E  LE R  + + FK+ W+  D+++V +S+  I  NI R   V+ ++  ++ +  TYP F+ +++    F +  +I +F++ +K+FK+I FNKTM  LS+T+ R  K++ GF++MF IVF+A+AQLAYL+FG+   D+S  Q  + +QFRIILGDFD+  + EA+   G IYF  +VFF+F +L+NMF+AII + Y +VK D       + +++  K      M + K+K   I DI D++          L FDE R  ++ KG++D EIEA+F+KYD+DGDQ L  +E +QM + LE E++ +    +S    +  R  S+SQ +  E D     + ++           EE   L  R+D +E+++  I+ KID V+  +E++E  K+  + V+G+IL+
Sbjct:  120 QEHRSCGKRILEKMRVLWDTRLLGESN-SNREMYLKTVLREMITYILFLLTLCIITYGMVSTNMYYYTKVMSQLFLDTPLSSG--EPTNFKSLSTMEDFWKFTEGPFLNGMYWE-LWYNNKSLPENQS---LIYYENLLLGVPRLRQLRVRNESCSVHEDLRDEVYDCYNVYSPANEDKAPFGP-KNGTAWRFKDESSLGESSYWGQVSTYGGGGYYQDLSRTREKSANQLQELKNNLWLDRGTRAVFLDFSIYNGNVNLFCIVRLLVEFPATGGAVPSWQFQTVRLLRYVSSWDYFVGMCEVSFCLFVLYYLVEEALEIRLHRLRYFKSLWNCLDVLIVALSVPAIIMNICRTSAVSHRLHFLLENHSTYPNFEPLARLQVHFNNLAAIIVFLSWVKLFKFINFNKTMNQLSTTMSRCAKDLMGFAIMFFIVFLAYAQLAYLVFGTQVNDFSTFQACIFTQFRIILGDFDFSEIEEADSVLGPIYFTTFVFFIFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKSYNRAMVKLKLKKSSINDIPDSLQQA----AGKLSFDELRQDLRGKGHSDAEIEAIFAKYDLDGDQELTEHEHQQMRDDLEKEREDLDLEHSSLPRPASGRSFSRSQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKMKRRDVLGRILD 823          
BLAST of PKD2-3 vs. UniProt/SwissProt
Match: sp|Q4GZT3|PKD2_BOVIN (Polycystin-2 OS=Bos taurus OX=9913 GN=PKD2 PE=2 SV=1)

HSP 1 Score: 407.142 bits (1045), Expect = 2.946e-126
Identity = 247/701 (35.24%), Postives = 417/701 (59.49%), Query Frame = 3
Query:  381 LWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGN---LMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKI----SEAMNSEKDGSFKRQNSKSQINLRESDSN-------AIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            LW TR  ++ + ++ + Y+ + LREL  YL+FL++L ++++G ++++ +Y+   M   F++       ++   F  LS+   +W++ +   L  L+W      ++P   TE +    +Y+E  L+GV R+RQ+R +   C +P  L      CY+ YS+ ++D AP  P ++   W YTS +     +++G I+ Y G GY +DL+    +T   V++LK+  W+DRGTRA+F+DF V+N N+NLFC +R++ EFP  GGV+ S+   P KL+RY + F++F+  CEI+F +FI+YY +E ILE R  K   F+++W+  D+V++++S++ I  NIYR   V + +   +   +T+P F+ ++ +   F +  ++ +F   +K+FK+I FN+TM+ LS+T+ R  K++FGF++MF I+F+A+AQLAYL+FG+   D+S  Q  + +QFRIILGD ++  + EAN   G IYF  +VFF+FF+L+NMF+AII + Y +VK D       + +S+  +      + + K+K   + DI +++  G       L FDE R  +K KG+ D EIEA+F+KYD DGDQ L  +E +QM + LE E++ +    S         SF R    S+    +   +           V+ EE   L  R+D +E+++  I+ KID V+  +E +E  KL  ++V+G++L+
Sbjct:  202 LWGTRL-MEESSTDREKYLKSVLRELATYLLFLIVLCILTYGMMSSSVYYYTRIMSQLFLDT--PVSKMEKTNFKTLSSMEDFWKFTEGALLDGLYW-----KTQPSNRTEADNRSFIYYENLLLGVPRIRQLRVRNGSCSIPLDLRDEIKECYDVYSVSSEDRAPFGP-RNGTAWIYTSEKDLNGSSHWGMIATYSGAGYYLDLSRTREETAAQVANLKKNVWLDRGTRAIFIDFTVYNANINLFCVIRLLIEFPATGGVIPSWQFQPVKLIRYVTTFDFFLAACEIIFCLFILYYVVEEILEIRIHKLHYFRSFWNCLDVVIIVLSVVAIGINIYRTSNV-EALLQFLEDQNTFPNFENLAYWQTQFNNIAAVIVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALIKLKLKKNTVDDISESLRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEEDDDDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLD 888          
BLAST of PKD2-3 vs. UniProt/SwissProt
Match: sp|A2A259|PK2L1_MOUSE (Polycystic kidney disease 2-like 1 protein OS=Mus musculus OX=10090 GN=Pkd2l1 PE=1 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 6.256e-122
Identity = 242/686 (35.28%), Postives = 400/686 (58.31%), Query Frame = 3
Query:  339 NSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIE 2396
            +S C  +C  I   LW T T  +    N ++Y+ TTLREL +Y++FLV + L+++G  +++++Y+   M   F++   D G    + F  +S+   +W++     L  L+W   W N++       + +Y+E  L+G  R+RQ+R +   C +          CY+ YS   +D  P  P ++   WTY S       +++G ++ Y GGGY +DL      + + +  L+E  W+DRGTR VF+DF V+N N+NLFC +R+V EFP  GG + S+ I   KL+RY + +++FI+ CE++F +FI YY +E ILE    + +   + W+I D+VV+L+SI+ + F+I+R + VN+ +  ++   DTY  F+ ++ +   + +  ++NLF A +KIFKYI FNKTMT LSSTL R  K+I GF++MF IVF A+AQL YL+FG+   ++S     + +QFRIILGDFDY A+  AN   G +YFV YVFFVFFVL+NMF+AII + Y +VK +       + +S+F K      + R +++ +++ D+Q  +  G    +  + F+++  T+++ G+ + EI A F+++D DGD +LD  EQ+QM + LE E+      +N+E +   +         L    +    +V+ EE   L  R+  L+  ++ ++ +ID V S ++ +E
Sbjct:   67 SSCCLHICRSIRG-LWGT-TLTENTAENRELYVKTTLRELVVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDSG----VSFQTISSMSDFWDFAQGPLLDSLYWT-KWYNNQSLGRGSHSFIYYENLLLGAPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGP-QNGTAWTYHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRVVFIDFSVYNANINLFCILRLVVEFPATGGTIPSWQIRTVKLIRYVNNWDFFIVGCEVVFCVFIFYYVVEEILEIHLHRLRYLSSVWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPDTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDQLQLSDFLKQSYNKTLLRLRLRKERVSDVQKVLKGG----EPEIQFEDFTSTLRELGHEEHEITAAFTRFDQDGDHILDEEEQEQMRQGLEEERV----TLNAEIENLGRSVGHSPPGELGAEAARGQSWVSGEEFDMLTRRVLQLQCVLEGVVSQIDAVGSKLKMLE 736          
BLAST of PKD2-3 vs. UniProt/SwissProt
Match: sp|Q13563|PKD2_HUMAN (Polycystin-2 OS=Homo sapiens OX=9606 GN=PKD2 PE=1 SV=3)

HSP 1 Score: 392.119 bits (1006), Expect = 1.074e-120
Identity = 252/704 (35.80%), Postives = 414/704 (58.81%), Query Frame = 3
Query:  381 LWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGN---LMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKK-------KISEAMNSEKDGSFKRQNSKSQINLRESDSN-------AIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            LW TR  ++ + +N + Y+ + LREL  YL+FL++L ++++G +++N +Y+   M   F++        +   F  LS+   +W++ +   L  L+W       +P   TE +    +++E  L+GV R+RQ+R +   C +P  L      CY+ YS+ ++D AP  P ++   W YTS +     +++G I+ Y G GY +DL+    +T   V+ LK+  W+DRGTRA F+DF V+N N+NLFC VR++ EFP  GGV+ S+   P KL+RY + F++F+  CEI+F  FI YY +E ILE R  K   F+++W+  D+V+V++S++ I  NIYR   V + +   +   +T+P F+ ++ +   F +  ++ +F   +K+FK+I FN+TM+ LS+T+ R  K++FGF++MF I+F+A+AQLAYL+FG+   D+S  Q  + +QFRIILGD ++  + EAN   G IYF  +VFF+FF+L+NMF+AII + Y +VK D       + +S+  +      + + K+K   + DI +++  G       L FDE R  +K KG+ D EIEA+F+KYD DGDQ L  +E +QM + LE E++        +   M+S    SF R    S+ +  E   +           V+ EE   L  R+D +E+++  I+ KID V+  +E +E  KL  ++V+G++L+
Sbjct:  200 LWGTRL-MEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDT--PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYW-----KMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP-RNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNV-EVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSR---SFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLD 886          
BLAST of PKD2-3 vs. UniProt/SwissProt
Match: sp|O35245|PKD2_MOUSE (Polycystin-2 OS=Mus musculus OX=10090 GN=Pkd2 PE=1 SV=2)

HSP 1 Score: 389.808 bits (1000), Expect = 8.717e-120
Identity = 246/698 (35.24%), Postives = 410/698 (58.74%), Query Frame = 3
Query:  381 LWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEY-----------VTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            LW TR   + N +N + Y+ + LREL  YL FLV+L ++++G +++N +Y+   +   FI+        +   F  LS+   +W++ +   L  L+W     N     +   + +++E  L+GV R+RQ+R +   C +P  L      CY+ YS+ ++D AP  P ++   W YTS +     +++G I+ Y G GY +DL+    +T   ++ L+   W+DRGTRA F+DF V+N N+NLFC VR++AEFP  GGVV S+   P KL+RY +AF++F+  CEI+F  FIIYY +E ILE R  +   F+++W+  D+V+V++S++ +  NIYR+    + +   +   +++P F+ ++ +   F +  ++ +F+  +K+FK+I FN+TM+ LS+T+ R  K++FGF++MF I+F+A+AQLAYL+FG+   D+S  Q  + +QFRIILGD ++  + EAN   G +YF  +VFF+FF+L+NMF+AII ++Y +VK D       + +S+  +      + + K+K   +  I +++  G       L FDE R  +K KG+ D EIEA+F+KYD DGDQ L   E +QM + LE E++ +    +S       R   +S  +  E D     +           V+ EE   L  R+D +E+++  I+ KID V+  +E +E  KL  ++V+G++L+
Sbjct:  198 LWGTRLMEESN-ANREKYLKSVLRELVTYLFFLVVLCILTYGMMSSNVYYYTRTLSQLFIDT--PVSKTEKTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSNH--TQADNRSFIFYENLLLGVPRLRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP-RNGTAWMYTSEKELNGSSHWGIIASYSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLAEFPATGGVVPSWQFQPVKLIRYVTAFDFFLAACEIIFCFFIIYYVVEEILEIRIHRLSYFRSFWNCLDVVIVVLSVVAMVINIYRMSNA-EGLLQFLEDQNSFPNFEHVAYWQIQFNNISAVMVFLVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFTIMFSIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPLYFTTFVFFMFFILLNMFLAIINDSYSEVKSDLAQQKAEMELSDLIRKGCQKALVKLKLKRNTVDAISESLRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEREHQQMRDDLEKEREDLDLEHSSLPRPMSSRSFPRSLDDSEEEDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLD 884          
BLAST of PKD2-3 vs. TrEMBL
Match: A0A0H3YJQ9 (PKD2-3 OS=Schmidtea mediterranea OX=79327 GN=PKD2-3 PE=2 SV=1)

HSP 1 Score: 1445.64 bits (3741), Expect = 0.000e+0
Identity = 754/754 (100.00%), Postives = 754/754 (100.00%), Query Frame = 3
Query:  207 MSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST 2468
            MSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLRELFIYLIFLVLLLLISFGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNYYGSISLYGGGGYIIDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIYFVLYVFFVFFVLINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST
Sbjct:    1 MSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLRELFIYLIFLVLLLLISFGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNYYGSISLYGGGGYIIDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIYFVLYVFFVFFVLINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST 754          
BLAST of PKD2-3 vs. TrEMBL
Match: V3Z0D8 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_229509 PE=4 SV=1)

HSP 1 Score: 482.256 bits (1240), Expect = 7.742e-154
Identity = 287/741 (38.73%), Postives = 448/741 (60.46%), Query Frame = 3
Query:  306 SNDKINFDEKQNSKCSQMCEKITN---YLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSN---PGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSE-----KDGSFKRQNSKSQINLRES-----------------DSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILET 2444
             ND     +    +    C KI      LW TR   +  K N ++Y+ TTLREL IY +FL++L +I+FG  +   +Y+   M + F+    D  N K   F  ++N   +W Y     LK L+W+ +W N++     +   +Y+E KL+GV R+RQ++     C + +        C++ Y+  N+D+    P  S+     W Y +    +  +++G ++ Y G GYI DL  + +++++I+ +L    W+ RGTRA+F+DF V+N N+N FC VR++ EFP  GG + S+T    KL+RY SAF++FI+ CE +FV+FI YY +E  LE ++ + Q FK +W+I D++V+L++++C+ F+IYR + V +++ +++ + + Y  F+++S ++  F + I+I +F+A +KIFKYI FNKTMT LSSTLGR  K++ GF+VMF I+F+AF QL YL+FG+   D+S  Q S  + FRIILGDFD++ L  AN   G I+F+L+VFFVFFVLINMF+AII + Y +VK D         M+++FK   + V+++  +K  KIVDIQ A+   D+NND  + FDEWR  +K +GYAD EIEA+F+KYD+DGD+VLD  EQK+M   L  EK  I++A  +E     + G+  R +S+   N                      SN + Y   EE   L+ R+D +E+++  I+ KID VL  +E++E  KL  ++ +GKIL++
Sbjct:   44 GNDSRALQKSSKPQSRGCCYKILGGIRSLWATR-HTEETKENRELYVKTTLRELIIYFVFLIILCVITFGMTSTTMYYYTKVMSDLFL----DTPNSKAGTFRTVTNVDDFWRYTKEPLLKGLYWE-TWYNNQSVPEEQQGYIYYENKLLGVPRIRQLKVHSNSCVVHNDFKGVIQECFDSYAEGNEDTKTFGPEGSDTNGSAWNYQTETELEGSSHWGLLTTYSGAGYIQDLALNMSESSKIIDNLFNNLWVTRGTRAIFIDFTVYNANINFFCVVRLLIEFPATGGAIPSWTFRTVKLIRYVSAFDFFIMACEFIFVLFIFYYIVEEALEIKKHRLQYFKGFWNILDILVILLALVCMVFDIYRTLVVGEKLESLLSNKEQYADFERLSYWETRFSNTIAILVFMAWIKIFKYISFNKTMTQLSSTLGRCAKDLAGFAVMFFIIFLAFTQLGYLLFGTQVKDFSSFQNSFFTLFRIILGDFDFQQLEAANRILGPIFFMLFVFFVFFVLINMFLAIINDTYSEVKGDMANMKNEFEMADYFKKGYSRVLDKLNLKRDKIVDIQKALKTADINNDKQVDFDEWRQDLKTRGYADGEIEAMFAKYDIDGDRVLDEEEQKRMQADLANEKSAINKAYYNELGKTPRSGTAGRSSSRISFNDDSGDDSDDEDSGTKSSRTGRTSNGVSY---EEFTVLSRRVDRMEHSIGSIVSKIDAVLVKLEAMEKAKLKRRETMGKILDS 775          
BLAST of PKD2-3 vs. TrEMBL
Match: A0A3S1A8W4 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_006585 PE=4 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 1.468e-150
Identity = 277/714 (38.80%), Postives = 434/714 (60.78%), Query Frame = 3
Query:  360 CEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRP---NKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDG-SFKRQNSKSQI---------------NLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILET 2444
            C +    LW TR + +   SN ++Y+ TTLREL IY++FLV+L +I+FG  +   +Y+   M + F++   D G      F  L++   +W Y     +  L+W+  W N +  +  +   +Y+E KL+GV R+RQ+R     C++     +    CY+ Y+   +D+ P        +N  W Y S       +++G ++ Y G G   DL S    + + +  L ++ W+ RGTRAVF+DF V+N N+NLFC +R++ EFP  GG + S+T    KL+RY +  +YF+L CEI+F IF++YY +E +LE +++K   FK +W+I D++V+++S +C+ FNIYR I V+ +++ ++     Y  F+++S ++  F + I+I +F+A +KIFKYI FNKTMT LSSTLGR  K++ GF VMF+I+F+AF QL YL+FG+   D+S  + +  + FRIILGDFD+  L +AN   G I+F+L+VFFVFFVLINMF+AII + Y +VK D         ++++FK   + ++++   K  KIVDIQ A+ + D+N D  + FDEWR  +K +GYADCEIEAVF++YDVDGD+VLD  EQK+M   L+ +K     A+N E D    K ++S S++                 +     A   V+ EE   L+ R+D +E+++  I+ KID VL  +E++E  KL  ++ +GKIL++
Sbjct:   73 CLRGVRSLWATR-QTEETTSNRELYVKTTLRELIIYIVFLVVLCIITFGMTSTTMYYYTKVMSDLFLDSTNDKGG----TFRTLTSVEDFWRYTKGPLVNGLYWE-KWYNDQNMSKPDMGYIYYENKLLGVPRIRQLRVHSNSCKVHEDFENFISECYDSYAESIEDTKPFGEYLNEPANTAWFYYSESDLGGSSHWGELNTYSGAGSYKDLNSTKAASLETIDHLFDKLWVTRGTRAVFIDFSVYNANINLFCVIRLLVEFPATGGAIPSWTFRTVKLIRYVTVMDYFVLACEIIFCIFLLYYTVEEVLEIKKLKLSYFKGFWNILDILVIIISFVCVGFNIYRTIEVDNKLTKLLEDPTVYADFERLSYWETRFSNAIAIAVFMAWIKIFKYISFNKTMTQLSSTLGRCAKDLAGFFVMFIIIFLAFTQLGYLLFGTQVKDFSSFENAFFTLFRIILGDFDFHQLEQANRILGPIFFMLFVFFVFFVLINMFLAIINDTYSEVKSDMANAKNEFEIADYFKKGYSKMLDKLNFKRDKIVDIQSALKSADINQDQRVDFDEWRQDLKSRGYADCEIEAVFARYDVDGDRVLDAEEQKKMFADLQEQKL----ALNKEYDDIGGKGRHSSSRLSSNGDSGDDSDDDENGTKSRSGRAANGVSYEEFTVLSRRVDRMEHSIGSIVSKIDAVLVKLEAMEKAKLKRRETMGKILDS 776          
BLAST of PKD2-3 vs. TrEMBL
Match: A0A267FRH5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005060g3 PE=4 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 1.524e-150
Identity = 278/722 (38.50%), Postives = 441/722 (61.08%), Query Frame = 3
Query:  348 CSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRP-ETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDS---------------------NAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETF 2447
            C + C+     +W TR   D  K + ++YI TTLREL IY IF+++L++I+FG  ++  +Y+   + + F++   +  N  +  +  + N   +W +++   +  L+WD +W NS       E N +Y+E KL+GV R+RQ+R     C + SY   +   CY KYS    D +      S   W Y S +     ++   IS Y GGG+ ++L+ D   T  I+ +L  + W++RGTRAVF+DF ++N N+NLFC +R+V EF   GG + ++ +   KLLRY    +YFIL CE +F++FI+YY +E  LE ++ KW+ F+ +W+  D++V+++S +C +FN+YR + V Q+++T++  ++ +P FD +S + + F H I+I +F A +KIFKYI FNKTMT LSSTLG   K++ GF++MF IVF AFAQL YL+FG+   D+   Q SV + FRIILGDFD+ +L  AN   G I+F+LYVFFVFFVLINMF+AII + Y +VK D ++      M+++FK + + ++ +  ++  KIVDIQ AI + DLNND  L F+EWR  +KQ+GYAD EIEA+F+K+D+DGD+VL+  EQ+QMH +LE +++ + + +NS++  + + +         + D+                        + V+  E   L  R+D +E ++  I+QKID VL  +E +E  KL  ++ + ++L+  
Sbjct:  107 CLKSCKHGLQSIWRTRDTQD-TKEDRELYIKTTLRELIIYCIFIIVLMIITFGMTSSTMYYYTKVLSDLFLDTKIE--NTTN-NYRSVGNMGDWWSFVNGPLMNGLYWD-TWYNSANFSDPREKNFIYYENKLLGVPRLRQLRVSNQSCNIASYFQGKISTCYAKYSYGVTDKSSFGLGNST-AWQYRSEEQLDGRSHNAEISSYDGGGFAVELSRDKATTQAILKELYSKLWVNRGTRAVFIDFTLYNANINLFCVIRLVTEFMATGGCLPTWDLRTVKLLRYVEPMDYFILACECVFMLFILYYIVEEALEIKKHKWRYFRCFWNCLDILVIVISTVCAAFNVYRTVAVGQKLTTLLQDENNFPDFDFLSYWQQQFNHGIAITVFFAWVKIFKYISFNKTMTQLSSTLGACAKDLMGFAIMFFIVFFAFAQLGYLIFGTQVKDFREFQQSVFTLFRIILGDFDFNSLQTANRVLGPIFFILYVFFVFFVLINMFLAIINDTYSQVKSDLSMQQNEFEMTDYFKQRASRMLSKLNLRRDKIVDIQKAIQSADLNNDKQLDFEEWRAELKQRGYADGEIEALFAKFDLDGDRVLNEEEQRQMHLELEGQRENLDQMINSKQAANEELEPDDEDEMEADGDALPAAATAASTRTSGGGGRGRGGGRKLVSPAEFQVLVKRVDRVEMSIGDIVQKIDSVLLKLELMERAKLRRREAMTRVLDAL 822          
BLAST of PKD2-3 vs. TrEMBL
Match: A0A1I8GHK9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 1.979e-150
Identity = 278/722 (38.50%), Postives = 441/722 (61.08%), Query Frame = 3
Query:  348 CSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRP-ETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDS---------------------NAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETF 2447
            C + C+     +W TR   D  K + ++YI TTLREL IY IF+++L++I+FG  ++  +Y+   + + F++   +  N  +  +  + N   +W +++   +  L+WD +W NS       E N +Y+E KL+GV R+RQ+R     C + SY   +   CY KYS    D +      S   W Y S +     ++   IS Y GGG+ ++L+ D   T  I+ +L  + W++RGTRAVF+DF ++N N+NLFC +R+V EF   GG + ++ +   KLLRY    +YFIL CE +F++FI+YY +E  LE ++ KW+ F+ +W+  D++V+++S +C +FN+YR + V Q+++T++  ++ +P FD +S + + F H I+I +F A +KIFKYI FNKTMT LSSTLG   K++ GF++MF IVF AFAQL YL+FG+   D+   Q SV + FRIILGDFD+ +L  AN   G I+F+LYVFFVFFVLINMF+AII + Y +VK D ++      M+++FK + + ++ +  ++  KIVDIQ AI + DLNND  L F+EWR  +KQ+GYAD EIEA+F+K+D+DGD+VL+  EQ+QMH +LE +++ + + +NS++  + + +         + D+                        + V+  E   L  R+D +E ++  I+QKID VL  +E +E  KL  ++ + ++L+  
Sbjct:  121 CLKSCKHGLQSIWRTRDTQD-TKEDRELYIKTTLRELIIYCIFIIVLMIITFGMTSSTMYYYTKVLSDLFLDTKIE--NTTN-NYRSVGNMGDWWSFVNGPLMNGLYWD-TWYNSANFSDPREKNFIYYENKLLGVPRLRQLRVSNQSCNIASYFQGKISTCYAKYSYGVTDKSSFGLGNST-AWQYRSEEQLDGRSHNAEISSYDGGGFAVELSRDKATTQAILKELYSKLWVNRGTRAVFIDFTLYNANINLFCVIRLVTEFMATGGCLPTWDLRTVKLLRYVEPMDYFILACECVFMLFILYYIVEEALEIKKHKWRYFRCFWNCLDILVIVISTVCAAFNVYRTVAVGQKLTTLLQDENNFPDFDFLSYWQQQFNHGIAITVFFAWVKIFKYISFNKTMTQLSSTLGACAKDLMGFAIMFFIVFFAFAQLGYLIFGTQVKDFREFQQSVFTLFRIILGDFDFNSLQTANRVLGPIFFILYVFFVFFVLINMFLAIINDTYSQVKSDLSMQQNEFEMTDYFKQRASRMLSKLNLRRDKIVDIQKAIQSADLNNDKQLDFEEWRAELKQRGYADGEIEALFAKFDLDGDRVLNEEEQRQMHLELEGQRENLDQMINSKQAANEELEPDDEDEMEADGDALPAAATAASTRTSGGGGRGRGGGRKLVSPAEFQVLVKRVDRVEMSIGDIVQKIDSVLLKLELMERAKLRRREAMTRVLDAL 836          
BLAST of PKD2-3 vs. Ensembl Cavefish
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:103043751])

HSP 1 Score: 418.313 bits (1074), Expect = 3.447e-132
Identity = 253/702 (36.04%), Postives = 416/702 (59.26%), Query Frame = 3
Query:  381 LWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSR--PETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAIN--NGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQ-----------EELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            LW TR  ++ ++S+ ++Y+   LRE   Y+ FL+ L +I++G ++ N +++   M   F++     G+     F  LS    +W+Y +   L  ++WD  W N++  PE  +   L+Y+E  L+GV R+RQV+     C +   L    + CY  YS  ++D AP    K+N  W Y+   +    +Y+G ++ Y GGGY  DL     ++ + + +LK+  W+DRGTRAVFLDF V+N N+NLFC VR++ EFP  GG VTS+     +L+RY S+++YF+  CE++F +F++YY +E +LE R  + + FK+ W+  D+++V +S   I  NIYR   V+ ++  ++ +  TYP F  +++    F H  ++ +F+A +K+FK+I FNKTM+ LS+T+ R  K++ GF++MF IVF+A+AQLAYL+FG+   D+S  Q  + +QFRIILGDFD+  + E N   G IYF  +VFF+F +L+NMF+AII + Y +VK D       + +++  K      M + +++   + DI D++    G LN      FDE R  ++ KG++D EIEA+F+KYD+DGDQ L  +E +QM + LE E++ +    +S       R  S+SQ +  E D     + ++           EE   L  R+D +E+++  I+ KID V+  +E++E  KL  ++V+G++L+
Sbjct:  139 LWGTRL-MEDSESSREVYLKNVLRETVTYIFFLITLCIITYGMVSTNMYFYTKVMSQLFLDTPLSKGD--PTTFKTLSTMEDFWKYTEGPFLNGMYWD-VWYNNKSLPENQS---LIYYENLLLGVPRLRQVKVLNKSCPVHEDLKDEVYDCYSIYSPASEDKAPFG-LKNNTAWVYSEENILGESSYWGEVATYRGGGYYQDLARSREESARQLKELKDNLWLDRGTRAVFLDFSVYNGNVNLFCIVRMLVEFPATGGAVTSWQFQTVRLVRYVSSWDYFVGTCEVVFCLFVLYYMVEEVLEIRLHRLRYFKSLWNCLDVIIVTLSAPAIIMNIYRTSAVSNRLRYLLENHSTYPNFQPLAQVQVQFNHLAAVIVFLAWVKLFKFINFNKTMSQLSTTMSRCAKDLLGFAIMFFIVFLAYAQLAYLVFGNQLNDFSTFQACIFTQFRIILGDFDFSEIEETNRVLGPIYFTTFVFFMFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKGYQKAMVKLRLRKTTVDDISDSLRQAGGKLN------FDELRQDLRGKGHSDAEIEAIFAKYDLDGDQELSEHEHQQMKDDLEKEREDLDLERSSLPRPMSGRSFSRSQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLD 826          
BLAST of PKD2-3 vs. Ensembl Cavefish
Match: pkd2l1 (polycystic kidney disease 2-like 1 protein [Source:NCBI gene;Acc:103031316])

HSP 1 Score: 389.037 bits (998), Expect = 6.210e-122
Identity = 254/711 (35.72%), Postives = 407/711 (57.24%), Query Frame = 3
Query:  324 FDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYS-IFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISE-----AMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKIL 2438
            + EK++S C     +    LW T    D  + N ++++ TTLREL +Y++FLV + L+++G  ++ ++Y+   M + F+N   D G    + F  +     +W Y     L  L+W  SW N++   +   + +Y+E  L+GV R+RQ++ K   C++          C++ Y+    DDS+    N +   W Y + +  +  N++G ++ Y GGGY  DL     ++  ++++L    W+D GTRAVF+DF  +N N+NLFC +R+V EFP  GG + S+ I   KL+RY + ++YFI+ CEI+F +FI+YY +E ILE R  K   FK+ W+I D+V+++++I+ I FN++R I V++ +  ++     Y  F+ ++ +   + +  ++NLF A +KIFKYI FNKTMT LSSTL R   +I GF++MF IVF A+AQL YL+FG+    +S     + +QFRIILGDFDY  +  AN   G IYF  YVFFVFFVL+NMF+AII + Y +VK +       + +++  K   +    + K+K +KI D+Q  + +G       L F ++R T+K+ G+AD EI A FSK+D DG+Q+LD  EQ+ M ++LE ++  +S       +N EK+G     N K+   L          VT ++   L  ++  LE ++   + KID V+  +   +  K N +   GK L
Sbjct:   80 YHEKKSSGCCSFLLRGIKGLWGTTLTKDTTE-NRELFVRTTLRELVVYIVFLVDMCLLTYGMTSSTTYYYTKVMTDLFVNAPSDSG----VTFQSIGTMDDFWSYAQGPLLDGLYWT-SWYNNQSLQTGTHSFIYYENMLLGVPRVRQLKVKNKSCKVHKDFEEEISDCFDVYNEKKEDDSSFGLINGT--AWQYHTEKELKGSNHWGMLATYSGGGYYQDLALTKEESAGVLANLNNNLWLDHGTRAVFIDFSTYNANINLFCVIRLVVEFPATGGAIPSYQIRTVKLIRYITTWDYFIIGCEIVFCVFILYYIVEEILELRIHKLSYFKSIWNILDVVIIMLAIVAIVFNVFRTIKVDKLLGNLLKEPSIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCATDILGFAIMFFIVFFAYAQLGYLLFGTEVESFSTFHKCIFTQFRIILGDFDYDGIERANRVLGPIYFFTYVFFVFFVLLNMFLAIINDTYSEVKEELASQKDDLQITDLIKQSYSKTFMKLKLKKEKISDVQKVLRSG----SKELEFKDFRETLKEMGHADHEISAAFSKFDYDGNQILDKEEQETMKQELEEKRDALSVELHNLGINYEKNGKETDDNEKTNSVL----------VTAQQFQMLVKQVVELECSLATTMAKIDVVMEKLGLQDAGKTNKKDATGKHL 768          
BLAST of PKD2-3 vs. Ensembl Cavefish
Match: pkd1l2a (polycystin 1 like 2 [Source:NCBI gene;Acc:103044173])

HSP 1 Score: 149.443 bits (376), Expect = 3.642e-36
Identity = 117/458 (25.55%), Postives = 223/458 (48.69%), Query Frame = 3
Query:  504 GTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPN----------KSNP-GWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAII 1844
            G  + N+FY    ++ +F N              D     + +++ ++  L  LF        +P   T+GN      KLVG AR+RQVR +   C++   + +    C+  YS   +D     P           K+ P  W Y +    +A   +G +++Y GGG+++DL  +    +  +  L E TW+D  TRA+F++F V+N N+NLFC V ++ E    G       +   +L + +     F++  E+++ +FI YY  +     ++ KW+ F++ W++ DM ++++S   +   I R +  NQ I       D Y  F++ +  D +  + I+  + +A +K++  +R N  +  ++STL R+  +I GF V+  I+F+A++    L++G     Y  +  +  +   + LG F+Y+ + + N   GA      + F+ FV++N+F+++I
Sbjct: 2109 GQRDPNAFYLTQHIQQSFSN-----------GISDSMTHGEVFQWANSTLLNNLF------GQQPGFITDGN-----SKLVGNARLRQVRVQDGSCRVDRSMRNSVPDCHAPYSWDMEDLGSYGPGWNPSIDANLSKTLPTPWQYQTQSRLRAHPIWGGVAVYRGGGFVVDLGPNRENASSSLQYLFENTWLDMFTRAIFVEFTVYNANVNLFCIVTLMFETTAVGAFQYRSELQSVRLYQSTGGLHIFVMASEVVYFLFIFYYMFQQGKLMKQQKWEYFRSKWNLLDMAIIILSWSALPVFIKRTLLGNQSIEYYQNHKDEYAGFNETATADAVLGYIIAFLVLLATVKLWHLLRLNPKLHMITSTLQRAWNDISGFIVVMTIMFLAYSVACNLLYGWKLYSYRTLLNAAQTIVSLQLGIFNYEEVLDYNPVLGAFIVGSCIIFMTFVVLNLFISVI 2544          
BLAST of PKD2-3 vs. Ensembl Cavefish
Match: ENSAMXT00000006495.2 (pep primary_assembly:Astyanax_mexicanus-2.0:5:35007331:35041448:1 gene:ENSAMXG00000006274.2 transcript:ENSAMXT00000006495.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.198 bits (352), Expect = 2.129e-33
Identity = 106/407 (26.04%), Postives = 205/407 (50.37%), Query Frame = 3
Query:  681 WVNSRPETSTEGNLMYF----EIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSN-----------PGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENY 1856
            W NS   T+  G    F      KLVG AR+RQVR +   C+  S + S    C+  YS   +D     P  ++             W Y +    +A   +G ++LY GGG+++DL  D   ++ ++  L E  W+D  TRA+F++F V+N N+NLFC V ++ E    G       +   +L + +       L  E ++ +FI+YY        ++ KW+ F+N W+I ++ ++L+S    S  I +++  +Q +       + +P F + +  D +  +  ++ + +A +K++  +R N  +  +++TL ++  +I  F V+ +I+F+A++ ++ L+FG     Y  +  +  +   + LG F+Y+ + + N   GA      + F+ FV++N+F+++I E +
Sbjct: 1261 WANSSLLTNLFGQYSGFITDGNSKLVGTARLRQVRVQKSSCRKASSVRSSVPDCHAPYSWEVEDMGSYGPGWTSLIDSNMSKALFTPWQYQTQSRLRAHTVWGGMALYRGGGFVVDLEPDQQNSSSVLQYLFENAWLDIYTRALFIEFTVYNANVNLFCIVTLMLETTAVGAFQYRTELQNIRLFQTTDGIP--TLVSEAIYFLFILYYMFLQAKLMKQQKWEYFRNKWNILELAIILLSWSAFSVFIKKMVQGDQDLKYYQDHRNQFPSFYETAAADSVLGYLTAVLVLLATIKMWHLMRLNSKLNMITNTLQQAWSDISSFIVVIVIMFLAYSIVSNLLFGWKLYTYKTLIDAATAMVSLQLGIFNYEEILDLNPVLGAFIIGSCIIFMTFVVLNLFISVILEAF 1665          
BLAST of PKD2-3 vs. Ensembl Cavefish
Match: pkd1a (polycystic kidney disease 1a [Source:ZFIN;Acc:ZDB-GENE-100707-1])

HSP 1 Score: 52.7582 bits (125), Expect = 2.329e-6
Identity = 48/243 (19.75%), Postives = 115/243 (47.33%), Query Frame = 3
Query:  981 DLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAI-EVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVL 1706
            +L+     +  ++  L    W    TRA+F++F ++N N +L     ++ EFP      +S  +    L       +  +    +L +IFIIY+++ E +   R+ +   F   W++  M  +L++ +  + ++ R     +  ++ +   +++  F  +++ +++     +  LF+ +LK    +RF +       TL RS  E+   ++  L++ +A++ + +L+F S    Y+ + ++ L
Sbjct: 3732 ELSRRMEDSRSLIQQLLSHQW----TRALFVEFSLYNTNTDLLAVFTLLLEFPVSERAQSSLDLKTCSLHTLHHGLDLSLFL-TLLLMIFIIYFSVREGVAAHRQGR-SYFLRVWNLAGMCTLLLAAVVSALHLSRSALATRLWASFLQQRESFTDFFPLAQQNQVLTQLNATLLFLLVLKASHQLRFLREWAVFGRTLRRSVWELLAAALALLVLLLAYSHMGHLLFHSVLEGYATVSSACL 3968          
BLAST of PKD2-3 vs. Ensembl Sea Lamprey
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 382.489 bits (981), Expect = 5.853e-122
Identity = 245/683 (35.87%), Postives = 391/683 (57.25%), Query Frame = 3
Query:  354 QMCEKITNYLWTTR-TKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNF--PCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEK--DGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSME 2387
            Q C       W TR T+++  +     Y  TTLREL IY++FL+ L L++FG +N N++Y+   M + F+        +    F  +S+   +W+ +    L  L+W+  W N   +     + + +E  ++GV R+RQ++ +   C +  Y L RN    CY+ YS   +D        +   W Y S +     +++G ++ Y G GY  DL+   N++  ++ +LK+  W+D GTRAVF+DF  +N N+NLFC VR+V EFP  GG + S+     KL+RY SAF+YFI+ CE++F  FI+YY +E  LE R    + FK+ W+  D++V+++S++ I FNI R I V+  +  ++   + Y  F+ ++ +   F + ++IN+F A +KIFKY+ FNKT+T LSSTL R  K++ GF+VMF I+F A+AQ  YL+FGS   D+S     + +QFRIILGDFD+ A+  AN   G IYF  Y+FFVFFVL+NMF+AII + Y  VK +         + +FFK     ++ + KMK   I D+Q A+++       +L +D WR  + + G++D EI A FSK+D D D VLD  EQKQ+  +LE +K K++E + + K  D S K  ++                VT+++      R+  +E+++  ++ K++ +L+ +E
Sbjct:    2 QHCRVCCPGFWGTRLTEVNSTREQ---YFKTTLRELIIYVVFLIDLCLLTFGMMNTNTYYYTKVMMDLFVES--PVSPIDGTNFNSISSMDDFWKVVQGPVLDGLYWE-KWYNG-DQLPVNLSFIQYENVMLGVPRVRQLKVRNGSCTI--YPLFRNIIPGCYDGYSCGEEDKETF-GRGTGTAWKYWSEEELSGSSHWGLLAQYSGAGYYRDLSRRKNESAPMLQELKDYLWLDHGTRAVFIDFTTYNGNINLFCVVRLVVEFPLTGGALPSYQFRTVKLIRYVSAFDYFIMACEVIFCCFILYYVVEECLELRLHGMKYFKSVWNCLDIIVIVLSMVAIIFNICRTIAVSNLLGALLNDPNIYADFEYLAFWQTQFNNMLAINVFFAWIKIFKYVSFNKTLTQLSSTLARCAKDVLGFAVMFFIIFFAYAQTGYLVFGSQVEDFSSFVNCIFTQFRIILGDFDFHAIENANRILGPIYFTTYIFFVFFVLLNMFLAIINDTYTDVKAELADTKDDFEIGDFFKQGYKNMLNKLKMKKDDIADMQRALDSA----GKHLEYDIWRKNLIRLGHSDEEIAAAFSKFDKDSDNVLDEDEQKQLRAELEGQKDKLNEDIEALKTMDNSGKPGDASR--------------VTKDDFNRFASRVAKMESSMDSLMSKVESLLTKLE 656          
BLAST of PKD2-3 vs. Ensembl Sea Lamprey
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 348.591 bits (893), Expect = 7.301e-108
Identity = 241/718 (33.57%), Postives = 394/718 (54.87%), Query Frame = 3
Query:  327 DEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFI------NEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXI--NMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKR----------------QNSKSQINLRESDSNAIEYVTQEELLF-----LNIRMDGLENNVQLILQKIDQVLSSMESI 2393
            +E Q+    +  + +   LW TR   D   ++ D Y+ TTLRELF+Y+ FL+ L++++FG  +   + +  AM+N F+      N+  +F ++    F D      +W+ +    L  L+W+  W N  P    + + +Y+E  L+GV R+RQ++ +   C + +        CY  YS   +D A   P    P W Y++S      +++G ++ Y GGGY +DLT   +++  ++ DL ++ W+DRGTRA+ +DF  +N N+NLF  +R++ EFP  GG V S  I   KL+RY +  +YFIL CE +F  FI+YY +E ILE    K+  FK+ W+  D++V+++S++ I FN+YR + VN+ +  ++   + Y  F  ++ +   + + +++N+F   +K FKY+ FNKTMT LSSTL R  K++ GF+VMF I+F A+AQL YL+FG+   D+S     + +QFRIILGDFD+ A+  AN   G +YF  YVF VFFVL+  NMF+AII + Y +VK++         +  +FK     + ++       IVD+   ++     +   + +D+WRL +K+ G++D EIEA F+K+D D + VLD  E K M ++L+++K          KDGS  R                  S   IN    + N   Y      L+     L   +D LE ++  +  K+D +++ + S+
Sbjct:   79 EEDQSGGPKKSRKSVLRGLWGTRLTED--ITDRDKYVKTTLRELFVYIAFLINLIILTFGMTSDLMYKYTLAMDNLFLQNTVSPNDSVNFNSI--FTFDD------FWKVVQGPVLNGLYWE-KWYNDIPLVENQ-SFIYYENFLLGVPRIRQLKVRNDSCTVHADFQKDVQGCYAAYSEDAEDKASFGPATGTP-WKYSTSSDMNGSSHWGLLATYSGGGYYLDLTRSKSESAILLQDLFDKQWLDRGTRAILIDFSSYNGNINLFSVIRLLVEFPPTGGAVPSSQIYTVKLIRYVTGSDYFILACEGIFCCFILYYIVEEILELSIHKFAYFKSVWNCLDLLVIMLSVVAIIFNVYRTVTVNKLLKALLDEPNRYGNFQFLAFWQTQYNNMVAVNVFFCWIKFFKYVSFNKTMTQLSSTLARCAKDVLGFAVMFFIIFFAYAQLGYLLFGTQVEDFSTFSNCIFTQFRIILGDFDFNAIENANRVLGPLYFTTYVFVVFFVLLPKNMFLAIINDTYAEVKNELAEKENEFDVGGYFKKVYLDIRKKLGKNRGNIVDMISVLD----ASSQKINYDDWRLKLKRLGHSDEEIEAAFAKFDKDKNSVLDSNEMKLMRDELKSQK----------KDGSMDRVLSPCVLLNYVIFRNLDCSAKCINNLSGEINHRRYADDISTLYNVYKRLVQNVDNLEQSISTMFSKVDVIMNKVGSL 769          
BLAST of PKD2-3 vs. Ensembl Sea Lamprey
Match: pkd2 (polycystic kidney disease 2 [Source:NCBI gene;Acc:432387])

HSP 1 Score: 226.098 bits (575), Expect = 2.498e-63
Identity = 162/562 (28.83%), Postives = 287/562 (51.07%), Query Frame = 3
Query:  828 CYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTN-QIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIF-KNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISIN---LFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAI-NNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQIN-----------------LRESDSN--AIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKIL 2438
            CY  YS  N++  P  P  S   W + S        + G++  YG GGY + L +DS     Q ++ L++ +W+DR TR + +D  + N N+ L+  VR+  EFP  GG++T+ ++TP + L   +        C +L  +  IYY +E +LE R +    F  + W+  D+ ++ + ++  +F ++  I  +  +     S      F  +S      Q+FI +    +F+A +K+ ++    +T+T     L R   ++ G++++F  VF+AFAQLA+L+FG    D+S   + +L+Q RI+LGDFD+ +L  A+   G IYFV YVF V  +++ MF+AI+ E Y + K ++  +     +S   K     V++R   K  ++  IQ  +  +G +N      F  WR  +K +G+AD EIEAVF++Y  DGD  L   EQ QM   L  EK+ I   ++       K+    S+ +                 +R  + +      V++EE   L  R++ +E+++  ++ K+D V+  +E++E Q+L  + V+ +++
Sbjct:  146 CYGPYSSANENKDPFGPANSTV-WRFDSEA---GVPWQGALGWYGPGGYAVRLPADSRTAAWQELAALRDASWLDRATRLLSVDAALLNPNLRLYMVVRLSMEFPPTGGILTALSLTPGRPL--GTPLWDARAVCGLLAALLTIYYLVEEVLELRNLGPAGFLSSPWTFLDISIIALCVVGTAFGVHHGILSSSLLGEA--SSSRAMSFSTVSTVAEWEQNFIIVTGVIVFVAWIKVVRFGSMCRTLTMCGCALTRCAWDLLGYTLVFATVFLAFAQLAFLIFGGALPDFSSFSSCILTQVRILLGDFDFSSLEAASRIMGPIYFVSYVFCVGLIMMVMFLAIVSEAYSEEKSEQAHSQPQFQLSSVIKQ--VKVVDRLSCKKPRVAGIQKTLPPSGQIN------FATWRQNLKGQGFADAEIEAVFARY--DGDGALTRAEQLQMRRDLRLEKQTIRLHISVSPREKKKKHQVTSRDDDDDDDDGDSDEDDDITVVRRGNHHQGGGGGVSREEFRVLVRRVNQMEHSIGSVVSKMDAVMVKLEAMERQRLRRRDVLSRLI 689          
BLAST of PKD2-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007306.1 (pep scaffold:Pmarinus_7.0:GL480012:400827:419749:1 gene:ENSPMAG00000006595.1 transcript:ENSPMAT00000007306.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 1.956e-21
Identity = 62/284 (21.83%), Postives = 129/284 (45.42%), Query Frame = 3
Query: 1008 NQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFT-ITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENY 1856
             +IV++L   +W+D  TRAV  +F  +N+N +LFC V ++ EF    G       I   ++  +    E       I+F I ++  A    L   E+    FK++W+I +++ + +    +     ++    + +         +  F ++  +D+     ++  +F++ +K+  +++  +    L      +   I GF+V+ ++VF +F QL  L+F  +  +Y    T +   F ++LG   Y  L  AN   G + +  +     FV++N  + I+ E +
Sbjct:  784 TEIVANLSSASWLDHSTRAVLTEFTGYNMNTDLFCSVTLLLEFSQGAGDAHGHAYIHVFRIESFVGKLETLTGVVYIVFAILLVIIAATEALRLSELGVAYFKSFWNIAELLSITLGAASVVTYFIKMSVATRTLEKFRTDPHKFVNFQELVTWDQQLSELLATLVFVSTIKVLGHMKSLRQFEVLVGAFSEARDHIQGFAVIVVVVFCSFGQLTSLLFAGSLRNYRTFTTCLEQLFSLLLGQPGYGELYAANRVLGPLIYFAFTSVNTFVIVNFSLGILSEGF 1067          
BLAST of PKD2-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002645.1 (pep scaffold:Pmarinus_7.0:GL476683:134:12081:-1 gene:ENSPMAG00000002415.1 transcript:ENSPMAT00000002645.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 1.316e-14
Identity = 70/299 (23.41%), Postives = 140/299 (46.82%), Query Frame = 3
Query: 1017 VSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLR----YSSAFEYFIL--CCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQH---------FISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVK 1868
            +S L++ +W+D  T  ++  F+++N N NLFC V ++ E       +++    PS  L+    +++   Y IL     I ++I  +Y+   VI    + K++  K   ++ +       IM I+  I ++I   +Q+S    +  ++  F  +  Y  L+ H         F+ + LF+A L+I    R+N TM+   +       ++  FS++F ++ I+++ + + + G+    Y     SV S F  + G   +  L  A G   A+ +  ++     +L+NM V +I E Y + +
Sbjct:   26 MSYLEQNSWVDARTTGLYAQFIIYNANANLFCLVEVLVE------SLSADMFQPSSNLKVFRLFNNRISYIILDNVAYIFYLIISMYFLTCVIFSITKEKFEYLKKPMNVAE-------IMNITLMIMKLI---KQVSRS-PALGSHLNFFFLINYCTLYSHKPLILLSTQFLGLVLFLATLRILPLFRYNTTMSEAVTLAAHCAHKLCSFSLIFFVLLISYSLIFWNVLGTRVGAYRSFGKSVGSLFAALHGAPVFGDLYAAGGYMAALLYFSFMLLFTVLLLNMMVVVIEEVYTRFR 307          
BLAST of PKD2-3 vs. Ensembl Nematostella
Match: EDO47023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN85])

HSP 1 Score: 415.231 bits (1066), Expect = 2.206e-131
Identity = 264/728 (36.26%), Postives = 425/728 (58.38%), Query Frame = 3
Query:  348 CSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNL--MYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLR---------------------------ESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILET 2444
            C    ++I   LW TR   D + S+ +++I TTLREL IYL+F+ +L +++FG  ++  +YF   M + F+       N     F D++   ++W Y        L+W+  + N++  T  + +L  +YFE K++G  R RQ+R     C +     S    CY  YS   +D        +   WTY + +  Q  +Y+G ++ Y GGG+   L     +T QI+ DLK+  W+DRGTRAVF+DF V+N N+NLFC VR+V E+P  GG + SF     KL+RY   F++F++ CE +F++FIIYY IE  LE ++ K + FK++W++ D+VV+++  + + FN+YR + V   +S+++     Y  FD +  +   F + +++ +F A +K+FKYI FNKTMT LSSTL +  K++ GF++MF I+F A+AQL YL+FG+   D+S  + S+ + FRIILGDFD+  +  AN   G ++F+ YVFFVFFVL+NMF+AII + Y +VK D         ++++FK     ++ +   K +KI+DIQ A+ + D+N D+ L F+EWR  +K +G+AD EIEAVF+KYD+DGD++LD  EQ++M E LE +K ++++ +   +     R  S S+++ R                                    V+ EE   L+ R+D +E+++  I+ KID VL  +E++E  KL  ++ + K+L++
Sbjct:   84 CWTRFKRIIRGLWRTRQTEDTD-SDREMHIKTTLRELIIYLVFITILCILTFGMTSSTMYYFTKVMRDLFVESSMSNRN----TFKDITTMNEFWMYTTETLSDGLYWE-QYYNNQNVTKPKDDLGFIYFENKILGRPRFRQLRVLNDSCTVHDDFKSVIKECYAAYSPNVEDMNTF-GKMNGSAWTYQTEKDLQGRSYWGRMTTYSGGGFTQLLAPTKAETQQIIEDLKQNLWLDRGTRAVFIDFTVYNANINLFCIVRLVFEYPPTGGCIPSFNFRTVKLIRYVDTFDHFVMACEGIFILFIIYYTIEEGLEIKKHKMKYFKSFWNVLDVVVIMLGYVAVVFNLYRTMAVGDLLSSLLEDGSQYANFDSLGFWQTQFNNMVAVAVFFAWIKVFKYISFNKTMTQLSSTLSKCAKDVAGFAIMFFIIFFAYAQLGYLIFGTQVRDFSTFEDSIFTLFRIILGDFDFHQIENANRVLGPLFFMTYVFFVFFVLLNMFLAIINDTYAEVKSDIASQESEFEITDYFKKGYQNMLNKLSFKREKILDIQKALKSADVNQDNKLDFEEWRANLKSRGHADAEIEAVFAKYDLDGDRILDEDEQRRMQEDLEGQKAELNDEIEEMERQKESRPKSASRMSFRGSDADSDDDDDDSQGGLSGRVGSAAGHRRGGGGGGGVSYEEFNVLSRRVDRMEHSIGSIVSKIDAVLVKLEAMEKAKLKRRETMAKLLDS 804          
BLAST of PKD2-3 vs. Ensembl Nematostella
Match: EDO44744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR6])

HSP 1 Score: 165.236 bits (417), Expect = 9.068e-42
Identity = 134/446 (30.04%), Postives = 216/446 (48.43%), Query Frame = 3
Query:  609 LSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPM-----RPNKSN-----PGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEF-REIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEF 1913
            +S+   +W + + V +  L+  +SW N R  +   G L      ++G ARMRQ+R K   C++          C   YS   +D+ P+     RP  SN       W Y  S   ++  Y G ++LY GGGY  DL     K   +++ LK   W+DR TRA+F++F V++   NL C   ++ E    GG      +  +++ RY+  F  F+L CEILFV+F +Y+  +   E  RE     F  YWS  ++V+   S   I     R       + T       +  F  ++  D++F +  +   F   LK  +  RFNK M+ L++TL  S KE+  FS++F +VF+AF    YL+F +    +  + ++V +   ++LG F Y+ L + N       F  Y   V F+LINMF++II EN+ +VK    + +    + +F
Sbjct:  667 VSDITSFWNWTEAVLIPGLY-SESWYNGR--SDKPGFLADHTSWMLGTARMRQLRVKAGDCKVHDVYSGYLAQCNGPYSWDTEDTTPVFRPGWRPAPSNYSTAQNAWKYRDSSELRSLPYLGKLALYSGGGYAFDL-GKKEKAMAMLAQLKRDKWVDRSTRAIFVEFTVYSPYTNLHCVGYLLLEVLPSGGTSPFSELLVTRIDRYAGNFMIFVLLCEILFVLFTVYFTYKQGKEIAREGVAYHFHEYWSWVELVLSGCSWTSIVLYFVRFGINKSTVLTYHKDTSVFVNFHALAASDQVFGYVYAFVAFFVSLKFLRLFRFNKRMSLLATTLKCSAKELAHFSIVFGLVFMAFVHFCYLIFSTELYIFHTVLSTVETLISVMLGKFSYERLLQTNRLLAPFMFFFYSIVVVFILINMFISIIIENFQRVKSQNDLQSNEYEIVDF 1108          
BLAST of PKD2-3 vs. Ensembl Nematostella
Match: EDO48595 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIZ7])

HSP 1 Score: 153.295 bits (386), Expect = 6.376e-40
Identity = 124/449 (27.62%), Postives = 225/449 (50.11%), Query Frame = 3
Query:  609 LSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSY---LLSRNFPCYEKYSIFNDDSAPMRPNKSNPGW------------------------TYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTI-TPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIIL-GDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVK 1868
            + +   +W++ +   +  ++ D +W N++P    EG L      LVG+ R+RQ+R +   C +        +R  PCY  YS      A  +   + PGW                         Y ++       + G   LYGGGGY+ DL   ++   +++ +LK+  WID  TRAVF++ +VF  + + F  V  + E    GG  T  +I T S     S   +     CE++ ++ +IY+ I  +++    +   FK+ W+  +++ VL +I  I  +I+R  + +Q ++ V  +      F  +  +  +    +++ +F+  +K+ + ++FNK ++ L+ ++ +S K +  +SV+FL+ FIAFAQ+A+L FG   T YS +     +QF + + GD D++AL  ++G  G IYF  Y+  +  +LINMF+AI+ E Y +V 
Sbjct:    1 IGSEENFWKWAETYMVPGMY-DPTWYNNQPFEYKEGFLSNRIGYLVGMPRLRQLRVENDECPIGDRYDSFATRLRPCYPHYSF----KAEYKTLYNRPGWDALTQNETFFHSEFELYQMCPRPWRYKTASSLHTLPFQGDKDLYGGGGYVADLGYTASSALRVMHNLKKNNWIDERTRAVFMEVLVFEPSNSYFSAVTYLYERLATGGGTTYRSIKTMSLYGSRSHGLQSLYAVCELVLILIVIYFIIAELIKLYRQRCAYFKSAWNWIEIIQVLAAIATIVLSIFRRYHASQLVNRVHENPFKTSSFHYVVMWSEIENALMAVLIFVITVKLLRILKFNKHISLLAGSMKKSAKRLVSYSVVFLVAFIAFAQVAFLAFGPTTTAYSTVVRVFRTQFSMFVGGDPDWEALKSSSGFIGPIYFFGYMTAMATILINMFIAILNEAYKEVH 444          
BLAST of PKD2-3 vs. Ensembl Nematostella
Match: EDO40051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8E5])

HSP 1 Score: 153.295 bits (386), Expect = 1.570e-39
Identity = 116/454 (25.55%), Postives = 215/454 (47.36%), Query Frame = 3
Query:  543 MENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFE----IKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNP--GWTYTSSQVSQA----DNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHD 1874
            +EN F+   ++ G+ K   F ++ +TR YW +L +  +  +F  + W N +     + +L Y        ++ VAR+RQ+R +   C +   L      C + YS   ++   + P    P   W Y + +  +            +      +      + +K   +   L E  W+D+ TRAVF +F ++N N NLFC V ++ E    GG+    +I   +L RY     +F+  CEI++++F  Y+    I +  ++     KN WSI ++ V  +S+  +     R+ +  + +  +      +      +  D   +  + + +F + +KI + +RFN+ M+ L+ TL     +I  F +++ I F A+AQLA L+FG NA  +  +  S  +    +LG F  K +S+ N   G  +F +Y   + F+LINMF++II +++ +V  D
Sbjct:   41 VENVFLQASYN-GSTK---FDEIGSTRDYWPWLKDTVIPSIF-IEKWYNDQ-----DYHLGYLADTPTAWVLAVARLRQLRMQKHTCPLLPALQHVIPSCNDFYSSDEEERGMLLPGWKEPKTAWQYQTGEELKTFPYWGQKATYSAGGYVQVFPPSTAKNYDKAQALADALNENDWLDKYTRAVFTEFSIYNANSNLFCVVTLLIEQLPTGGIFKFPSILTLRLYRYVGGEMFFVAACEIIYLLFTAYFIFREIKQAYKLGLDKLKNPWSILEIFVTCLSLSMVVLYFLRIKFTAEVVKDMRNDPTRFVSLHYTAFLDEWIKCLMGLIVFFSFIKIVRLLRFNRRMSLLAQTLKLCIPKIGAFVIVYGIAFFAYAQLACLVFGQNAEGFMTIPRSAATLMDTLLGKFTLKEMSDINRLIGPTFFYIYTLSMIFILINMFMSIINDSFAEVNSD 484          
BLAST of PKD2-3 vs. Ensembl Nematostella
Match: EDO48489 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ00])

HSP 1 Score: 144.821 bits (364), Expect = 5.610e-37
Identity = 119/424 (28.07%), Postives = 216/424 (50.94%), Query Frame = 3
Query:  627 YWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKV---IPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSA---FEYFILCCEILFVIFIIYYAIEVILEFREIKWQ---IFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIIL-GDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVK 1868
            +WE+ D+  L  L+ +  W N +P    EG +   E  +VG+ R+RQVR K     P  MP +   RN       SI        +P      W Y S+    + ++ G   +Y GGGY+ DL  +  +  +++S+L++  WID  T  VF++F VF    +LF  V+ + E    GG  T  T+    L+ Y+SA    + F   C+++ ++ I+++   + +EF +I  Q     K +W+  +++ +L ++  I    ++  Y ++ +  V  +       D I  +     + +S+ +FI  +K  + IRFN+++  ++ T+ +S K I  F ++F+ V +AF QL +L FGS +T YS    S+ S  +++L GD  +  L + N   G  +  +Y+  +  +L+NMF+AI+ ++Y + K
Sbjct:   51 FWEWTDSTLLPALY-EPQWYNGKPFEYDEGFISSREAFVVGMPRLRQVRLKPEDKTPWNMPMWKPVRNLT--RSMSILKLQDICPKP------WRYQSASALHSLSFTGLDLVYDGGGYVADLGYNMWQAKEVISNLQKNNWIDDKTGGVFVEFTVFEPTTSLFSAVKYLYERFRTGGTNTRATV--RTLVLYASADTNMQSFFQVCQLMLMLMILFF---LFVEFGKIYRQGREYPKQFWNWMELIQILCTVAAIVMFFFKEKYTSEFVQRVRDNPFETSSTDYIVLWSDCEIYLLSLVIFIITIKFLRLIRFNRSICQMTGTITKSAKSIANFFIVFVAVLLAFTQLGFLAFGSRSTPYSSFFQSLRSCLQMVLGGDMHFFELQDINRILGPAFAFVYMLSMTMILLNMFLAILNDSYEETK 460          
BLAST of PKD2-3 vs. Ensembl Medaka
Match: pkd2l1 (polycystin 2 like 1, transient receptor potential cation channel [Source:NCBI gene;Acc:100820724])

HSP 1 Score: 386.726 bits (992), Expect = 3.280e-121
Identity = 234/621 (37.68%), Postives = 368/621 (59.26%), Query Frame = 3
Query:  336 QNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMN 2198
            Q  K    C      LW T    +   +N + YI TTLREL +YL+FL+ + L+++G  +++++YF  AM + F+N G D G    + F  +     +W +     L  L+W   W N +   +   + +Y+E  L+GV RMRQ++ K   C++        F CY+ Y    +D        +   WTY + +  +  +++G +S Y G GY  DL     ++ +I+S L +  W+ RGTR VF+DF  +N N+N+FC + ++ EFP  GG V S+ I   KLLRY + ++YFIL CE +F +FI+YY +E +LE R  ++   K+ W+I D+VV+L++++ I+FN++R I V+  +  ++ + + Y  F+ ++ +   + +  ++NLF A +KIFKYI FNKTMT LS+TLGR  K+I GF+VMF IVF A+AQL YL+FG+    +S     + +QFRIILGDF++ A+ +AN   G IYFV YVFFVFFVL+NMF+AII + Y +VK + T     + +++  K        R K+K  KI D+Q A+  G       + F +++ T+ + G+ D EI A FSK+D DG+QVLD  EQ++M  +L+ ++  +S  +N
Sbjct:   74 QRVKKKSGCCSFIKGLWGT-ALTENVSNNREKYIRTTLRELLVYLLFLLDICLLTYGMTSSSTYYFTKAMTDLFVNSGGDAG----VAFQSIGTMADFWSFAQGPLLDGLYWT-KWYNQQSLNNGNQSFIYYENMLLGVPRMRQIKMKNNSCKVHQDFKDEIFGCYDVYDEKKEDDLNFGL-INGTAWTYHTEKEMRGSSHWGLLSTYSGAGYYQDLDRTRERSAEILSTLMDNCWLGRGTRVVFIDFSAYNANINMFCVISLMVEFPATGGAVPSYQIRTVKLLRYVTRWDYFILGCEAVFCVFILYYMVEEVLELRIHRFSYLKSVWNILDIVVILLALVAIAFNVFRTIKVDNLLGKLLENPNIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSTTLGRCAKDILGFAVMFFIVFFAYAQLGYLLFGTEVDTFSTFVKCIFTQFRIILGDFNFDAIDQANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELTSQKDELQITDIIKQSYMKTFTRLKLKKDKITDVQKALQAG----SGEIQFKDFKQTLIEMGHTDGEISAAFSKFDRDGNQVLDAEEQERMKRELQEKRDALSTELN 683          
BLAST of PKD2-3 vs. Ensembl Medaka
Match: pkd2l1 (polycystin 2 like 1, transient receptor potential cation channel [Source:NCBI gene;Acc:100820724])

HSP 1 Score: 384.8 bits (987), Expect = 3.322e-119
Identity = 234/621 (37.68%), Postives = 367/621 (59.10%), Query Frame = 3
Query:  336 QNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMN 2198
            Q  K    C      LW T    +   +N + YI TTLREL +YL+FL+ + L+++G  +++++YF  AM + F+N G D G    + F  +     +W +     L  L+W   W N +   +   + +Y+E  L+GV RMRQ++ K   C++        F CY+ Y    +D            WTY + +  +  +++G +S Y G GY  DL     ++ +I+S L +  W+ RGTR VF+DF  +N N+N+FC + ++ EFP  GG V S+ I   KLLRY + ++YFIL CE +F +FI+YY +E +LE R  ++   K+ W+I D+VV+L++++ I+FN++R I V+  +  ++ + + Y  F+ ++ +   + +  ++NLF A +KIFKYI FNKTMT LS+TLGR  K+I GF+VMF IVF A+AQL YL+FG+    +S     + +QFRIILGDF++ A+ +AN   G IYFV YVFFVFFVL+NMF+AII + Y +VK + T     + +++  K        R K+K  KI D+Q A+  G       + F +++ T+ + G+ D EI A FSK+D DG+QVLD  EQ++M  +L+ ++  +S  +N
Sbjct:   74 QRVKKKSGCCSFIKGLWGT-ALTENVSNNREKYIRTTLRELLVYLLFLLDICLLTYGMTSSSTYYFTKAMTDLFVNSGGDAG----VAFQSIGTMADFWSFAQGPLLDGLYWT-KWYNQQSLNNGNQSFIYYENMLLGVPRMRQIKMKNNSCKVHQDFKDEIFGCYDVYDEKKEDDLNFGLINGT-AWTYHTEKEMRGSSHWGLLSTYSGAGYYQDLDRTRERSAEILSTLMDNCWLGRGTRVVFIDFSAYNANINMFCVISLMVEFPATGGAVPSYQIRTVKLLRYVTRWDYFILGCEAVFCVFILYYMVEEVLELRIHRFSYLKSVWNILDIVVILLALVAIAFNVFRTIKVDNLLGKLLENPNIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSTTLGRCAKDILGFAVMFFIVFFAYAQLGYLLFGTEVDTFSTFVKCIFTQFRIILGDFNFDAIDQANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELTSQKDELQITDIIKQSYMKTFTRLKLKKDKITDVQKALQAG----SGEIQFKDFKQTLIEMGHTDGEISAAFSKFDRDGNQVLDAEEQERMKRELQEKRDALSTELN 683          
BLAST of PKD2-3 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 380.948 bits (977), Expect = 3.910e-118
Identity = 247/720 (34.31%), Postives = 409/720 (56.81%), Query Frame = 3
Query:  327 DEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGN--LMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAIN--NGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQ-----------EELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            D  ++  C +   +    LW T    DG+ SN + Y+   LREL  Y+ FL+ + ++++G I+ N +Y+  AM   F++      N K   F  LS    +W+Y     L  ++W+  W N++   S  GN   +Y+E  L+GV R+RQVR     C +   L      CY  Y+  N+D++P  P ++   W +T+     A  ++G +S YGGGGY  DL+    ++   +  LK+  W+DRGTRA+FLDF V+N N+NL C  R++ EFP  GGV+TS+     +L++Y S+++YF+  CE+ F +F++YY +E +LE    +   FKN W+  D+++V +S++ I  +I R   +   +   + +  ++  FD ++     F +  ++ +F   +K+FK+I FNKTM+ LS+T+ R  K++ GF++MF I+F+A+AQLAYL+FG+   D+S  Q SV +QFRIILGDFD+  + EAN   G IYF+ +V F+FF+L+NMF+AII + Y +VK D   +   + M++F K      + + ++K   + DI D++    G LN      +DE    +K+KG+ + EI+A+F+KYD DGD  L  ++ +QM + LE E++ +    NS    S  R   ++Q +  E D     + ++           EE   L  R+D +E+++  I+ KID V+  +E +E  KL  + V+ ++L+
Sbjct:  124 DRHEHPGCMKRIFQNIRILWGTELMEDGD-SNRERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPK--TFRSLSTMEDFWKYTQGPFLGGMYWE-VWYNNQ---SLPGNQSFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFGP-QNGTAWVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTVRLIKYVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRAA-MGGDLLKGLENYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVFTQFRIILGDFDFFEIKEANPVLGPIYFITFVLFIFFILMNMFLAIINDTYSEVKADMAQHRSEMEMTDFIKKGCTKALVKLRLKKTTVDDISDSLRQAGGKLN------YDELLQDLKEKGHTEAEIQAIFAKYDQDGDLELTEHDHQQMRDDLEKEREDLDLERNSLTRPSSGRSFPRTQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEGMERAKLKRRDVLVRLLD 828          
BLAST of PKD2-3 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 380.178 bits (975), Expect = 2.434e-117
Identity = 247/720 (34.31%), Postives = 409/720 (56.81%), Query Frame = 3
Query:  327 DEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGN--LMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAIN--NGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQ-----------EELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            D  ++  C +   +    LW T    DG+ SN + Y+   LREL  Y+ FL+ + ++++G I+ N +Y+  AM   F++      N K   F  LS    +W+Y     L  ++W+  W N++   S  GN   +Y+E  L+GV R+RQVR     C +   L      CY  Y+  N+D++P  P ++   W +T+     A  ++G +S YGGGGY  DL+    ++   +  LK+  W+DRGTRA+FLDF V+N N+NL C  R++ EFP  GGV+TS+     +L++Y S+++YF+  CE+ F +F++YY +E +LE    +   FKN W+  D+++V +S++ I  +I R   +   +   + +  ++  FD ++     F +  ++ +F   +K+FK+I FNKTM+ LS+T+ R  K++ GF++MF I+F+A+AQLAYL+FG+   D+S  Q SV +QFRIILGDFD+  + EAN   G IYF+ +V F+FF+L+NMF+AII + Y +VK D   +   + M++F K      + + ++K   + DI D++    G LN      +DE    +K+KG+ + EI+A+F+KYD DGD  L  ++ +QM + LE E++ +    NS    S  R   ++Q +  E D     + ++           EE   L  R+D +E+++  I+ KID V+  +E +E  KL  + V+ ++L+
Sbjct:  124 DRHEHPGCMKRIFQNIRILWGTELMEDGD-SNRERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPK--TFRSLSTMEDFWKYTQGPFLGGMYWE-VWYNNQ---SLPGNQSFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFGP-QNGTAWVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTVRLIKYVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRAA-MGGDLLKGLENYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVFTQFRIILGDFDFFEIKEANPVLGPIYFITFVLFIFFILMNMFLAIINDTYSEVKADMAQHRSEMEMTDFIKKGCTKALVKLRLKKTTVDDISDSLRQAGGKLN------YDELLQDLKEKGHTEAEIQAIFAKYDQDGDLELTEHDHQQMRDDLEKEREDLDLERNSLTRPSSGRSFPRTQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEGMERAKLKRRDVLVRLLD 828          
BLAST of PKD2-3 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 326.25 bits (835), Expect = 8.512e-98
Identity = 224/722 (31.02%), Postives = 384/722 (53.19%), Query Frame = 3
Query:  327 DEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGN--LMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALS--EANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAIN--NGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQ-----------EELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILE 2441
            D  ++  C +   +    LW T    DG+ SN + Y+   LREL  Y+ FL+ + ++++G I+ N +Y+  AM   F++      N K   F  LS    +W+Y     L  ++W+  W N++   S  GN   +Y+E  L+GV R+RQVR     C +   L      CY  Y+  N+D++P  P ++   W +T+     A  ++G +S YGGGGY  DL+    ++   +  LK+  W+DRGTRA+FLDF V+N N+NL C  R++ EFP  GGV+TS+     +L++Y S+++YF+  CE+ F +F++YY +E +LE    +   FKN W+  D+++V +S++ I  +I R   +   +   + +  ++  FD ++     F +  ++ +F   +K+FK+I FNKTM+ LS+T+ R  K++ GF++MF I+F+A+AQLAYL+FG+   D+S  Q SV S+  ++   ++ + L    ++G  G                      IC   + VK D   +   + M++F K      + + ++K   + DI D++    G LN      +DE    +K+KG+ + EI+A+F+KYD DGD  L  ++ +QM + LE E++ +    NS    S  R   ++Q +  E D     + ++           EE   L  R+D +E+++  I+ KID V+  +E +E  KL  + V+ ++L+
Sbjct:  124 DRHEHPGCMKRIFQNIRILWGTELMEDGD-SNRERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPK--TFRSLSTMEDFWKYTQGPFLGGMYWE-VWYNNQ---SLPGNQSFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFGP-QNGTAWVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTVRLIKYVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRAA-MGGDLLKGLENYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSV-SRTDLL---YNLRPLHFLYSHGEKG----------------------ICTVSLFVKADMAQHRSEMEMTDFIKKGCTKALVKLRLKKTTVDDISDSLRQAGGKLN------YDELLQDLKEKGHTEAEIQAIFAKYDQDGDLELTEHDHQQMRDDLEKEREDLDLERNSLTRPSSGRSFPRTQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEGMERAKLKRRDVLVRLLD 804          
BLAST of PKD2-3 vs. Planmine SMEST
Match: SMESG000059487.1 (SMESG000059487.1)

HSP 1 Score: 1560.04 bits (4038), Expect = 0.000e+0
Identity = 811/811 (100.00%), Postives = 811/811 (100.00%), Query Frame = 3
Query:   36 FERSVCVCDPIKKLYFVNSNTTRNFILTESKKTKFSLIRIFHRLTSIYLQQFSEFSRMSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST 2468
            FERSVCVCDPIKKLYFVNSNTTRNFILTESKKTKFSLIRIFHRLTSIYLQQFSEFSRMSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLRELFIYLIFLVLLLLISFGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNYYGSISLYGGGGYIIDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIYFVLYVFFVFFVLINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST
Sbjct:   14 FERSVCVCDPIKKLYFVNSNTTRNFILTESKKTKFSLIRIFHRLTSIYLQQFSEFSRMSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLRELFIYLIFLVLLLLISFGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNYYGSISLYGGGGYIIDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIYFVLYVFFVFFVLINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST 824          
BLAST of PKD2-3 vs. Planmine SMEST
Match: SMESG000059487.1 (SMESG000059487.1)

HSP 1 Score: 1517.29 bits (3927), Expect = 0.000e+0
Identity = 788/791 (99.62%), Postives = 791/791 (100.00%), Query Frame = 3
Query:   96 TTRNFILTESKKTKFSLIRIFHRLTSIYLQQFSEFSRMSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST 2468
            +++NFILTESKKTKFSLIRIFHRLTSIYLQQFSEFSRMSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLRELFIYLIFLVLLLLISFGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNYYGSISLYGGGGYIIDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIYFVLYVFFVFFVLINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST
Sbjct:    4 SSKNFILTESKKTKFSLIRIFHRLTSIYLQQFSEFSRMSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLRELFIYLIFLVLLLLISFGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNYYGSISLYGGGGYIIDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIYFVLYVFFVFFVLINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST 794          
BLAST of PKD2-3 vs. Planmine SMEST
Match: SMESG000059487.1 (SMESG000059487.1)

HSP 1 Score: 1516.13 bits (3924), Expect = 0.000e+0
Identity = 793/812 (97.66%), Postives = 795/812 (97.91%), Query Frame = 3
Query:   66 IKKLYFVNSNTTR-----------NFILTESKKTKFSLIRIFHRLTSIYLQQFSEFSRMSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST 2468
            I   +FVN +  R           NFILTESKKTKFSLIRIFHRLTSIYLQQFSEFSRMSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLRELFIYLIFLVLLLLISFGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNYYGSISLYGGGGYIIDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIYFVLYVFFVFFVLINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST
Sbjct:    9 ISHKHFVNDSVVRENSGKADSLGINFILTESKKTKFSLIRIFHRLTSIYLQQFSEFSRMSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLRELFIYLIFLVLLLLISFGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNYYGSISLYGGGGYIIDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIYFVLYVFFVFFVLINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST 820          
BLAST of PKD2-3 vs. Planmine SMEST
Match: SMESG000059487.1 (SMESG000059487.1)

HSP 1 Score: 1496.87 bits (3874), Expect = 0.000e+0
Identity = 779/780 (99.87%), Postives = 780/780 (100.00%), Query Frame = 3
Query:  129 KTKFSLIRIFHRLTSIYLQQFSEFSRMSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST 2468
            +TKFSLIRIFHRLTSIYLQQFSEFSRMSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLRELFIYLIFLVLLLLISFGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNYYGSISLYGGGGYIIDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIYFVLYVFFVFFVLINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST
Sbjct:   17 ETKFSLIRIFHRLTSIYLQQFSEFSRMSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLRELFIYLIFLVLLLLISFGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNYYGSISLYGGGGYIIDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIYFVLYVFFVFFVLINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLYGIST 796          
BLAST of PKD2-3 vs. Planmine SMEST
Match: SMESG000018492.1 (SMESG000018492.1)

HSP 1 Score: 435.647 bits (1119), Expect = 1.928e-140
Identity = 291/742 (39.22%), Postives = 439/742 (59.16%), Query Frame = 3
Query:  222 TRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQMCEKITNYLWTTRTKIDGNKSNADIYIMTTLREXXXXXXXXXXXXXXXXGTINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVALKFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSYLLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNXXXXXXXXXXXXXXXDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNLFCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFIIYYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMTHLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVLSQFRIILGDFDYKALSEANGPFGAIXXXXXXXXXXXXXINMFVAIICENYVKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDLNNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHEQLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLFLNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETF 2447
            TR +  AM     S ++YEY   T  +   ++ NF     + C    +     LW TR   D  K +  +YI TTLREL IY+ FL +L++ISFG     +++F   +   F    F   N     F   +    +W++L    L  L+W  +W N+   TS + N +Y+E +L+G+ R+RQVR +   C +PS        C+  YS+ ++         S P W YT+S V     Y G ++ YGGGG+ ++L S    +   +  L    WIDRGTRAV +DF V+N N+NLFC +++V EFP  GG++ S      KL+RY  + ++F+L CE+LFV+FI+YY +E  LE + +K++ F + W+I D++V++ S+ C  FNI R + V   I T++ +D+ +P F+ ++ +   F + I+I LF+A +K+FKYI FNKTMT LS+TL R  K++ GF++MF I+FIAFAQL YL+FG+   D+S +Q  + + FRIILGDFD+  L  A+  FG +YFV YVFFVFFVL NMF+AII + Y +VK +         ++++ K +T  V+ +  +K  KI+DIQ+A+  GD NND  + FDEWR+ +K +GY D EIEAVF++YD DGD+ LD  EQ  M ++LE +K  +            + Q  KS+I L ++    +  V+ EE   LN R+D ++NN ++I+ KID VL ++ESIE  K  +++ +G IL T 
Sbjct:    9 TRELPSAM-----SDDSYEYGKSTKDSI--EETNFINP--NSCWNRFKNGIRSLWATRHTED-TKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNF---NDNSGTFAASTTESDFWKFLTGPLLNGLYWT-TWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTP-WVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSFNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLAGFAIMFFIIFIAFAQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPLYFVFYVFFVFFVLFNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLKKDKIIDIQNAVLAGDTNNDGKMDFDEWRVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSL----------DLEIQYEKSEI-LNKTRDVILPVVSLEEYRALNRRVDRMDNNTRVIVTKIDTVLEALESIEKDKARSRETMGIILNTL 724          
The following BLAST results are available for this feature:
BLAST of PKD2-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PKD22.237e-12135.80polycystin 2, transient receptor potential cation ... [more]
PKD2L12.279e-11935.70polycystin 2 like 1, transient receptor potential ... [more]
PKD2L21.445e-7935.06polycystin 2 like 2, transient receptor potential ... [more]
PKD2L21.490e-7935.06polycystin 2 like 2, transient receptor potential ... [more]
PKD2L24.391e-7334.14polycystin 2 like 2, transient receptor potential ... [more]
back to top
BLAST of PKD2-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pkd-21.323e-5527.49Polycystin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U... [more]
lov-11.355e-1220.12Location of vulva defective 1 [Source:UniProtKB/S... [more]
back to top
BLAST of PKD2-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkd22.474e-5032.50gene:FBgn0041195 transcript:FBtr0080365[more]
brv21.187e-922.73gene:FBgn0036712 transcript:FBtr0331846[more]
brv21.998e-922.73gene:FBgn0036712 transcript:FBtr0075242[more]
brv31.740e-821.26gene:FBgn0040333 transcript:FBtr0340092[more]
brv31.939e-821.55gene:FBgn0040333 transcript:FBtr0300708[more]
back to top
BLAST of PKD2-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd25.598e-13235.89polycystic kidney disease 2 [Source:NCBI gene;Acc:... [more]
pkd2l13.576e-12736.53polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd1l2a5.824e-3727.92polycystic kidney disease 1 like 2a [Source:ZFIN;A... [more]
pkd1l2a2.555e-3627.92polycystic kidney disease 1 like 2a [Source:ZFIN;A... [more]
pkd1l2b1.520e-3525.35polycystic kidney disease 1 like 2b [Source:ZFIN;A... [more]
back to top
BLAST of PKD2-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp332.341e-12135.00ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
usp334.709e-12135.46ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
usp338.148e-12134.59ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
usp334.174e-12034.12ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
usp334.367e-11935.00ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
back to top
BLAST of PKD2-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkd2l18.943e-12335.28polycystic kidney disease 2-like 1 [Source:MGI Sym... [more]
Pkd21.246e-12035.24polycystin 2, transient receptor potential cation ... [more]
Pkd2l24.022e-8335.56polycystic kidney disease 2-like 2 [Source:MGI Sym... [more]
Pkd2l24.022e-8335.56polycystic kidney disease 2-like 2 [Source:MGI Sym... [more]
Pkd1l22.405e-3425.38polycystic kidney disease 1 like 2 [Source:MGI Sym... [more]
back to top
BLAST of PKD2-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6IVV8|PKD2_DANRE4.226e-13135.89Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 S... [more]
sp|Q4GZT3|PKD2_BOVIN2.946e-12635.24Polycystin-2 OS=Bos taurus OX=9913 GN=PKD2 PE=2 SV... [more]
sp|A2A259|PK2L1_MOUSE6.256e-12235.28Polycystic kidney disease 2-like 1 protein OS=Mus ... [more]
sp|Q13563|PKD2_HUMAN1.074e-12035.80Polycystin-2 OS=Homo sapiens OX=9606 GN=PKD2 PE=1 ... [more]
sp|O35245|PKD2_MOUSE8.717e-12035.24Polycystin-2 OS=Mus musculus OX=10090 GN=Pkd2 PE=1... [more]
back to top
BLAST of PKD2-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJQ90.000e+0100.00PKD2-3 OS=Schmidtea mediterranea OX=79327 GN=PKD2-... [more]
V3Z0D87.742e-15438.73Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A3S1A8W41.468e-15038.80Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A267FRH51.524e-15038.50Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GHK91.979e-15038.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of PKD2-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd23.447e-13236.04polycystin 2, transient receptor potential cation ... [more]
pkd2l16.210e-12235.72polycystic kidney disease 2-like 1 protein [Source... [more]
pkd1l2a3.642e-3625.55polycystin 1 like 2 [Source:NCBI gene;Acc:10304417... [more]
ENSAMXT00000006495.22.129e-3326.04pep primary_assembly:Astyanax_mexicanus-2.0:5:3500... [more]
pkd1a2.329e-619.75polycystic kidney disease 1a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of PKD2-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd2l15.853e-12235.87polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd2l17.301e-10833.57polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd22.498e-6328.83polycystic kidney disease 2 [Source:NCBI gene;Acc:... [more]
ENSPMAT00000007306.11.956e-2121.83pep scaffold:Pmarinus_7.0:GL480012:400827:419749:1... [more]
ENSPMAT00000002645.11.316e-1423.41pep scaffold:Pmarinus_7.0:GL476683:134:12081:-1 ge... [more]
back to top
BLAST of PKD2-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD2-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470232.206e-13136.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447449.068e-4230.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485956.376e-4027.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400511.570e-3925.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484895.610e-3728.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PKD2-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd2l13.280e-12137.68polycystin 2 like 1, transient receptor potential ... [more]
pkd2l13.322e-11937.68polycystin 2 like 1, transient receptor potential ... [more]
pkd23.910e-11834.31polycystin 2, transient receptor potential cation ... [more]
pkd22.434e-11734.31polycystin 2, transient receptor potential cation ... [more]
pkd28.512e-9831.02polycystin 2, transient receptor potential cation ... [more]
back to top
BLAST of PKD2-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059487.10.000e+0100.00SMESG000059487.1[more]
SMESG000059487.10.000e+099.62SMESG000059487.1[more]
SMESG000059487.10.000e+097.66SMESG000059487.1[more]
SMESG000059487.10.000e+099.87SMESG000059487.1[more]
SMESG000018492.11.928e-14039.22SMESG000018492.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035484
GenBankAKN21729.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035484 ID=SMED30035484|Name=PKD2-3|organism=Schmidtea mediterranea sexual|type=transcript|length=2601bp
GGTAACACAAAATCGGTGACATTCCTGTACAATAGTTTGAACGAAGTGTA
TGTGTTTGTGATCCAATAAAGAAGTTATATTTTGTTAACTCAAACACTAC
CAGAAATTTTATATTAACCGAATCGAAGAAAACCAAATTCAGCTTGATAA
GAATATTCCACAGACTCACTTCAATTTATCTTCAGCAATTTTCTGAATTT
TCAAGAATGTCTGTGACTGACACCCGCAATGTGCTCGAGGCCATGGAATG
TGAGACTTTATCCAGCAATGCCTACGAATATAATAATAAAACCGTGAAAA
CTTTTTCAAACGACAAAATTAATTTCGATGAAAAACAGAATTCAAAATGT
TCACAAATGTGCGAAAAAATCACAAATTATTTATGGACAACCCGCACGAA
GATAGATGGAAATAAATCCAATGCAGATATTTATATAATGACAACATTAC
GTGAACTTTTTATTTACTTGATATTTCTAGTTCTACTTCTTTTAATTTCA
TTTGGGACGATCAATGCCAATAGTTTCTATTTTGCGGCGGCAATGGAAAA
TGCATTTATTAATGAAGGCTTCGATTTTGGAAATCTTAAAGATTTGCAGT
TTCCTGATCTTTCGAATACTAGGCAATACTGGGAATATTTAGATAATGTA
GCTCTGAAATTTTTATTTTGGGATGATAGTTGGGTGAACAGTAGACCTGA
AACAAGCACTGAAGGAAATCTGATGTATTTTGAAATCAAATTGGTCGGAG
TTGCAAGAATGCGTCAAGTTAGATCAAAAGTCATCCCCTGCCAAATGCCT
TCATATCTCCTTAGTAGAAATTTTCCTTGCTATGAAAAATATTCAATTTT
CAACGACGACTCTGCACCAATGAGGCCAAATAAATCGAATCCTGGATGGA
CCTACACGTCAAGCCAAGTATCGCAAGCGGATAATTATTATGGCAGTATT
AGCTTATACGGAGGAGGTGGATATATCATTGACTTAACTAGTGATTCTAA
CAAAACAAATCAAATTGTAAGTGATTTGAAGGAACAAACCTGGATTGACA
GAGGAACTCGAGCGGTGTTTCTCGATTTTGTGGTTTTCAACATCAATATG
AATCTGTTTTGCAAAGTCAGGATAGTTGCAGAATTTCCTAATTTTGGCGG
AGTTGTAACCAGTTTTACTATAACGCCTTCCAAACTACTCCGTTATTCTT
CTGCATTTGAATATTTCATTCTTTGCTGCGAAATTTTATTCGTAATTTTC
ATAATATATTACGCAATCGAAGTTATTTTGGAATTTAGAGAGATAAAGTG
GCAAATATTCAAAAACTATTGGAGTATACAGGATATGGTGGTGGTCCTGG
TCAGTATTATGTGTATTTCCTTCAACATATACCGTGTAATATACGTTAAT
CAACAAATCTCCACTGTCATTGTTTCAGATGATACTTATCCGCAGTTTGA
TCAAATTAGTAAATATGATAGGCTTTTCCAGCATTTTATTTCTATTAATT
TGTTTATCGCTATTTTAAAAATATTTAAATACATTCGCTTTAACAAAACA
ATGACGCATTTAAGTTCAACTTTGGGAAGATCAGGAAAAGAAATTTTCGG
ATTTTCTGTGATGTTTCTTATTGTATTTATTGCTTTCGCCCAGTTGGCCT
ATTTGATGTTCGGATCCAACGCCACGGATTACAGTGGAATGCAAACCAGT
GTATTGAGTCAATTTCGAATAATTCTTGGAGATTTTGATTACAAAGCATT
ATCGGAAGCTAATGGTCCGTTTGGAGCGATATATTTTGTTCTGTATGTTT
TCTTTGTATTTTTTGTTTTAATCAACATGTTTGTGGCAATAATTTGCGAG
AATTATGTCAAAGTGAAACACGATGAAACAATAAACAATCAAACTATTTC
AATGTCTGAATTTTTCAAATCGAAAACTGCTGCAGTAATGGAACGGTTTA
AAATGAAAACGAAGAAAATTGTTGATATACAAGATGCAATAAACAATGGC
GATTTGAATAATGATTCATATTTAGGGTTTGACGAGTGGCGACTGACAAT
GAAACAGAAAGGCTACGCTGATTGTGAAATAGAAGCCGTATTTTCAAAAT
ATGACGTCGACGGCGACCAAGTGCTGGATCCTTATGAGCAAAAGCAAATG
CACGAACAATTGGAAGCTGAAAAAAAAAAAATTTCAGAAGCCATGAATTC
TGAAAAGGATGGATCATTTAAAAGGCAAAATTCTAAATCCCAAATAAATT
TGCGAGAATCAGATAGTAATGCTATAGAATACGTTACTCAGGAAGAACTA
TTGTTTCTCAATATTAGAATGGATGGCCTAGAAAATAATGTTCAATTAAT
TTTGCAAAAAATTGACCAGGTGCTCTCTAGCATGGAATCTATTGAGCTGC
AGAAATTAAACAATCAAAAAGTTATTGGAAAGATTTTGGAAACATTTCCT
TTATATGGAATTTCGACGTAAAGAAATATACTGAAGAAATGTACAGAAAT
ATCACATAAGATAATCAACTGTTTAAGAAAAATCATCACAAATTTTGATT
TATAATTTATTTTACCTTTTTATATTAATGGAAATCCAATAAGTATTTGT
G
back to top

protein sequence of SMED30035484-orf-1

>SMED30035484-orf-1 ID=SMED30035484-orf-1|Name=SMED30035484-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=755bp
MSVTDTRNVLEAMECETLSSNAYEYNNKTVKTFSNDKINFDEKQNSKCSQ
MCEKITNYLWTTRTKIDGNKSNADIYIMTTLRELFIYLIFLVLLLLISFG
TINANSFYFAAAMENAFINEGFDFGNLKDLQFPDLSNTRQYWEYLDNVAL
KFLFWDDSWVNSRPETSTEGNLMYFEIKLVGVARMRQVRSKVIPCQMPSY
LLSRNFPCYEKYSIFNDDSAPMRPNKSNPGWTYTSSQVSQADNYYGSISL
YGGGGYIIDLTSDSNKTNQIVSDLKEQTWIDRGTRAVFLDFVVFNINMNL
FCKVRIVAEFPNFGGVVTSFTITPSKLLRYSSAFEYFILCCEILFVIFII
YYAIEVILEFREIKWQIFKNYWSIQDMVVVLVSIMCISFNIYRVIYVNQQ
ISTVIVSDDTYPQFDQISKYDRLFQHFISINLFIAILKIFKYIRFNKTMT
HLSSTLGRSGKEIFGFSVMFLIVFIAFAQLAYLMFGSNATDYSGMQTSVL
SQFRIILGDFDYKALSEANGPFGAIYFVLYVFFVFFVLINMFVAIICENY
VKVKHDETINNQTISMSEFFKSKTAAVMERFKMKTKKIVDIQDAINNGDL
NNDSYLGFDEWRLTMKQKGYADCEIEAVFSKYDVDGDQVLDPYEQKQMHE
QLEAEKKKISEAMNSEKDGSFKRQNSKSQINLRESDSNAIEYVTQEELLF
LNIRMDGLENNVQLILQKIDQVLSSMESIELQKLNNQKVIGKILETFPLY
GIST*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR003915PKD_2
IPR002048EF_hand_dom
IPR013122PKD1_2_channel
IPR011992EF-hand-dom_pair
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005262calcium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0050982detection of mechanical stimulus
GO:0070588calcium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 645..669
NoneNo IPR availableGENE3DG3DSA:1.10.238.170coord: 605..649
e-value: 1.8E-21
score: 77.7
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 692..748
e-value: 8.5E-8
score: 34.0
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 448..555
e-value: 1.5E-9
score: 39.6
NoneNo IPR availablePANTHERPTHR10877:SF114POLYCYSTIN-2coord: 41..695
NoneNo IPR availablePANTHERPTHR10877POLYCYSTIN-RELATEDcoord: 41..695
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 337..552
NoneNo IPR availableTMHMMTMhelixcoord: 84..103
NoneNo IPR availableTMHMMTMhelixcoord: 378..397
NoneNo IPR availableTMHMMTMhelixcoord: 524..546
NoneNo IPR availableTMHMMTMhelixcoord: 423..442
NoneNo IPR availableTMHMMTMhelixcoord: 336..358
NoneNo IPR availableTMHMMTMhelixcoord: 463..485
IPR003915Polycystic kidney disease type 2 proteinPRINTSPR01433POLYCYSTIN2coord: 341..363
score: 57.39
coord: 465..486
score: 69.09
coord: 418..443
score: 26.15
coord: 566..585
score: 15.0
coord: 97..118
score: 21.82
coord: 286..308
score: 59.13
coord: 526..547
score: 67.27
coord: 704..722
score: 40.0
coord: 372..392
score: 40.0
coord: 172..191
score: 40.0
IPR002048EF-hand domainSMARTSM00054efh_1coord: 590..618
e-value: 1.5
score: 16.4
coord: 624..652
e-value: 2.2
score: 15.1
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 586..621
score: 8.432
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 624..655
score: 8.181
IPR013122Polycystin cation channel, PKD1/PKD2PFAMPF08016PKD_channelcoord: 134..553
e-value: 6.9E-109
score: 364.4
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 560..662