DNAHb-1

Overview
NameDNAHb-1 (AKN21713.1)
Smed IDSMED30035468
Uniprot Best hitDynein beta chain, ciliary OS=Tripneustes gratilla OX=7673 PE=1 SV=1 (E=0)
Length (bp)13546
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNAHb-1 (SMED30035468) t-SNE clustered cells

Violin plots show distribution of expression levels for DNAHb-1 (SMED30035468) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNAHb-1 (SMED30035468) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNAHb-1 (SMED30035468) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035468

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035468SMESG000072112.1 Contig3732uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035468SMESG000072112.1 Contig3732newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035468SMESG000017203.1 Contig3732uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035468SMESG000017203.1 Contig3732newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30035468SMESG000072114.1 SMESG000072113.1 SMESG000072112.1 SmedASXL_018456SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30035468SMESG000072114.1 SMESG000072113.1 SMESG000072112.1 dd_Smed_v4_3670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30035468SMESG000072114.1 SMESG000072113.1 SMESG000072112.1 dd_Smed_v4_3670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30035468SMESG000072114.1 SMESG000072113.1 SMESG000072112.1 dd_Smed_v4_3670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30035468SMESG000072114.1 SMESG000072113.1 SMESG000072112.1 dd_Smed_v4_3670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30035468SMESG000072114.1 SMESG000072113.1 SMESG000072112.1 dd_Smed_v4_3670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035468SMESG000072114.1 SMESG000072113.1 SMESG000072112.1 dd_Smed_v6_3670_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035468SMESG000072114.1 SMESG000072113.1 SMESG000072112.1 dd_Smed_v6_3670_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30035468SMESG000072114.1 SMESG000072113.1 SMESG000072112.1 dd_Smed_v6_3670_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30035468SMESG000072114.1 SMESG000072113.1 SMESG000072112.1 dd_Smed_v4_3670_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30035468SMESG000072114.1 SMESG000072113.1 SMESG000072112.1 dd_Smed_v4_3670_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30035468SMESG000072114.1 SMESG000072113.1 SMESG000072112.1 dd_Smed_v4_3670_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30035468SMESG000072114.1 SMESG000072113.1 SMESG000072112.1 dd_Smed_v4_3670_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNAHb-1 vs. Ensembl Human
Match: DNAH17 (dynein axonemal heavy chain 17 [Source:HGNC Symbol;Acc:HGNC:2946])

HSP 1 Score: 5630.06 bits (14604), Expect = 0.000e+0
Identity = 2830/4464 (63.40%), Postives = 3491/4464 (78.20%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLP--VGSEKVSEGDINSFGEVPRSI----IYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKG---ETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEK--VPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQ--IEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLG-SNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            D R E++ +     LK K DK+ KL   +E   +  +FFEKP++Q + VL     G +     FP +LKSK  +F K   E+I++D  +   L++GDIS TP+DQ  + V+EV+  +L+ ++N   WP V+S D+++  + LK++  V+ G+ KGKTLLP+P  +GS    +G + S   +P S+    ++AIET +I+W+HQI DVLSK S++ L+ GL+P P VE ++W TR  NL+CI+EQL  PKV K+  +LE   S Y P  ++++ +V   LKE+ +I LYL PLR  LEE+EQ +F+ +   I  +   +C IWA  + Y  P RI+V+ QE  N II    ++L P+E+ KG   E EE L  +  ++ +L +  ++++     +K +FKD  EPV W+F S+L F R+NSF  RI+ ++ +    +EF KLEK+E+ G++G  L   +  +++E   + K F +  YD LDP +++F +DY  F+  I DLDRRLAT   Q F DC C  +  KL+ + GGL++RP++  E   RY  ++++ D E++N K++YD  ++ +E+  +P IHKNMP V G+L+W  E++ER++  +    H++H      E  L  +K+DE++ELL+ H  K Y  W+ GVD+ C FNL QPL++R+  +  I VNF   L AVLREVKYL    Q+EIP SA  + S+N+T RK++ NL+L+V WYN ++     VE  LI++EL  ID +L  A T L WN +    G +QYI++VR+++HNL++R+ K+K+NI+ I   M +W  +PLFERK+ K + LL+LD R    NKRY  + +AG ++  +V EN+EL +AD++S  WK YV  IDDM+++ F + I  SL +++D   I+ S  PLFE+ M+L  + + F P+L+      F  L++ LV DI+  A  + RLA      +Y+ DLE+N +L + R E+S     A ++A+ YQ  F+ YS LWTDN +EFM  FL YG A++AE+L+   +  I    + PPTL QF+ QID YEK +EE+ K     +   W + DCR FKQA L+TI+RW  MFK+HL +HVTNSL +L  F+K+   GL K   EGD++GLVE+MGHL  VKERQ ATD MFEPLKQTI+LLKTY +EMP+E+HL+L+ELPE W NTKK+A+ VK TVAPLQ  EV+ +RRKC  F++KQH FRE+FR+  PF+FS    Y+ L+++   IS +E  ME L++S  LFEV VP++KQLK C +E+RLLK LWD + VVN+SIE WK T WKDINVEQMD DCK FAK +RSLDKEM++WDA+ G+++ +KN++TSLRAV+ELQNPAIR+RHW QLM AT+VKF M+E TTL DLL+LNLH++EDEVR+IV+KAVKE  MEKVLK L STWS MEF+HE H RTG  +LK+SE L+ETLE++QV+LQN+M SKY++HF  EV SWQ+ LSTAD VI IWFEVQRTWSHLESIFIGS+DIR QLP DS+RFD I+ +FKAL+ +  +T NVV+AT KP LY +LE ++  L +CEKALAEYLETKRLAFPRFYFVSSADLLDILSNGN P  V +HL+KLFDSL KLKF  +A ++  KVG+ MY+K+ E + F   CDL GQVE WLNR+L+ M +T+R  + E+V + EEK R+QWI ++PAQVAL+ +QI W TEV L+FARLEEGYENA++D+NKKQI+QLN LITLL+G L+  DR K+MTICTIDVH RDVV K+I  K+++SQ+FTW  QLRHRW +  + C+ NICDAQ +Y++EYLGNTPRLVITPLTDRCYITLTQSLHL M GAPAGPAGTGKTETTKDLGRALG MVYVFNCSEQMDYKS GNIYKGLAQ+G+WGCFDEFNRISVEVLSV+AVQVKC+QDAI+ K+K F+FLGE I L   +GIFITMNPGYAGR ELPENLKALFRPCAMVVPDFELICEIML+AEGFL+AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DP R EDQVLMRALRDFNIPKIVTDD PVFMGLIGDLFPALDVPRKRD  FEK ++Q+ ++LKLQAE++FVLKVVQL+EL  VRHSVF++GNAG+GKS V K+L KTY NLK+KP+AVDL+PKAVT DELFGIINP TREWKDGLFS IMRDLAN+T DGPKWI+LDGDIDPMWIESLNTVMDDNKVLTLASNERIPL  TMRL+FEISHL+TATPATVSRAGILYINP DLGW P V+SWI  R++QSE+ANL ILFDKY+P CL+ L+  FKKITP+ EI+ +Q + +LLE LL  +  P D P+E YELYFVF   WAFG  MFQDQLVD+RVEF+KWW+ EFKTIK P+QGT+FDYYID +TKKF PWT ++  FE+D + PLQA LV T+ET R RYF+DLL+EK  PVMLVG AGTGK+VL+ DKL S+  DNY+V  VPFNFYTTS MLQ VLEKPLEKK+GRNYGP G+KKL+YFIDDMNMPEVDKY TV PHTLIRQH+D+ HWYDR KLTLK+IHN QY+ACMNPT+GSFTI  RLQRHFCVFA+SFPGQE+L  IY+TIL++ L   + S ++ +  S LV  AL  H KI +TFLPTAIKFHYVFNLRDLSNIFQG+LF+  + +K P DLVRLW+HE ERVY DK++D+ D ET  R+    TKK F+++ + ++F KP ++CHFAQGIG+PKY+PV     L+K+L + L+SYNEVNA MNLVLFEDAVAHI RINRILESPRG ALLVGVGGSGKQSLSRLAA+IS LDVFQITL+KGYGI DLK+DLAA Y+KA VKN+  VFL+TD+Q+A+E+FLVL+NDLLASGEI  LF +DE+ENIISSMR +VKS GM D+RE CW FFI KVR  L+++LCFSPVGS LRVRARKFPAVVNCT+IDWFHEWPEDAL+SVS RFL+E E +P + K S + FMS+VH  VN++S  YL  ERRYNYTTPK+FLEQI LY N+L KK TEL  K+ RLENGL KL+STA QVDDLKAKLA QE EL+QKN SA++L++ V  + +KVS EK IAD EE KV  I   V++KQ+ CE DLAKAEPAL AAQEAL+TLNKNNLTE+KSFG+PP AV++V+AA M L A  GK+PKD+SWKAAK  +MGK+D FLD+L  ++K++IPE  LKA K Y  +P F+PE I+SKS AAAGLCSW INI+ +YE++CDV PKR ALE AN EL EA EKLS I+NKI +L   L  L   FEKA ++K +CQ EAD T + I LANRLVGGLASEN+RW + VE ++ +  TL GDVL+  AF+SYVG FTK YR  LM+ +W+P++ NL   IPIT  LDPL +L DDA +A+WNN+GLPSDRMS ENATIL N ERWPLI+D QLQGIKWIK ++ ++LK +RLGQK YLDVIEQA+S GD +LIENI E++DPVLD LLGRNTIKKG+ IK+GDKE EY+P+FRLIL TK  NPHYKPEMQAQ T+INF VTRDGLEDQLLA VV KER DLE LK +LTK QN+FKI LKELEDSLL RLSAA GNFLGD ALVENLE  K TA EIEEKV +AKITEV INE RE YRPAA RAS+LYFILNDLNKINP+YQFSLKAF VVFEKAI R  P+ E+K RV NL D IT+SVY+YT+RGLFE+DKLIF AQ++FQ+L   KE+NP ELDFLLRFP    + SP+DFL +  WGGIKALS ++EFKNLD DIEGSAKRWKK VESE PEKE FP+EWKNKT+LQ+LCM+R LRPDRMTYA+ +FV+EK+G K+VEG  VEFS+S+EES P+T IFFILSPGVDPLKDVE LGKKLGF+ DN    N+SLGQGQE+VAE A+D+ A++GHWV+LQNIHLV++WL  L+KKLE Y+  SHE YRVFISAEP+ SPE+HIIPQGILENAIKITNEPPTGM ANLHK+L+ F Q+T+EMC KE EFK +LFALCYFHAVV+ERRKFG QGWNRSYPFN GDL IS+NVLYNYLEAN KVPW+DLRYLFGEIMYGGHITDDWDR+LC+TYL EY++ EML+G++ + PGF++PPN DYKGYH YIDE LP ESPYLYGLHPNAEI FLT  S+KLF+TV EMQP+++     TG+SREE++K +LDDI+EK+P+ FNM EI AK    E+ PYVVVAFQECERMN+LT+E+RRSLKEL+LGLKGELTIT D+E LS +L+ D +P++W  RAYPS+ GLA WYADLLLRI+ELE WTTDF LP+ +WL G FNPQSFLTAIMQ MARKNEWPLD+M L  +VTKKN+EDM  PPR+G+YV+GLFMEGARWDTQ+G+IAEA+LKEL P+MPVIFIKAIPVDR + +N+Y CPVYKT+ RGPT+VWTFNLKTKEK +KW
Sbjct:    6 DVRLEYLEEVASIVLKFKPDKWSKLIGAEENVALFTEFFEKPDVQ-VLVLTLNAAGMIIPCLGFPQSLKSKGVYFIKTKSENINKDN-YRARLLYGDISPTPVDQLIAVVEEVLSSLLNQSENMAGWPQVVSEDIVKQVHRLKNEMFVMSGKIKGKTLLPIPEHLGS---LDGTLESMERIPSSLDNLLLHAIETTIIDWSHQIRDVLSKDSAQALLDGLHPLPQVEFEFWDTRLLNLKCIHEQLNRPKVNKIVEILEKAKSCYWPALQNVYTNVTEGLKEANDIVLYLKPLRILLEEMEQADFTMLPTFIAKVLDTICFIWATSEYYNTPARIIVILQEFCNQIIEMTRTFLSPEEVLKGLQGEIEEVLSGISLAVNVLKELYQTYDFCCVNMKLFFKD-KEPVPWEFPSSLAFSRINSFFQRIQTIEELYKTAIEFLKLEKIELGGVRGNLLGSLVTRIYDEVFELVKVFADCKYDPLDPGDSNFDRDYADFEIKIQDLDRRLATIFCQGFDDCSCIKSSAKLLYMCGGLMERPLILAEVAPRYSVMLELFDAELDNAKILYDAQMAASEEGNIPLIHKNMPPVAGQLKWSLELQERLEVSMKHLKHVEHPVMSGAEAKLTYQKYDEMMELLRCHREKIYQQWVAGVDQDCHFNLGQPLILRDAASNLIHVNFSKALVAVLREVKYLNFQQQKEIPDSAESLFSENETFRKFVGNLELIVGWYNEIKTIVKAVEFLLIKSELEAIDVKLLSAETTLFWNGE----GVFQYIQEVREILHNLQNRMQKAKQNIEGISQAMKDWSANPLFERKDNKKEALLDLDGRIANLNKRYAAVRDAGVKIQAMVAENAELFRADTLSLPWKDYVIYIDDMVLDEFDQFIRKSLSFLMDNMVIDESIAPLFEIRMELDEDGLTFNPTLEVGSDRGFLALIEGLVNDIYNVARLIPRLA--KDRMNYKMDLEDNTDLIEMREEVSSLVINAMKEAEEYQDSFERYSYLWTDNLQEFMKNFLIYGCAVTAEDLDTWTDDTIP---KTPPTLAQFQEQIDSYEKLYEEVSKCENTKVFHGWLQCDCRPFKQALLSTIRRWGFMFKRHLSNHVTNSLADLEAFMKVARMGLTKPLKEGDYDGLVEVMGHLMKVKERQAATDNMFEPLKQTIELLKTYGEEMPEEIHLKLQELPEHWANTKKLAIQVKLTVAPLQANEVSILRRKCQQFELKQHEFRERFRREAPFSFSDPNPYKSLNKQQKSISAMEGIMEALSKSGGLFEVPVPDYKQLKACHREVRLLKELWDMVVVVNTSIEDWKTTKWKDINVEQMDIDCKKFAKDMRSLDKEMKTWDAFVGLDNTVKNVITSLRAVSELQNPAIRERHWQQLMQATQVKFKMSEETTLADLLQLNLHSYEDEVRNIVDKAVKESGMEKVLKALDSTWSMMEFQHEPHPRTGTMMLKSSEVLVETLEDNQVQLQNLMMSKYLAHFLKEVTSWQQKLSTADSVISIWFEVQRTWSHLESIFIGSEDIRTQLPGDSQRFDDINQEFKALMEDAVKTPNVVEATSKPGLYNKLEALKKSLAICEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKLKFRLDASDKPLKVGLGMYSKEDEYMVFDQECDLSGQVEVWLNRVLDRMCSTLRHEIPEAVVTYEEKPREQWILDYPAQVALTCTQIWWTTEVGLAFARLEEGYENAIRDYNKKQISQLNVLITLLMGNLNAGDRMKIMTICTIDVHARDVVAKMIVAKVESSQAFTWQAQLRHRWDEEKRHCFANICDAQIQYSYEYLGNTPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDLGRALGTMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVIAVQVKCVQDAIRAKKKAFNFLGEIIGLIPTVGIFITMNPGYAGRAELPENLKALFRPCAMVVPDFELICEIMLMAEGFLEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPSRAEDQVLMRALRDFNIPKIVTDDLPVFMGLIGDLFPALDVPRKRDLNFEKIIKQSIVELKLQAEDSFVLKVVQLEELLQVRHSVFIVGNAGSGKSQVLKSLNKTYQNLKRKPVAVDLDPKAVTCDELFGIINPVTREWKDGLFSTIMRDLANITHDGPKWIILDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNRTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPVVSSWIERRKVQSEKANLMILFDKYLPTCLDKLRFGFKKITPVPEITVIQTILYLLECLLTEKTVPPDSPRELYELYFVFTCFWAFGGAMFQDQLVDYRVEFSKWWINEFKTIKFPSQGTIFDYYIDPDTKKFLPWTDKVPSFELDPDVPLQASLVHTTETIRIRYFMDLLMEKSWPVMLVGNAGTGKSVLMGDKLESLNTDNYLVQAVPFNFYTTSAMLQGVLEKPLEKKSGRNYGPPGTKKLVYFIDDMNMPEVDKYGTVAPHTLIRQHMDHRHWYDRHKLTLKDIHNCQYVACMNPTSGSFTIDSRLQRHFCVFAVSFPGQEALTTIYNTILTQHLAFRSVSMAIQRISSQLVAAALALHQKITATFLPTAIKFHYVFNLRDLSNIFQGLLFSTAEVLKTPLDLVRLWLHETERVYGDKMVDEKDQETLHRVTMASTKKFFDDLGDELLFAKPNIFCHFAQGIGDPKYVPVTDMAPLNKLLVDVLDSYNEVNAVMNLVLFEDAVAHICRINRILESPRGNALLVGVGGSGKQSLSRLAAYISGLDVFQITLKKGYGIPDLKIDLAAQYIKAAVKNVPSVFLMTDSQVAEEQFLVLINDLLASGEIPGLFMEDEVENIISSMRPQVKSLGMNDTRETCWKFFIEKVRRQLKVILCFSPVGSVLRVRARKFPAVVNCTAIDWFHEWPEDALVSVSARFLEETEGIPWEVKASISFFMSYVHTTVNEMSRVYLATERRYNYTTPKTFLEQIKLYQNLLAKKRTELVAKIERLENGLMKLQSTASQVDDLKAKLAIQEAELKQKNESADQLIQVVGIEAEKVSKEKAIADQEEVKVEVINKNVTEKQKACETDLAKAEPALLAAQEALDTLNKNNLTELKSFGSPPDAVVNVTAAVMILTAPGGKIPKDKSWKAAKI-MMGKVDTFLDSLKKFDKEHIPEACLKAFKPYQGNPTFDPEFIRSKSTAAAGLCSWCINIVRFYEVYCDVAPKRQALEEANAELAEAQEKLSRIKNKIAELNANLSNLTSAFEKATAEKIKCQQEADATNRVILLANRLVGGLASENIRWAESVENFRSQGVTLCGDVLLISAFVSYVGYFTKKYRNELMEKFWIPYIHNLKVPIPITNGLDPLSLLTDDADVATWNNQGLPSDRMSTENATILGNTERWPLIVDAQLQGIKWIKNKYRSELKAIRLGQKSYLDVIEQAISEGDTLLIENIGETVDPVLDPLLGRNTIKKGKYIKIGDKEVEYHPKFRLILHTKYFNPHYKPEMQAQCTLINFLVTRDGLEDQLLAAVVAKERPDLEQLKANLTKSQNEFKIVLKELEDSLLARLSAASGNFLGDTALVENLETTKHTASEIEEKVVEAKITEVKINEARENYRPAAERASLLYFILNDLNKINPVYQFSLKAFNVVFEKAIQRTTPANEVKQRVINLTDEITYSVYMYTARGLFERDKLIFLAQVTFQVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQGWGGIKALSEMDEFKNLDSDIEGSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCLRPDRMTYAIKNFVEEKMGSKFVEGRSVEFSKSYEESSPSTSIFFILSPGVDPLKDVEALGKKLGFTIDNGKLHNVSLGQGQEVVAENALDVAAEKGHWVILQNIHLVARWLGTLDKKLEHYSTGSHEDYRVFISAEPAPSPETHIIPQGILENAIKITNEPPTGMHANLHKALDLFTQDTLEMCTKEMEFKCMLFALCYFHAVVAERRKFGAQGWNRSYPFNNGDLTISINVLYNYLEANPKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLAEYIRTEMLEGDVLLAPGFQIPPNLDYKGYHEYIDENLPPESPYLYGLHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAGTGVSREEKVKAVLDDILEKIPETFNMAEIMAKAA--EKTPYVVVAFQECERMNILTNEMRRSLKELNLGLKGELTITTDVEDLSTALFYDTVPDTWVARAYPSMMGLAAWYADLLLRIRELEAWTTDFALPTTVWLAGFFNPQSFLTAIMQSMARKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQTGVIAEARLKELTPAMPVIFIKAIPVDRMETKNIYECPVYKTRIRGPTYVWTFNLKTKEKAAKW 4451          
BLAST of DNAHb-1 vs. Ensembl Human
Match: DNAH9 (dynein axonemal heavy chain 9 [Source:HGNC Symbol;Acc:HGNC:2953])

HSP 1 Score: 5528.76 bits (14341), Expect = 0.000e+0
Identity = 2774/4467 (62.10%), Postives = 3472/4467 (77.73%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFF--EKPEIQHLFVLQAPGGGALNLQNEFPTNLKS-----KACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINS---FGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKV--PKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIE--GSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSE--KLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMV-MFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            D+R   +G YV  SL+  +  + +   + E +Q++  F   +  E     ++  PG   L ++       +S     KA FF +   E    D+ F   ++ GD+   PL+  ++   EV+LPVL+N KN+ +WP +I  DV RH +SL+    V+L Q KGKTLLPLP GSEK+   D  S      + +S+IYAIE+ VI+W++Q+  VL ++SS+ L+ G NPTP VEL++WK+R  +L+ IY QL +  V+ MA LL+ + S+Y P FK +++ VVAAL E+Q+I+++L PL+  LE +E  EF E++P + PL HV+CLIWA CK YR P R+ VL QEI NL+I    +YL P+++ + E EE+  K++     L+ FK+ F+  RE +  YFK+  E  EW F S+L+F RL+ F+ ++ +V+ +L   L+F+KL KVE SG++G  LSQ +  M EEF+ +++  +  + DCL    TDF  D  +F   ++DLDRRL T   QAF D    +  FKL+DI G LL+RP++  +   +Y  L++M +++++  +++Y  HV    ++    +HKNMP V G L W +E+R+RI+ P +    + H   ++ E   + +K++++L LL+K+E + Y +W   V E   +NLSQPLL R+ +T  I++NF+ +L +VL+E+ YL+  + + +P++A  + S  D  R+ + NL+LM  WYN + K  L VE PL+E EL  ID +L  A   L W ++    G   Y+ ++   +H+L  R+ K+K+N++ I+ IM  W  +P+F+ K+GK ++LL+LDDR DR  K Y  I E+G ++H LV+EN  L  AD  S  WK YV++ID++++  F   I  SL+Y+++  E      P+FE  + L   E+VF PSL+      F ++V+ L+T IF+  S V RL+  +    Y+ DL+   +L   R  + ER +        YQ+ F +YS L+ ++R+E + QFL YG  ++ EE+E H E  I    E PP L QFK QID YE  +EE+ ++    + D W +ID R FK + LN IKRWSL+FKQHL+DHVT+SL  L  FIK + SGL K+  +GDF+GLVE+MGHL  VKERQ  TDEMFEPLKQTI+LLKTY QE+P+ V  QLEELPEKWNN KKVA+TVKQ VAPLQ  EV  +R++C  FD +Q  F EQF K  PF F  +  ++ LD +HIEI  +E  M  ++ESA+LFEV VP++KQL+QCRKE+  LK LWD I +V SSI  W+ T W++INVE M+ +CK FA+ IR+LDKE+R+WDA+TG+E  + N ++SLRAV ELQNPAIR+RHW QLM AT V F M++ TTL  LL+L LH++EDEVR IV+KA KEM MEK LKEL +TW+ MEF++E H RT + LL + E+LIE LE++QV+LQN++ SKY++ F +EV  WQK LST D VI IWFEVQRTW+HLESIF GS+DIR QLP+DS+RF+ ID DFK L  + ++  NVV+ T KP LYE+LE +Q  L LCEKALAEYL+TKRLAFPRFYF+SS+DLLDILSNG +P+ V +HL+KLFD++AK++F  +A  E TK  + MY+K+ E V F+  CD  GQVE WLN +L  M+ T+R  ++E V++ EEK R+QW+F+ PAQVAL+ +QI W TEV ++FARLEEGYE+A+KD+ KKQ+ QL  LIT+LIG+LSK DRQK+MTICTIDVH RDVV K+I QK+DN+Q+F WL QLRHRW D  K C+ NICDAQF Y++EYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGI+VYVFNCSEQMDYKS GNIYKGLAQ+G+WGCFDEFNRISVEVLSVVAVQVK IQDAI++K++ F FLGEEISL+ ++GIFITMNPGYAGRTELPENLK+LFRPCAMVVPDFELICEIMLVAEGF++A+ LARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DPDRPEDQVLMR+LRDFNIPKIVTDD P+FMGLIGDLFPALDVPR+RDP FE  VR+A +DLKLQAE+NFVLKVVQL+EL AVRHSVFV+G AGTGKS V ++L KTY  +K++P+  DLNPKAVTNDELFGIINP+T EWKDGLFS IMR+LAN+T DGPKWI+LDGDIDPMWIESLNTVMDDNKVLTLASNERIPL PTM+LLFEISHL+TATPATVSRAGILYINP DLGW P V+SWI  REIQ+E+ANLTILFDKY+P CL+ L+ RFKKI PI E S VQM+CHLLE LL  E+ PADCPKE YE YFVF AIWAFG  M QDQLVD+R EF+KWW+TEFKT+K P+QGT+FDYYID ETKKFEPW+K + +FE D E PLQA LV TSET R  YF++ L+ ++RPVMLVG AGTGK+VL+  KL S+  + Y+V NVPFN+YTTS MLQ VLEKPLEKKAGRNYGP G+KKLIYFIDDMNMPEVD Y TVQPHT+IRQH+DY HWYDR+KL+LKEI N QY++CMNPTAGSFTI+PRLQRHF VF LSFPG ++L +IYS IL++  KLG NF ASL K++  L+DLAL FH KI +TFLPT IKFHY+FNLRD +NIFQGILF+  +C+K   DL+RL++HE  RVY DK++++ D + + ++Q E+ KK F+++++ V   + P LYCHFA GIGEPKYMPV+  E L++ L EALE++NEVN  M+LVLFEDA+ H+  INRILESPRG ALLVGVGGSGKQSL+RLAAFISS+DVFQITLRKGY I D K+DLA+L +KAGVKN+  VFL+TDAQ+ADE+FLVL+NDLLASGEI DL+ DDE+ENIIS++RNEVKS G++D+RENCW FFI+++R  L++ LCFSPVG+ LRVR+RKFPA+VNCT+I WFHEWP+ AL SVS RFLQ  E +    K S +KFM+FVH +VN+ S SYL NE+RYNYTTPKSFLE I LY ++L +   EL+ K  RLENGL KL ST+ QVDDLKAKLAAQEVEL+QKN  A++L++ V  +T KVS EK +AD EE+KV+ I  EV +KQ+DCE DLAKAEPAL AAQ ALNTLNK NLTE+KSFG+PP AV +VSAA M LMA  G+VPKDRSWKAAK   M K+D FLD+LIN+NK+NI E  LKA + Y +DP FNPE + +KS AAAGLCSWVINI+ +YE+FCDV+PKR AL  A  +L  A EKL+ I+ KI  L + L KL   FEKA +DK +CQ EA++T  TI LANRLVGGLASENVRW   V+ +K +E+TL GD+L+  AF+SY+G FTK YR +L+D  W P+L+ L   IP+T  LDPL+ML+DDA +A+W NEGLP+DRMS+ENATIL N ERWPL++DPQLQGIKWIK ++G DL+V ++GQKGYL +IEQA+ AG VVLIEN+EES+DPVL  LLGR  IKKGR IK+GDKECEYNP+FRLIL TKLANPHY+PE+QAQ T+INFTVTRDGLEDQLLA VV+ ER DLE LK DLTKQQN FKITLK LEDSLL RLS+A GNFLG+  LVENLE  K+TA E+E+KV++AK+TEV INE RE YRPAAARAS+LYFI+NDL+KI+PMYQFSLKAF +VF+KA++RA P E L+ RV NLIDSITFSVY YT RGLFE DKL + AQ++FQILL  +E+N  ELDFLLR P+     SP++FLS+ +WG +K LS++EEF NLDRDIEGSAK WKKFVESE PEKEK PQEWKNKT+LQRLCM+RA+RPDRMTYA+ DFV+EKLG KYV G  ++F+ SFEESGPATP+FFILSPGVDPLKDVE+ G+KLG++ +N+NF N+SLGQGQE+VAE A+DL AK+GHWV+LQNIHLV+KWLS LEKKLEE++E SH  +RVF+SAEP+ SPE HIIPQGILEN+IKITNEPPTGM ANLHK+L+NF Q+T+EMC++E EFK+ILFALCYFHAVV+ERRKFGPQGWNRSYPFNTGDL ISVNVLYN+LEAN+KVP++DLRYLFGEIMYGGHITDDWDR+LC+TYL E+++PEML+GEL++ PGF +P N DY GYH YID  LP ESPYLYGLHPNAEI FLT  S+KLF+TV E+QPRDS      G +REE++K +L++I+E++ D+FN+ E+ AKV  EER PY+VVAFQEC RMN+LT EI+RSL+EL+LGLKGELT+T+ ME L N+LY D++PESW++RAYPS  GLA W+ DLL RIKELE WT DF +PS +WL G FNPQSFLTAIMQ  ARKNEWPLD+MALQCD+TKKN+E+   PPR+GAY+HGLFMEGA WDTQ+G+I EAKLK+L P MPV+FIKAIP D+QD R+VY+CPVYKT +RGPT+VWTFNLKTKE PSKW
Sbjct:   22 DRRLRLLGTYVAMSLRPAAGAWERCAGSAEAEQLLQAFLGRDAAEGPRPLLVVRPGPRGLAIRPGLEVGPESGLAGAKALFFLRTGPEPPGPDS-FRGAVVCGDLPAAPLEHLAALFSEVVLPVLANEKNRLNWPHMICEDVRRHAHSLQCDLSVILEQVKGKTLLPLPAGSEKMEFADSKSETVLDSIDKSVIYAIESAVIKWSYQVQVVLKRESSQPLLQGENPTPKVELEFWKSRYEDLKYIYNQLRTITVRGMAKLLDKLQSSYFPAFKAMYRDVVAALAEAQDIHVHLIPLQRHLEALENAEFPEVKPQLRPLLHVVCLIWATCKSYRSPGRLTVLLQEICNLLIQQASNYLSPEDLLRSEVEESQRKLQVVSDTLSFFKQEFQDRRENLHTYFKENQEVKEWDFQSSLVFVRLDGFLGQLHVVEGLLKTALDFHKLGKVEFSGVRGNALSQQVQQMHEEFQEMYRLLSGSSSDCLYLQSTDFENDVSEFNQKVEDLDRRLGTIFIQAFDDAPGLEHAFKLLDIAGNLLERPLVARDTSDKYLVLIQMFNKDLDAVRMIYSQHVQEEAELGFSPVHKNMPTVAGGLRWAQELRQRIQGPFSNFGRITHPCMESAEGKRMQQKYEDMLSLLEKYETRLYEDWCRTVSEKSQYNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLLEVEFPLVEEELQNIDLRLRAAEETLNWKTE----GICDYVTEITSSIHDLEQRIQKTKDNVEEIQNIMKTW-VTPIFKTKDGKRESLLSLDDRHDRMEKYYNLIKESGLKIHALVQENLGLFSADPTSNIWKTYVNSIDNLLLNGFFLAIECSLKYLLENTECKAGLTPIFEAQLSLAIPELVFYPSLESGVKGGFCDIVEGLITSIFRIPSLVPRLSPQNGSPHYQVDLDGIPDLANMRRTLMERVQRMMGLCCGYQSTFSQYSYLYVEDRKEVLGQFLLYGHILTPEEIEDHVEDGIP---ENPPLLSQFKVQIDSYETLYEEVCRLEPIKVFDGWMKIDIRPFKASLLNIIKRWSLLFKQHLVDHVTHSLANLDAFIKKSESGLLKKVEKGDFQGLVEIMGHLMAVKERQSNTDEMFEPLKQTIELLKTYEQELPETVFKQLEELPEKWNNIKKVAITVKQQVAPLQANEVTLLRQRCTAFDAEQQQFWEQFHKEAPFRFDSIHPHQMLDARHIEIQQMESTMASISESASLFEVNVPDYKQLRQCRKEVCQLKELWDTIGMVTSSIHAWETTPWRNINVEAMELECKQFARHIRNLDKEVRAWDAFTGLESTVWNTLSSLRAVAELQNPAIRERHWRQLMQATGVSFTMDQDTTLAHLLQLQLHHYEDEVRGIVDKAAKEMGMEKTLKELQTTWAGMEFQYEPHPRTNVPLLCSDEDLIEVLEDNQVQLQNLVMSKYVAFFLEEVSGWQKKLSTVDAVISIWFEVQRTWTHLESIFTGSEDIRAQLPQDSKRFEGIDIDFKELAYDAQKIPNVVQTTNKPGLYEKLEDIQGRLCLCEKALAEYLDTKRLAFPRFYFLSSSDLLDILSNGTAPQQVQRHLSKLFDNMAKMRFQLDASGEPTKTSLGMYSKEEEYVAFSEPCDCSGQVEIWLNHVLGHMKATVRHEMTEGVTAYEEKPREQWLFDHPAQVALTCTQIWWTTEVGMAFARLEEGYESAMKDYYKKQVAQLKTLITMLIGQLSKGDRQKIMTICTIDVHARDVVAKMIAQKVDNAQAFLWLSQLRHRWDDEVKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGILVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKQWFSFLGEEISLNPSVGIFITMNPGYAGRTELPENLKSLFRPCAMVVPDFELICEIMLVAEGFIEAQSLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPDRPEDQVLMRSLRDFNIPKIVTDDMPIFMGLIGDLFPALDVPRRRDPNFEALVRKAIVDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGGAGTGKSQVLRSLHKTYQIMKRRPVWTDLNPKAVTNDELFGIINPATGEWKDGLFSSIMRELANITHDGPKWILLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMKLLFEISHLRTATPATVSRAGILYINPADLGWNPPVSSWIEKREIQTERANLTILFDKYLPTCLDTLRTRFKKIIPIPEQSMVQMVCHLLECLLTTEDIPADCPKEIYEHYFVFAAIWAFGGAMVQDQLVDYRAEFSKWWLTEFKTVKFPSQGTIFDYYIDPETKKFEPWSKLVPQFEFDPEMPLQACLVHTSETIRVCYFMERLMARQRPVMLVGTAGTGKSVLVGAKLASLDPEAYLVKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGNKKLIYFIDDMNMPEVDAYGTVQPHTIIRQHLDYGHWYDRSKLSLKEITNVQYVSCMNPTAGSFTINPRLQRHFSVFVLSFPGADALSSIYSIILTQHLKLG-NFPASLQKSIPPLIDLALAFHQKIATTFLPTGIKFHYIFNLRDFANIFQGILFSSVECVKSTWDLIRLYLHESNRVYRDKMVEEKDFDLFDKIQTEVLKKTFDDIEDPVEQTQSPNLYCHFANGIGEPKYMPVQSWELLTQTLVEALENHNEVNTVMDLVLFEDAMRHVCHINRILESPRGNALLVGVGGSGKQSLTRLAAFISSMDVFQITLRKGYQIQDFKMDLASLCLKAGVKNLNTVFLMTDAQVADERFLVLINDLLASGEIPDLYSDDEVENIISNVRNEVKSQGLVDNRENCWKFFIDRIRRQLKVTLCFSPVGNKLRVRSRKFPAIVNCTAIHWFHEWPQQALESVSLRFLQNTEGIEPTVKQSISKFMAFVHTSVNQTSQSYLSNEQRYNYTTPKSFLEFIRLYQSLLHRHRKELKCKTERLENGLLKLHSTSAQVDDLKAKLAAQEVELKQKNEDADKLIQVVGVETDKVSREKAMADEEEQKVAVIMLEVKQKQKDCEEDLAKAEPALTAAQAALNTLNKTNLTELKSFGSPPLAVSNVSAAVMVLMAPRGRVPKDRSWKAAKV-TMAKVDGFLDSLINFNKENIHENCLKAIRPYLQDPEFNPEFVATKSYAAAGLCSWVINIVRFYEVFCDVEPKRQALNKATADLTAAQEKLAAIKAKIAHLNENLAKLTARFEKATADKLKCQQEAEVTAVTISLANRLVGGLASENVRWADAVQNFKQQERTLCGDILLITAFISYLGFFTKKYRQSLLDRTWRPYLSQLKTPIPVTPALDPLRMLMDDADVAAWQNEGLPADRMSVENATILINCERWPLMVDPQLQGIKWIKNKYGEDLRVTQIGQKGYLQIIEQALEAGAVVLIENLEESIDPVLGPLLGREVIKKGRFIKIGDKECEYNPKFRLILHTKLANPHYQPELQAQATLINFTVTRDGLEDQLLAAVVSMERPDLEQLKSDLTKQQNGFKITLKTLEDSLLSRLSSASGNFLGETVLVENLEITKQTAAEVEKKVQEAKVTEVKINEAREHYRPAAARASLLYFIMNDLSKIHPMYQFSLKAFSIVFQKAVERAAPDESLRERVANLIDSITFSVYQYTIRGLFECDKLTYLAQLTFQILLMNREVNAVELDFLLRSPVQTGTASPVEFLSHQAWGAVKVLSSMEEFSNLDRDIEGSAKSWKKFVESECPEKEKLPQEWKNKTALQRLCMLRAMRPDRMTYALRDFVEEKLGSKYVVGRALDFATSFEESGPATPMFFILSPGVDPLKDVESQGRKLGYTFNNQNFHNVSLGQGQEVVAEAALDLAAKKGHWVILQNIHLVAKWLSTLEKKLEEHSENSHPEFRVFMSAEPAPSPEGHIIPQGILENSIKITNEPPTGMHANLHKALDNFTQDTLEMCSRETEFKSILFALCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNFLEANAKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLGEFIRPEMLEGELSLAPGFPLPGNMDYNGYHQYIDAELPPESPYLYGLHPNAEIGFLTQTSEKLFRTVLELQPRDSQARDGAGATREEKVKALLEEILERVTDEFNIPELMAKV--EERTPYIVVAFQECGRMNILTREIQRSLRELELGLKGELTMTSHMENLQNALYFDMVPESWARRAYPSTAGLAAWFPDLLNRIKELEAWTGDFTMPSTVWLTGFFNPQSFLTAIMQSTARKNEWPLDQMALQCDMTKKNREEFRSPPREGAYIHGLFMEGACWDTQAGIITEAKLKDLTPPMPVMFIKAIPADKQDCRSVYSCPVYKTSQRGPTYVWTFNLKTKENPSKW 4475          
BLAST of DNAHb-1 vs. Ensembl Human
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:HGNC Symbol;Acc:HGNC:2942])

HSP 1 Score: 5121.6 bits (13284), Expect = 0.000e+0
Identity = 2590/4466 (57.99%), Postives = 3308/4466 (74.07%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGEVP---RSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKI-HKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGS--KDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDG---------LFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKE-YCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            D R  F+G  +   L    +K+ +   +++ +Q++ +F E      L V      G L    E P +   K  F +KK  ESI  +  F++V++FG++    L   S+F+DE+++PVLSN  N +SW    S D+  H   +K +  +  G+   +TLLP+P  + K+      S  + P   R I++AIE+VVIEW+HQI +++ + S ++L+ GL+ +P  ELD+W  R  NL CIY+QL +P V KM  +L    S+Y P  K IF +V  AL E+Q++ LYL PLR  ++ +++ EF +   +I PLFH +CLIW+H K Y  P R++VL QE  NL IN   +YL P+++ +GE EE+LEKV+ ++ IL  FK SF ++R+K+  YF  G +   W F S+L+F R + F+ R+  ++ I   TLEF KLE++E  G KG  L+  + +M EE   + K F + TYD  D    +F  DY  FK+   + DRRL T + +AF +C+  +A FKL+ IFG  L++P++   F   Y  LV M + E++  K +Y+ H+   E    + +KNMP  +G ++W +++ +R++   +  + L +      +  LV +K+ E+  LL + E + YN W + VDE C FNL+QPL+  +     + VNFD KL AVLREVKYL +L +++IP SA  I  K +T+ KYI NLDL+V+ YN L++  L VE PLIE+EL  IDEQL  A T L W  D      W YIE+VR     L  RV ++++N+  I+  M  W +  L  R+E + +    L+D+ D   K+YK I   G ++H LV+EN +L KA+   + WK YV+ IDD++VE F + I + L + +   E      P F+  M L   EIVF+PSLDR+  D F +LV+ ++ + F+ ++++ R+A    +++Y+ D++    L + R EI  R      K   ++   + ++ LW D+R EFM  FL YG A+S++E++AH  ++I    E+PPTL+QFK QID YE  + ++ K   F + D WF++D + FK + L  IK+WS MF++HL+  V +SL EL EFIK T+SGL +E  EGD +GLV++M HL  V+ RQ+ATDE+FEPLK+TI LL++Y Q+MP++V++QLEELPE+W  TKK+A TV+  V+PL N EV  IR+KC  FD KQ  FRE+FR   P  F+    Y  LD+ + E+  LE+ M ++ ES  LFEV +PE+KQ+KQCRKE++LLK LWD I  V  SI+ W KT W+ I+VEQMD + + FAK I SL+KE+R WDAYTG+E  +K+M  SLRA+ ELQ+PA+RDRHW QLM A  VKF +NE+TTL DLL L LH  ED+VR IV+KAVKE+  EKV+ E+  TW+ M+F +E H RTGI LLK+ E+L ETLE +QV+LQ ++ SKY+ +F ++V SWQ  L+ AD VI  W EVQRTWSHLESIF+ S+DIR QL +D+ RFD +D +FK L+ +  +  NV++AT +P LYE+L+ +QS L LCEKALAEYLETKR+AFPRFYFVSSADLLDILS G  P+ V  HL KLFDS+A L+F    +    +  V MY+K+ E V F   C+  G VETWL +L + M+ T+R  ++E++ + EEK R+ WIF+FPAQVAL+SSQI W T+V ++F+RLEEGYE ALKDF+KKQI+QLN LITLL+GEL   DRQK+MTICTIDVH RDVV KLI+QK+ + Q+FTWL QLRHRW DT K C++NICDAQF+Y +EYLGN+PRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALG+MVYVFNCSEQMDYKSIGNIYKGL Q+G+WGCFDEFNRISVEVLSVVAVQVK I DAI+N++KRF FLGE I+L  ++GIFITMNPGYAGRTELPENLKALFRPCAMV PD ELICEI+LVAEGF+ AR LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR D +RPEDQVLMRALRDFN+PKIVTDD PVF+GL+GDLFPALDVPR+R   FE+ VRQ+TL+L+LQ EE+F+LKVVQL+EL AVRHSVFV+GNAGTGKS + +TL +TY N+K+KP+  DLNPKAVT DELFG I+ +TREWKDG         LFS I+R+ ANL  DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI LTP MRLLFEI HL++ATPATVSRAGILY+NPQDLGW P+V SWI  R  QSE+ANLTILFDKYVP CL+ L+  FK IT I E S VQ LC LLE LL PEN P+D PKE YE+YFVF  IWAFG  + QDQ+ D++ +F++WW  E K +K P+QGT+FDYY+D +TKK  PW  ++ +F MD + PLQ VLV T+ET R RYF++LL+EK +P+MLVG AG GKTV + D L S+ ++Y+V+ VPFN+YTTS  LQ++LEKPLEKKAG NYGP G+KKLIYFIDDMNMPEVD Y TVQPHTLIRQHIDY HWYDR K+ LKEIHN QY+ACMNP  GSFTI+PRLQRHF VFA +FP  ++L  IY  I S       F+ S+L++   L+   + FH  +   FLPTAIKFHY+FNLRDLSN+FQGILFA P+C+K P DL+ LW+HE  RVY DKLID  D + +QR   E   K FE +D  ++ ++PL+YCHFA    +P YMPV+  E L  IL E L++YNE+NAAM+LVLFEDA+ H+ RI+RIL +P+G ALLVGVGGSGKQSLSRLAA++  L+VFQITL +GYGI +L++DLA LY++ G KN+  VFLLTDAQ+ DE FLVL+NDLLASGEI DLF D++++ IIS + NEV + GM+DSRENCW FF+ +VR  L+++LCFSPVG TLRVRARKFPA+VNCT+IDWFH WP++AL+SVS RF++E + +   +KDS + FM+ VH  VN++S  Y QNERR+NYTTPKSFLEQI+L+ N+LKKK  E+  K  RL NG+QKL++TA QV DLKA+LA+QE EL+ +N  A  L+ K+   T+KVS EK IAD EE KV+ I+ EV +KQ++CE DL KAEPAL AA  ALNTLN+ NL+E+K+F  PP AV +V+AA M L+A  G+VPKDRSWKAAK   MGK+D FL  LINY+K++IPE  LK   E Y KDP FNP  I++KS AAAGLC+WVINII +YE++CDV+PKR AL  AN EL  ATEKL  I+ K+  L+  L +L   FEKA ++K RCQ+E + T KTI+LANRLV  L ++ +RWG+ ++ ++ +EKTL GDVL+T AF+SYVG FT+ YR  L+   W+PFL     I P+T+ LD + ML DDA IA+WNNEGLPSDRMS ENA ILT+ ERWPL+IDPQ QGIKWIK ++G DLKV  LGQKG+L+ IE A++ GDV+LIEN+EE++DPVLD LLGRNTIKKG+ I++GDKECE+N  FRLIL TKLANPHYKPE+QAQTT++NFTVT DGLE QLLA VV+ ER DLE LKL LTK QN FKI LK LED LL RLSAAEG+FL D  LVE LE  K T  EIE KV +AK  E  INE RE YRP AARAS+LYF++NDL KINP+YQFSLKAF V+F +AI++A+  E+++GR+  L++SIT +V+LYTS+ LFEKDKL F +QM+FQILL  KEI+P ELDFLLRF +     SP+DFL++ SW  IKA++ +EEF+ +DRD+EGSAK+W+K+VESE PEKEK PQEWK K+ +Q+L ++RA+RPDRMTYA+ +FV+EKLG KYVE   ++  ++FEES PATPIFFILSPGVD LKD+E LGK+LGF+ D+  F N+SLGQGQE VAE A++  +K GHWV+LQN+HLV+KWL  LEK LE +++ SH  YRVF+SAE + +P+ HIIPQG+LEN+IKITNEPPTGMLANLH +L NF+Q+T+E+C+KE EFK+ILF+LCYFHA V+ R +FGPQGW+RSYPFN GDL I  +VLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLC+ YLEE++ P + + EL + PGF  PP  DY GYH YI+E LP ESP LYGLHPNAEIEFLT  S+ LF+T+ EMQPR++      G S EE++K +LDDI+EKLP++FNM EI  K     R+PYV+V FQECERMN+L  EIR SL++LDL LKGEL ++  +EA   +L  D +P++WSK AYPS YGLA W+ DLLLR +EL+ WT D  LP+V+WL G FNPQSFLTAIMQ MARKNEWPLD+  L  DVTKK KED G PPR+GAY+HGLFMEGARWDTQ+G I EA+LKEL   MPVIF KA PVDRQ+ +  Y CPVY+TK RGP+++WTF LK++EK +KW
Sbjct:   56 DARVRFLGGRLAMMLGFTEEKWSQYLESEDNRQVLGEFLESTSPACL-VFSFAASGRLAASQEIPRDANHKLVFISKKITESIGVND-FSQVVLFGELPALSLGHVSAFLDEILVPVLSNKNNHKSWSCFTSQDMEYHIEVMKKKMYIFRGKMSRRTLLPIPTVAGKMDLDQNCSENKPPSNERIILHAIESVVIEWSHQIQEIIERDSVQRLLNGLHLSPQAELDFWMMRRENLSCIYDQLQAPVVLKMVKILTTKQSSYFPTLKDIFLAVENALLEAQDVELYLRPLRRHIQCLQETEFPQTRILIAPLFHTICLIWSHSKFYNTPARVIVLLQEFCNLFINQATAYLSPEDLLRGEIEESLEKVQVAVNILKTFKNSFFNYRKKLASYFM-GRKLRPWDFQSHLVFCRFDKFLDRLIKIEDIFATTLEFEKLERLEFGGTKGAILNGQVHEMSEELMELCKLFKQSTYDPSDCTNMEFESDYVAFKSKTLEFDRRLGTIICEAFFNCNGLEAAFKLLTIFGNFLEKPVVMEIFSLHYSTLVHMFNTELDVCKQLYNEHMKQIECGHVVLNKNMPFTSGNMKWAQQVLQRLQMFWSNFASLRYLFLGNPDHALVYQKYVEMTTLLDQFESRIYNEWKSNVDEICEFNLNQPLVKFSAINGLLCVNFDPKLVAVLREVKYLLMLKKQDIPDSALAIFKKRNTILKYIGNLDLLVQGYNKLKQTLLEVEYPLIEDELRAIDEQLTAATTWLTWQDDC-----WGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNLVEENRKLFKANPSLDTWKIYVEFIDDIVVEGFFQAIMHDLDFFLKNTEKQLKPAPFFQAQMILLPPEIVFKPSLDREAGDGFYDLVEEMLCNSFRMSAQMNRIATHLEIKNYQNDMDNMLGLAEVRQEIMNRVVNVINKVLDFRNTLETHTYLWVDDRAEFMKHFLLYGHAVSSDEMDAHANEEIP---EQPPTLEQFKEQIDIYEALYVQMSKFEDFRVFDSWFKVDMKPFKVSLLTIIKKWSWMFQEHLLRFVIDSLNELQEFIKETDSGLQRELNEGDHDGLVDIMVHLLAVRSRQRATDELFEPLKETITLLESYGQKMPEQVYIQLEELPERWETTKKIAATVRHEVSPLHNAEVTLIRKKCILFDAKQAEFRERFRHYAPLGFNAENPYTALDKANEELEALEEEMLQMQESTRLFEVALPEYKQMKQCRKEIKLLKGLWDVIIYVRRSIDNWTKTQWRQIHVEQMDVELRRFAKEIWSLNKEVRVWDAYTGLEGTVKDMTASLRAITELQSPALRDRHWHQLMKAIGVKFLINEATTLADLLALRLHRVEDDVRRIVDKAVKELGTEKVITEISQTWATMKFSYEVHYRTGIPLLKSDEQLFETLEHNQVQLQTLLQSKYVEYFIEQVLSWQNKLNIADLVIFTWMEVQRTWSHLESIFVCSEDIRIQLVKDARRFDGVDAEFKELMFKTAKVENVLEATCRPNLYEKLKDLQSRLSLCEKALAEYLETKRIAFPRFYFVSSADLLDILSKGAQPKQVTCHLAKLFDSIADLQFEDNQDVSAHR-AVGMYSKEKEYVPFQAECECVGHVETWLLQLEQTMQETVRHSITEAIVAYEEKPRELWIFDFPAQVALTSSQIWWTTDVGIAFSRLEEGYETALKDFHKKQISQLNTLITLLLGELPPGDRQKIMTICTIDVHARDVVAKLISQKVVSPQAFTWLSQLRHRWEDTQKHCFVNICDAQFQYFYEYLGNSPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGNIYKGLVQTGAWGCFDEFNRISVEVLSVVAVQVKMIHDAIRNRKKRFVFLGEAITLKPSVGIFITMNPGYAGRTELPENLKALFRPCAMVAPDIELICEILLVAEGFVDARALARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVLMRALRDFNMPKIVTDDIPVFLGLVGDLFPALDVPRRRKLHFEQMVRQSTLELRLQPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKILRTLNRTYVNMKQKPVWNDLNPKAVTTDELFGFIHHATREWKDGKIVYSYFIGLFSSILREQANLKHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPFMRLLFEIHHLRSATPATVSRAGILYVNPQDLGWNPYVASWIDRRRHQSEKANLTILFDKYVPACLDKLRTSFKTITSIPESSLVQTLCVLLECLLTPENVPSDSPKEVYEVYFVFACIWAFGGTLLQDQISDYQADFSRWWQKEMKAVKFPSQGTIFDYYVDHKTKKLLPWADKIAQFTMDPDVPLQTVLVHTTETARLRYFMELLLEKGKPLMLVGNAGVGKTVFVGDTLASLSEDYIVSRVPFNYYTTSTALQKILEKPLEKKAGHNYGPGGNKKLIYFIDDMNMPEVDLYGTVQPHTLIRQHIDYGHWYDRQKVMLKEIHNCQYVACMNPMVGSFTINPRLQRHFTVFAFNFPSLDALNTIYGQIFSFHFQQQAFAPSILRSGPTLIQATIAFHQTMMCNFLPTAIKFHYIFNLRDLSNVFQGILFASPECLKGPLDLIHLWLHESARVYGDKLIDKKDCDLFQRRMLETAYKYFEGIDSHMLLQQPLIYCHFADRGKDPHYMPVKDWEVLKTILTETLDNYNELNAAMHLVLFEDAMQHVCRISRILRTPQGCALLVGVGGSGKQSLSRLAAYLRGLEVFQITLTEGYGIQELRVDLANLYIRTGAKNMPTVFLLTDAQVLDESFLVLINDLLASGEIPDLFSDEDVDKIISGIHNEVHALGMVDSRENCWKFFMARVRLQLKIILCFSPVGRTLRVRARKFPAIVNCTAIDWFHAWPQEALVSVSRRFIEETKGIEPVHKDSISLFMAHVHTTVNEMSTRYYQNERRHNYTTPKSFLEQISLFKNLLKKKQNEVSEKKERLVNGIQKLKTTASQVGDLKARLASQEAELQLRNHDAEALITKIGLQTEKVSREKTIADAEERKVTAIQTEVFQKQRECEADLLKAEPALVAATAALNTLNRVNLSELKAFPNPPIAVTNVTAAVMVLLAPRGRVPKDRSWKAAKV-FMGKVDDFLQALINYDKEHIPENCLKVVNEHYLKDPEFNPNLIRTKSFAAAGLCAWVINIIKFYEVYCDVEPKRQALAQANLELAAATEKLEAIRKKLVDLDRNLSRLTASFEKATAEKVRCQEEVNQTNKTIKLANRLVKELEAKKIRWGQSIKSFEAQEKTLCGDVLLTAAFVSYVGPFTRQYRQELVHCKWVPFLQQKVSI-PLTEGLDLISMLTDDATIAAWNNEGLPSDRMSTENAAILTHCERWPLVIDPQQQGIKWIKNKYGMDLKVTHLGQKGFLNAIETALAFGDVILIENLEETIDPVLDPLLGRNTIKKGKYIRIGDKECEFNKNFRLILHTKLANPHYKPELQAQTTLLNFTVTEDGLEAQLLAEVVSIERPDLEKLKLVLTKHQNDFKIELKYLEDDLLLRLSAAEGSFLDDTKLVERLEATKTTVAEIEHKVIEAKENERKINEARECYRPVAARASLLYFVINDLQKINPLYQFSLKAFNVLFHRAIEQADKVEDMQGRISILMESITHAVFLYTSQALFEKDKLTFLSQMAFQILLRKKEIDPLELDFLLRFTVEHTHLSPVDFLTSQSWSAIKAIAVMEEFRGIDRDVEGSAKQWRKWVESECPEKEKLPQEWKKKSLIQKLILLRAMRPDRMTYALRNFVEEKLGAKYVERTRLDLVKAFEESSPATPIFFILSPGVDALKDLEILGKRLGFTIDSGKFHNVSLGQGQETVAEVALEKASKGGHWVILQNVHLVAKWLGTLEKLLERFSQGSHRDYRVFMSAESAPTPDEHIIPQGLLENSIKITNEPPTGMLANLHAALYNFDQDTLEICSKEQEFKSILFSLCYFHACVAGRLRFGPQGWSRSYPFNPGDLTICASVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCRVYLEEFMNPSLTEDELMLAPGFAAPPYLDYAGYHQYIEEMLPPESPALYGLHPNAEIEFLTVTSNTLFRTLLEMQPRNALSGDELGQSTEEKVKNVLDDILEKLPEEFNMAEIMQK--NSNRSPYVLVCFQECERMNILIREIRISLEQLDLSLKGELALSPAVEAQQFALSYDTVPDTWSKLAYPSTYGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGFFNPQSFLTAIMQTMARKNEWPLDKTRLTADVTKKTKEDYGHPPREGAYLHGLFMEGARWDTQAGTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPVYRTKLRGPSYIWTFRLKSEEKTAKW 4505          
BLAST of DNAHb-1 vs. Ensembl Human
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:HGNC Symbol;Acc:HGNC:2942])

HSP 1 Score: 5112.35 bits (13260), Expect = 0.000e+0
Identity = 2590/4473 (57.90%), Postives = 3309/4473 (73.98%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGEVP---RSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKI-HKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGS--KDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKS-----IRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQK--IDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDG---------LFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKE-YCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            D R  F+G  +   L    +K+ +   +++ +Q++ +F E      L V      G L    E P +   K  F +KK  ESI  +  F++V++FG++    L   S+F+DE+++PVLSN  N +SW    S D+  H   +K +  +  G+   +TLLP+P  + K+      S  + P   R I++AIE+VVIEW+HQI +++ + S ++L+ GL+ +P  ELD+W  R  NL CIY+QL +P V KM  +L    S+Y P  K IF +V  AL E+Q++ LYL PLR  ++ +++ EF +   +I PLFH +CLIW+H K Y  P R++VL QE  NL IN   +YL P+++ +GE EE+LEKV+ ++ IL  FK SF ++R+K+  YF  G +   W F S+L+F R + F+ R+  ++ I   TLEF KLE++E  G KG  L+  + +M EE   + K F + TYD  D    +F  DY  FK+   + DRRL T + +AF +C+  +A FKL+ IFG  L++P++   F   Y  LV M + E++  K +Y+ H+   E    + +KNMP  +G ++W +++ +R++   +  + L +      +  LV +K+ E+  LL + E + YN W + VDE C FNL+QPL+  +     + VNFD KL AVLREVKYL +L +++IP SA  I  K +T+ KYI NLDL+V+ YN L++  L VE PLIE+EL  IDEQL  A T L W  D      W YIE+VR     L  RV ++++N+  I+  M  W +  L  R+E + +    L+D+ D   K+YK I   G ++H LV+EN +L KA+   + WK YV+ IDD++VE F + I + L + +   E      P F+  M L   EIVF+PSLDR+  D F +LV+ ++ + F+ ++++ R+A    +++Y+ D++    L + R EI  R      K   ++   + ++ LW D+R EFM  FL YG A+S++E++AH  ++I    E+PPTL+QFK QID YE  + ++ K   F + D WF++D + FK + L  IK+WS MF++HL+  V +SL EL EFIK T+SGL +E  EGD +GLV++M HL  V+ RQ+ATDE+FEPLK+TI LL++Y Q+MP++V++QLEELPE+W  TKK+A TV+  V+PL N EV  IR+KC  FD KQ  FRE+FR   P  F+    Y  LD+ + E+  LE+ M ++ ES  LFEV +PE+KQ+KQCRKE++LLK LWD I  V  SI+ W KT W+ I+VEQMD + + FAK+     I SL+KE+R WDAYTG+E  +K+M  SLRA+ ELQ+PA+RDRHW QLM A  VKF +NE+TTL DLL L LH  ED+VR IV+KAVKE+  EKV+ E+  TW+ M+F +E H RTGI LLK+ E+L ETLE +QV+LQ ++ SKY+ +F ++V SWQ  L+ AD VI  W EVQRTWSHLESIF+ S+DIR QL +D+ RFD +D +FK L+ +  +  NV++AT +P LYE+L+ +QS L LCEKALAEYLETKR+AFPRFYFVSSADLLDILS G  P+ V  HL KLFDS+A L+F    +    +  V MY+K+ E V F   C+  G VETWL +L + M+ T+R  ++E++ + EEK R+ WIF+FPAQVAL+SSQI W T+V ++F+RLEEGYE ALKDF+KKQI+QLN LITLL+GEL   DRQK+MTICTIDVH RDVV KLI+QK  + + Q+FTWL QLRHRW DT K C++NICDAQF+Y +EYLGN+PRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALG+MVYVFNCSEQMDYKSIGNIYKGL Q+G+WGCFDEFNRISVEVLSVVAVQVK I DAI+N++KRF FLGE I+L  ++GIFITMNPGYAGRTELPENLKALFRPCAMV PD ELICEI+LVAEGF+ AR LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR D +RPEDQVLMRALRDFN+PKIVTDD PVF+GL+GDLFPALDVPR+R   FE+ VRQ+TL+L+LQ EE+F+LKVVQL+EL AVRHSVFV+GNAGTGKS + +TL +TY N+K+KP+  DLNPKAVT DELFG I+ +TREWKDG         LFS I+R+ ANL  DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI LTP MRLLFEI HL++ATPATVSRAGILY+NPQDLGW P+V SWI  R  QSE+ANLTILFDKYVP CL+ L+  FK IT I E S VQ LC LLE LL PEN P+D PKE YE+YFVF  IWAFG  + QDQ+ D++ +F++WW  E K +K P+QGT+FDYY+D +TKK  PW  ++ +F MD + PLQ VLV T+ET R RYF++LL+EK +P+MLVG AG GKTV + D L S+ ++Y+V+ VPFN+YTTS  LQ++LEKPLEKKAG NYGP G+KKLIYFIDDMNMPEVD Y TVQPHTLIRQHIDY HWYDR K+ LKEIHN QY+ACMNP  GSFTI+PRLQRHF VFA +FP  ++L  IY  I S       F+ S+L++   L+   + FH  +   FLPTAIKFHY+FNLRDLSN+FQGILFA P+C+K P DL+ LW+HE  RVY DKLID  D + +QR   E   K FE +D  ++ ++PL+YCHFA    +P YMPV+  E L  IL E L++YNE+NAAM+LVLFEDA+ H+ RI+RIL +P+G ALLVGVGGSGKQSLSRLAA++  L+VFQITL +GYGI +L++DLA LY++ G KN+  VFLLTDAQ+ DE FLVL+NDLLASGEI DLF D++++ IIS + NEV + GM+DSRENCW FF+ +VR  L+++LCFSPVG TLRVRARKFPA+VNCT+IDWFH WP++AL+SVS RF++E + +   +KDS + FM+ VH  VN++S  Y QNERR+NYTTPKSFLEQI+L+ N+LKKK  E+  K  RL NG+QKL++TA QV DLKA+LA+QE EL+ +N  A  L+ K+   T+KVS EK IAD EE KV+ I+ EV +KQ++CE DL KAEPAL AA  ALNTLN+ NL+E+K+F  PP AV +V+AA M L+A  G+VPKDRSWKAAK   MGK+D FL  LINY+K++IPE  LK   E Y KDP FNP  I++KS AAAGLC+WVINII +YE++CDV+PKR AL  AN EL  ATEKL  I+ K+  L+  L +L   FEKA ++K RCQ+E + T KTI+LANRLV  L ++ +RWG+ ++ ++ +EKTL GDVL+T AF+SYVG FT+ YR  L+   W+PFL     I P+T+ LD + ML DDA IA+WNNEGLPSDRMS ENA ILT+ ERWPL+IDPQ QGIKWIK ++G DLKV  LGQKG+L+ IE A++ GDV+LIEN+EE++DPVLD LLGRNTIKKG+ I++GDKECE+N  FRLIL TKLANPHYKPE+QAQTT++NFTVT DGLE QLLA VV+ ER DLE LKL LTK QN FKI LK LED LL RLSAAEG+FL D  LVE LE  K T  EIE KV +AK  E  INE RE YRP AARAS+LYF++NDL KINP+YQFSLKAF V+F +AI++A+  E+++GR+  L++SIT +V+LYTS+ LFEKDKL F +QM+FQILL  KEI+P ELDFLLRF +     SP+DFL++ SW  IKA++ +EEF+ +DRD+EGSAK+W+K+VESE PEKEK PQEWK K+ +Q+L ++RA+RPDRMTYA+ +FV+EKLG KYVE   ++  ++FEES PATPIFFILSPGVD LKD+E LGK+LGF+ D+  F N+SLGQGQE VAE A++  +K GHWV+LQN+HLV+KWL  LEK LE +++ SH  YRVF+SAE + +P+ HIIPQG+LEN+IKITNEPPTGMLANLH +L NF+Q+T+E+C+KE EFK+ILF+LCYFHA V+ R +FGPQGW+RSYPFN GDL I  +VLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLC+ YLEE++ P + + EL + PGF  PP  DY GYH YI+E LP ESP LYGLHPNAEIEFLT  S+ LF+T+ EMQPR++      G S EE++K +LDDI+EKLP++FNM EI  K     R+PYV+V FQECERMN+L  EIR SL++LDL LKGEL ++  +EA   +L  D +P++WSK AYPS YGLA W+ DLLLR +EL+ WT D  LP+V+WL G FNPQSFLTAIMQ MARKNEWPLD+  L  DVTKK KED G PPR+GAY+HGLFMEGARWDTQ+G I EA+LKEL   MPVIF KA PVDRQ+ +  Y CPVY+TK RGP+++WTF LK++EK +KW
Sbjct:   56 DARVRFLGGRLAMMLGFTEEKWSQYLESEDNRQVLGEFLESTSPACL-VFSFAASGRLAASQEIPRDANHKLVFISKKITESIGVND-FSQVVLFGELPALSLGHVSAFLDEILVPVLSNKNNHKSWSCFTSQDMEYHIEVMKKKMYIFRGKMSRRTLLPIPTVAGKMDLDQNCSENKPPSNERIILHAIESVVIEWSHQIQEIIERDSVQRLLNGLHLSPQAELDFWMMRRENLSCIYDQLQAPVVLKMVKILTTKQSSYFPTLKDIFLAVENALLEAQDVELYLRPLRRHIQCLQETEFPQTRILIAPLFHTICLIWSHSKFYNTPARVIVLLQEFCNLFINQATAYLSPEDLLRGEIEESLEKVQVAVNILKTFKNSFFNYRKKLASYFM-GRKLRPWDFQSHLVFCRFDKFLDRLIKIEDIFATTLEFEKLERLEFGGTKGAILNGQVHEMSEELMELCKLFKQSTYDPSDCTNMEFESDYVAFKSKTLEFDRRLGTIICEAFFNCNGLEAAFKLLTIFGNFLEKPVVMEIFSLHYSTLVHMFNTELDVCKQLYNEHMKQIECGHVVLNKNMPFTSGNMKWAQQVLQRLQMFWSNFASLRYLFLGNPDHALVYQKYVEMTTLLDQFESRIYNEWKSNVDEICEFNLNQPLVKFSAINGLLCVNFDPKLVAVLREVKYLLMLKKQDIPDSALAIFKKRNTILKYIGNLDLLVQGYNKLKQTLLEVEYPLIEDELRAIDEQLTAATTWLTWQDDC-----WGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNLVEENRKLFKANPSLDTWKIYVEFIDDIVVEGFFQAIMHDLDFFLKNTEKQLKPAPFFQAQMILLPPEIVFKPSLDREAGDGFYDLVEEMLCNSFRMSAQMNRIATHLEIKNYQNDMDNMLGLAEVRQEIMNRVVNVINKVLDFRNTLETHTYLWVDDRAEFMKHFLLYGHAVSSDEMDAHANEEIP---EQPPTLEQFKEQIDIYEALYVQMSKFEDFRVFDSWFKVDMKPFKVSLLTIIKKWSWMFQEHLLRFVIDSLNELQEFIKETDSGLQRELNEGDHDGLVDIMVHLLAVRSRQRATDELFEPLKETITLLESYGQKMPEQVYIQLEELPERWETTKKIAATVRHEVSPLHNAEVTLIRKKCILFDAKQAEFRERFRHYAPLGFNAENPYTALDKANEELEALEEEMLQMQESTRLFEVALPEYKQMKQCRKEIKLLKGLWDVIIYVRRSIDNWTKTQWRQIHVEQMDVELRRFAKASSITEIWSLNKEVRVWDAYTGLEGTVKDMTASLRAITELQSPALRDRHWHQLMKAIGVKFLINEATTLADLLALRLHRVEDDVRRIVDKAVKELGTEKVITEISQTWATMKFSYEVHYRTGIPLLKSDEQLFETLEHNQVQLQTLLQSKYVEYFIEQVLSWQNKLNIADLVIFTWMEVQRTWSHLESIFVCSEDIRIQLVKDARRFDGVDAEFKELMFKTAKVENVLEATCRPNLYEKLKDLQSRLSLCEKALAEYLETKRIAFPRFYFVSSADLLDILSKGAQPKQVTCHLAKLFDSIADLQFEDNQDVSAHR-AVGMYSKEKEYVPFQAECECVGHVETWLLQLEQTMQETVRHSITEAIVAYEEKPRELWIFDFPAQVALTSSQIWWTTDVGIAFSRLEEGYETALKDFHKKQISQLNTLITLLLGELPPGDRQKIMTICTIDVHARDVVAKLISQKKVVVSPQAFTWLSQLRHRWEDTQKHCFVNICDAQFQYFYEYLGNSPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGNIYKGLVQTGAWGCFDEFNRISVEVLSVVAVQVKMIHDAIRNRKKRFVFLGEAITLKPSVGIFITMNPGYAGRTELPENLKALFRPCAMVAPDIELICEILLVAEGFVDARALARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVLMRALRDFNMPKIVTDDIPVFLGLVGDLFPALDVPRRRKLHFEQMVRQSTLELRLQPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKILRTLNRTYVNMKQKPVWNDLNPKAVTTDELFGFIHHATREWKDGKIVYSYFIGLFSSILREQANLKHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPFMRLLFEIHHLRSATPATVSRAGILYVNPQDLGWNPYVASWIDRRRHQSEKANLTILFDKYVPACLDKLRTSFKTITSIPESSLVQTLCVLLECLLTPENVPSDSPKEVYEVYFVFACIWAFGGTLLQDQISDYQADFSRWWQKEMKAVKFPSQGTIFDYYVDHKTKKLLPWADKIAQFTMDPDVPLQTVLVHTTETARLRYFMELLLEKGKPLMLVGNAGVGKTVFVGDTLASLSEDYIVSRVPFNYYTTSTALQKILEKPLEKKAGHNYGPGGNKKLIYFIDDMNMPEVDLYGTVQPHTLIRQHIDYGHWYDRQKVMLKEIHNCQYVACMNPMVGSFTINPRLQRHFTVFAFNFPSLDALNTIYGQIFSFHFQQQAFAPSILRSGPTLIQATIAFHQTMMCNFLPTAIKFHYIFNLRDLSNVFQGILFASPECLKGPLDLIHLWLHESARVYGDKLIDKKDCDLFQRRMLETAYKYFEGIDSHMLLQQPLIYCHFADRGKDPHYMPVKDWEVLKTILTETLDNYNELNAAMHLVLFEDAMQHVCRISRILRTPQGCALLVGVGGSGKQSLSRLAAYLRGLEVFQITLTEGYGIQELRVDLANLYIRTGAKNMPTVFLLTDAQVLDESFLVLINDLLASGEIPDLFSDEDVDKIISGIHNEVHALGMVDSRENCWKFFMARVRLQLKIILCFSPVGRTLRVRARKFPAIVNCTAIDWFHAWPQEALVSVSRRFIEETKGIEPVHKDSISLFMAHVHTTVNEMSTRYYQNERRHNYTTPKSFLEQISLFKNLLKKKQNEVSEKKERLVNGIQKLKTTASQVGDLKARLASQEAELQLRNHDAEALITKIGLQTEKVSREKTIADAEERKVTAIQTEVFQKQRECEADLLKAEPALVAATAALNTLNRVNLSELKAFPNPPIAVTNVTAAVMVLLAPRGRVPKDRSWKAAKV-FMGKVDDFLQALINYDKEHIPENCLKVVNEHYLKDPEFNPNLIRTKSFAAAGLCAWVINIIKFYEVYCDVEPKRQALAQANLELAAATEKLEAIRKKLVDLDRNLSRLTASFEKATAEKVRCQEEVNQTNKTIKLANRLVKELEAKKIRWGQSIKSFEAQEKTLCGDVLLTAAFVSYVGPFTRQYRQELVHCKWVPFLQQKVSI-PLTEGLDLISMLTDDATIAAWNNEGLPSDRMSTENAAILTHCERWPLVIDPQQQGIKWIKNKYGMDLKVTHLGQKGFLNAIETALAFGDVILIENLEETIDPVLDPLLGRNTIKKGKYIRIGDKECEFNKNFRLILHTKLANPHYKPELQAQTTLLNFTVTEDGLEAQLLAEVVSIERPDLEKLKLVLTKHQNDFKIELKYLEDDLLLRLSAAEGSFLDDTKLVERLEATKTTVAEIEHKVIEAKENERKINEARECYRPVAARASLLYFVINDLQKINPLYQFSLKAFNVLFHRAIEQADKVEDMQGRISILMESITHAVFLYTSQALFEKDKLTFLSQMAFQILLRKKEIDPLELDFLLRFTVEHTHLSPVDFLTSQSWSAIKAIAVMEEFRGIDRDVEGSAKQWRKWVESECPEKEKLPQEWKKKSLIQKLILLRAMRPDRMTYALRNFVEEKLGAKYVERTRLDLVKAFEESSPATPIFFILSPGVDALKDLEILGKRLGFTIDSGKFHNVSLGQGQETVAEVALEKASKGGHWVILQNVHLVAKWLGTLEKLLERFSQGSHRDYRVFMSAESAPTPDEHIIPQGLLENSIKITNEPPTGMLANLHAALYNFDQDTLEICSKEQEFKSILFSLCYFHACVAGRLRFGPQGWSRSYPFNPGDLTICASVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCRVYLEEFMNPSLTEDELMLAPGFAAPPYLDYAGYHQYIEEMLPPESPALYGLHPNAEIEFLTVTSNTLFRTLLEMQPRNALSGDELGQSTEEKVKNVLDDILEKLPEEFNMAEIMQK--NSNRSPYVLVCFQECERMNILIREIRISLEQLDLSLKGELALSPAVEAQQFALSYDTVPDTWSKLAYPSTYGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGFFNPQSFLTAIMQTMARKNEWPLDKTRLTADVTKKTKEDYGHPPREGAYLHGLFMEGARWDTQAGTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPVYRTKLRGPSYIWTFRLKSEEKTAKW 4512          
BLAST of DNAHb-1 vs. Ensembl Human
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:HGNC Symbol;Acc:HGNC:2942])

HSP 1 Score: 5112.35 bits (13260), Expect = 0.000e+0
Identity = 2590/4473 (57.90%), Postives = 3309/4473 (73.98%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGEVP---RSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKI-HKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGS--KDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKS-----IRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQK--IDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDG---------LFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKE-YCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            D R  F+G  +   L    +K+ +   +++ +Q++ +F E      L V      G L    E P +   K  F +KK  ESI  +  F++V++FG++    L   S+F+DE+++PVLSN  N +SW    S D+  H   +K +  +  G+   +TLLP+P  + K+      S  + P   R I++AIE+VVIEW+HQI +++ + S ++L+ GL+ +P  ELD+W  R  NL CIY+QL +P V KM  +L    S+Y P  K IF +V  AL E+Q++ LYL PLR  ++ +++ EF +   +I PLFH +CLIW+H K Y  P R++VL QE  NL IN   +YL P+++ +GE EE+LEKV+ ++ IL  FK SF ++R+K+  YF  G +   W F S+L+F R + F+ R+  ++ I   TLEF KLE++E  G KG  L+  + +M EE   + K F + TYD  D    +F  DY  FK+   + DRRL T + +AF +C+  +A FKL+ IFG  L++P++   F   Y  LV M + E++  K +Y+ H+   E    + +KNMP  +G ++W +++ +R++   +  + L +      +  LV +K+ E+  LL + E + YN W + VDE C FNL+QPL+  +     + VNFD KL AVLREVKYL +L +++IP SA  I  K +T+ KYI NLDL+V+ YN L++  L VE PLIE+EL  IDEQL  A T L W  D      W YIE+VR     L  RV ++++N+  I+  M  W +  L  R+E + +    L+D+ D   K+YK I   G ++H LV+EN +L KA+   + WK YV+ IDD++VE F + I + L + +   E      P F+  M L   EIVF+PSLDR+  D F +LV+ ++ + F+ ++++ R+A    +++Y+ D++    L + R EI  R      K   ++   + ++ LW D+R EFM  FL YG A+S++E++AH  ++I    E+PPTL+QFK QID YE  + ++ K   F + D WF++D + FK + L  IK+WS MF++HL+  V +SL EL EFIK T+SGL +E  EGD +GLV++M HL  V+ RQ+ATDE+FEPLK+TI LL++Y Q+MP++V++QLEELPE+W  TKK+A TV+  V+PL N EV  IR+KC  FD KQ  FRE+FR   P  F+    Y  LD+ + E+  LE+ M ++ ES  LFEV +PE+KQ+KQCRKE++LLK LWD I  V  SI+ W KT W+ I+VEQMD + + FAK+     I SL+KE+R WDAYTG+E  +K+M  SLRA+ ELQ+PA+RDRHW QLM A  VKF +NE+TTL DLL L LH  ED+VR IV+KAVKE+  EKV+ E+  TW+ M+F +E H RTGI LLK+ E+L ETLE +QV+LQ ++ SKY+ +F ++V SWQ  L+ AD VI  W EVQRTWSHLESIF+ S+DIR QL +D+ RFD +D +FK L+ +  +  NV++AT +P LYE+L+ +QS L LCEKALAEYLETKR+AFPRFYFVSSADLLDILS G  P+ V  HL KLFDS+A L+F    +    +  V MY+K+ E V F   C+  G VETWL +L + M+ T+R  ++E++ + EEK R+ WIF+FPAQVAL+SSQI W T+V ++F+RLEEGYE ALKDF+KKQI+QLN LITLL+GEL   DRQK+MTICTIDVH RDVV KLI+QK  + + Q+FTWL QLRHRW DT K C++NICDAQF+Y +EYLGN+PRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALG+MVYVFNCSEQMDYKSIGNIYKGL Q+G+WGCFDEFNRISVEVLSVVAVQVK I DAI+N++KRF FLGE I+L  ++GIFITMNPGYAGRTELPENLKALFRPCAMV PD ELICEI+LVAEGF+ AR LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR D +RPEDQVLMRALRDFN+PKIVTDD PVF+GL+GDLFPALDVPR+R   FE+ VRQ+TL+L+LQ EE+F+LKVVQL+EL AVRHSVFV+GNAGTGKS + +TL +TY N+K+KP+  DLNPKAVT DELFG I+ +TREWKDG         LFS I+R+ ANL  DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI LTP MRLLFEI HL++ATPATVSRAGILY+NPQDLGW P+V SWI  R  QSE+ANLTILFDKYVP CL+ L+  FK IT I E S VQ LC LLE LL PEN P+D PKE YE+YFVF  IWAFG  + QDQ+ D++ +F++WW  E K +K P+QGT+FDYY+D +TKK  PW  ++ +F MD + PLQ VLV T+ET R RYF++LL+EK +P+MLVG AG GKTV + D L S+ ++Y+V+ VPFN+YTTS  LQ++LEKPLEKKAG NYGP G+KKLIYFIDDMNMPEVD Y TVQPHTLIRQHIDY HWYDR K+ LKEIHN QY+ACMNP  GSFTI+PRLQRHF VFA +FP  ++L  IY  I S       F+ S+L++   L+   + FH  +   FLPTAIKFHY+FNLRDLSN+FQGILFA P+C+K P DL+ LW+HE  RVY DKLID  D + +QR   E   K FE +D  ++ ++PL+YCHFA    +P YMPV+  E L  IL E L++YNE+NAAM+LVLFEDA+ H+ RI+RIL +P+G ALLVGVGGSGKQSLSRLAA++  L+VFQITL +GYGI +L++DLA LY++ G KN+  VFLLTDAQ+ DE FLVL+NDLLASGEI DLF D++++ IIS + NEV + GM+DSRENCW FF+ +VR  L+++LCFSPVG TLRVRARKFPA+VNCT+IDWFH WP++AL+SVS RF++E + +   +KDS + FM+ VH  VN++S  Y QNERR+NYTTPKSFLEQI+L+ N+LKKK  E+  K  RL NG+QKL++TA QV DLKA+LA+QE EL+ +N  A  L+ K+   T+KVS EK IAD EE KV+ I+ EV +KQ++CE DL KAEPAL AA  ALNTLN+ NL+E+K+F  PP AV +V+AA M L+A  G+VPKDRSWKAAK   MGK+D FL  LINY+K++IPE  LK   E Y KDP FNP  I++KS AAAGLC+WVINII +YE++CDV+PKR AL  AN EL  ATEKL  I+ K+  L+  L +L   FEKA ++K RCQ+E + T KTI+LANRLV  L ++ +RWG+ ++ ++ +EKTL GDVL+T AF+SYVG FT+ YR  L+   W+PFL     I P+T+ LD + ML DDA IA+WNNEGLPSDRMS ENA ILT+ ERWPL+IDPQ QGIKWIK ++G DLKV  LGQKG+L+ IE A++ GDV+LIEN+EE++DPVLD LLGRNTIKKG+ I++GDKECE+N  FRLIL TKLANPHYKPE+QAQTT++NFTVT DGLE QLLA VV+ ER DLE LKL LTK QN FKI LK LED LL RLSAAEG+FL D  LVE LE  K T  EIE KV +AK  E  INE RE YRP AARAS+LYF++NDL KINP+YQFSLKAF V+F +AI++A+  E+++GR+  L++SIT +V+LYTS+ LFEKDKL F +QM+FQILL  KEI+P ELDFLLRF +     SP+DFL++ SW  IKA++ +EEF+ +DRD+EGSAK+W+K+VESE PEKEK PQEWK K+ +Q+L ++RA+RPDRMTYA+ +FV+EKLG KYVE   ++  ++FEES PATPIFFILSPGVD LKD+E LGK+LGF+ D+  F N+SLGQGQE VAE A++  +K GHWV+LQN+HLV+KWL  LEK LE +++ SH  YRVF+SAE + +P+ HIIPQG+LEN+IKITNEPPTGMLANLH +L NF+Q+T+E+C+KE EFK+ILF+LCYFHA V+ R +FGPQGW+RSYPFN GDL I  +VLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLC+ YLEE++ P + + EL + PGF  PP  DY GYH YI+E LP ESP LYGLHPNAEIEFLT  S+ LF+T+ EMQPR++      G S EE++K +LDDI+EKLP++FNM EI  K     R+PYV+V FQECERMN+L  EIR SL++LDL LKGEL ++  +EA   +L  D +P++WSK AYPS YGLA W+ DLLLR +EL+ WT D  LP+V+WL G FNPQSFLTAIMQ MARKNEWPLD+  L  DVTKK KED G PPR+GAY+HGLFMEGARWDTQ+G I EA+LKEL   MPVIF KA PVDRQ+ +  Y CPVY+TK RGP+++WTF LK++EK +KW
Sbjct:   56 DARVRFLGGRLAMMLGFTEEKWSQYLESEDNRQVLGEFLESTSPACL-VFSFAASGRLAASQEIPRDANHKLVFISKKITESIGVND-FSQVVLFGELPALSLGHVSAFLDEILVPVLSNKNNHKSWSCFTSQDMEYHIEVMKKKMYIFRGKMSRRTLLPIPTVAGKMDLDQNCSENKPPSNERIILHAIESVVIEWSHQIQEIIERDSVQRLLNGLHLSPQAELDFWMMRRENLSCIYDQLQAPVVLKMVKILTTKQSSYFPTLKDIFLAVENALLEAQDVELYLRPLRRHIQCLQETEFPQTRILIAPLFHTICLIWSHSKFYNTPARVIVLLQEFCNLFINQATAYLSPEDLLRGEIEESLEKVQVAVNILKTFKNSFFNYRKKLASYFM-GRKLRPWDFQSHLVFCRFDKFLDRLIKIEDIFATTLEFEKLERLEFGGTKGAILNGQVHEMSEELMELCKLFKQSTYDPSDCTNMEFESDYVAFKSKTLEFDRRLGTIICEAFFNCNGLEAAFKLLTIFGNFLEKPVVMEIFSLHYSTLVHMFNTELDVCKQLYNEHMKQIECGHVVLNKNMPFTSGNMKWAQQVLQRLQMFWSNFASLRYLFLGNPDHALVYQKYVEMTTLLDQFESRIYNEWKSNVDEICEFNLNQPLVKFSAINGLLCVNFDPKLVAVLREVKYLLMLKKQDIPDSALAIFKKRNTILKYIGNLDLLVQGYNKLKQTLLEVEYPLIEDELRAIDEQLTAATTWLTWQDDC-----WGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNLVEENRKLFKANPSLDTWKIYVEFIDDIVVEGFFQAIMHDLDFFLKNTEKQLKPAPFFQAQMILLPPEIVFKPSLDREAGDGFYDLVEEMLCNSFRMSAQMNRIATHLEIKNYQNDMDNMLGLAEVRQEIMNRVVNVINKVLDFRNTLETHTYLWVDDRAEFMKHFLLYGHAVSSDEMDAHANEEIP---EQPPTLEQFKEQIDIYEALYVQMSKFEDFRVFDSWFKVDMKPFKVSLLTIIKKWSWMFQEHLLRFVIDSLNELQEFIKETDSGLQRELNEGDHDGLVDIMVHLLAVRSRQRATDELFEPLKETITLLESYGQKMPEQVYIQLEELPERWETTKKIAATVRHEVSPLHNAEVTLIRKKCILFDAKQAEFRERFRHYAPLGFNAENPYTALDKANEELEALEEEMLQMQESTRLFEVALPEYKQMKQCRKEIKLLKGLWDVIIYVRRSIDNWTKTQWRQIHVEQMDVELRRFAKASSITEIWSLNKEVRVWDAYTGLEGTVKDMTASLRAITELQSPALRDRHWHQLMKAIGVKFLINEATTLADLLALRLHRVEDDVRRIVDKAVKELGTEKVITEISQTWATMKFSYEVHYRTGIPLLKSDEQLFETLEHNQVQLQTLLQSKYVEYFIEQVLSWQNKLNIADLVIFTWMEVQRTWSHLESIFVCSEDIRIQLVKDARRFDGVDAEFKELMFKTAKVENVLEATCRPNLYEKLKDLQSRLSLCEKALAEYLETKRIAFPRFYFVSSADLLDILSKGAQPKQVTCHLAKLFDSIADLQFEDNQDVSAHR-AVGMYSKEKEYVPFQAECECVGHVETWLLQLEQTMQETVRHSITEAIVAYEEKPRELWIFDFPAQVALTSSQIWWTTDVGIAFSRLEEGYETALKDFHKKQISQLNTLITLLLGELPPGDRQKIMTICTIDVHARDVVAKLISQKQVVVSPQAFTWLSQLRHRWEDTQKHCFVNICDAQFQYFYEYLGNSPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGNIYKGLVQTGAWGCFDEFNRISVEVLSVVAVQVKMIHDAIRNRKKRFVFLGEAITLKPSVGIFITMNPGYAGRTELPENLKALFRPCAMVAPDIELICEILLVAEGFVDARALARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVLMRALRDFNMPKIVTDDIPVFLGLVGDLFPALDVPRRRKLHFEQMVRQSTLELRLQPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKILRTLNRTYVNMKQKPVWNDLNPKAVTTDELFGFIHHATREWKDGKIVYSYFIGLFSSILREQANLKHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPFMRLLFEIHHLRSATPATVSRAGILYVNPQDLGWNPYVASWIDRRRHQSEKANLTILFDKYVPACLDKLRTSFKTITSIPESSLVQTLCVLLECLLTPENVPSDSPKEVYEVYFVFACIWAFGGTLLQDQISDYQADFSRWWQKEMKAVKFPSQGTIFDYYVDHKTKKLLPWADKIAQFTMDPDVPLQTVLVHTTETARLRYFMELLLEKGKPLMLVGNAGVGKTVFVGDTLASLSEDYIVSRVPFNYYTTSTALQKILEKPLEKKAGHNYGPGGNKKLIYFIDDMNMPEVDLYGTVQPHTLIRQHIDYGHWYDRQKVMLKEIHNCQYVACMNPMVGSFTINPRLQRHFTVFAFNFPSLDALNTIYGQIFSFHFQQQAFAPSILRSGPTLIQATIAFHQTMMCNFLPTAIKFHYIFNLRDLSNVFQGILFASPECLKGPLDLIHLWLHESARVYGDKLIDKKDCDLFQRRMLETAYKYFEGIDSHMLLQQPLIYCHFADRGKDPHYMPVKDWEVLKTILTETLDNYNELNAAMHLVLFEDAMQHVCRISRILRTPQGCALLVGVGGSGKQSLSRLAAYLRGLEVFQITLTEGYGIQELRVDLANLYIRTGAKNMPTVFLLTDAQVLDESFLVLINDLLASGEIPDLFSDEDVDKIISGIHNEVHALGMVDSRENCWKFFMARVRLQLKIILCFSPVGRTLRVRARKFPAIVNCTAIDWFHAWPQEALVSVSRRFIEETKGIEPVHKDSISLFMAHVHTTVNEMSTRYYQNERRHNYTTPKSFLEQISLFKNLLKKKQNEVSEKKERLVNGIQKLKTTASQVGDLKARLASQEAELQLRNHDAEALITKIGLQTEKVSREKTIADAEERKVTAIQTEVFQKQRECEADLLKAEPALVAATAALNTLNRVNLSELKAFPNPPIAVTNVTAAVMVLLAPRGRVPKDRSWKAAKV-FMGKVDDFLQALINYDKEHIPENCLKVVNEHYLKDPEFNPNLIRTKSFAAAGLCAWVINIIKFYEVYCDVEPKRQALAQANLELAAATEKLEAIRKKLVDLDRNLSRLTASFEKATAEKVRCQEEVNQTNKTIKLANRLVKELEAKKIRWGQSIKSFEAQEKTLCGDVLLTAAFVSYVGPFTRQYRQELVHCKWVPFLQQKVSI-PLTEGLDLISMLTDDATIAAWNNEGLPSDRMSTENAAILTHCERWPLVIDPQQQGIKWIKNKYGMDLKVTHLGQKGFLNAIETALAFGDVILIENLEETIDPVLDPLLGRNTIKKGKYIRIGDKECEFNKNFRLILHTKLANPHYKPELQAQTTLLNFTVTEDGLEAQLLAEVVSIERPDLEKLKLVLTKHQNDFKIELKYLEDDLLLRLSAAEGSFLDDTKLVERLEATKTTVAEIEHKVIEAKENERKINEARECYRPVAARASLLYFVINDLQKINPLYQFSLKAFNVLFHRAIEQADKVEDMQGRISILMESITHAVFLYTSQALFEKDKLTFLSQMAFQILLRKKEIDPLELDFLLRFTVEHTHLSPVDFLTSQSWSAIKAIAVMEEFRGIDRDVEGSAKQWRKWVESECPEKEKLPQEWKKKSLIQKLILLRAMRPDRMTYALRNFVEEKLGAKYVERTRLDLVKAFEESSPATPIFFILSPGVDALKDLEILGKRLGFTIDSGKFHNVSLGQGQETVAEVALEKASKGGHWVILQNVHLVAKWLGTLEKLLERFSQGSHRDYRVFMSAESAPTPDEHIIPQGLLENSIKITNEPPTGMLANLHAALYNFDQDTLEICSKEQEFKSILFSLCYFHACVAGRLRFGPQGWSRSYPFNPGDLTICASVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCRVYLEEFMNPSLTEDELMLAPGFAAPPYLDYAGYHQYIEEMLPPESPALYGLHPNAEIEFLTVTSNTLFRTLLEMQPRNALSGDELGQSTEEKVKNVLDDILEKLPEEFNMAEIMQK--NSNRSPYVLVCFQECERMNILIREIRISLEQLDLSLKGELALSPAVEAQQFALSYDTVPDTWSKLAYPSTYGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGFFNPQSFLTAIMQTMARKNEWPLDKTRLTADVTKKTKEDYGHPPREGAYLHGLFMEGARWDTQAGTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPVYRTKLRGPSYIWTFRLKSEEKTAKW 4512          
BLAST of DNAHb-1 vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 964.14 bits (2491), Expect = 0.000e+0
Identity = 857/3150 (27.21%), Postives = 1526/3150 (48.44%), Query Frame = 1
Query: 4159 HWAQLMAATKVKFDMNESTTLE-----DLLKLNLHNFE--DEVRSIVEKAVKEMSMEKVLKELYSTWSQMEF--EHEKHSR-TGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENA--LKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNP---GYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAV-DLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQ-MLCHL--------LEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLP-AQGTVFDYYIDTETKKFEPWTKRMTKFEMDLE--QPLQAVLVPTSETTRFRYFLDLLIEK--RRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKK--AGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPT--AGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILS---EKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPK----YMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMEN---IISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKV-----ATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKA-----AKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEE--IKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKG--RAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEE--------FKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNK-TSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELN--IVPGFKVPPNTDYKGYHNYIDECLPA-ESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESW-SKRAYPS----LYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSM-PVIFIKAIPVDRQDLRN-VYACPVYKTKERG 13377
            HW ++         +   TT+E     DLL ++ +  E  D+++ +  +A  E+++   ++EL    +Q EF     KHS    + ++K  +E I +L++ Q  LQ++ +S Y S F D+   W+  L+  D  +    E+QR W +LE IF      R  LP ++ RF R+D++++A++ +V +   +V    +  L + LE +  +L  C+KAL ++LE KR AFPRFYF+   DLL+IL    +P+++  H+ KLF  + +++F         +  ++M + +GE V  +    +  QVE+WL  L +EMR T++ + +++V+  +       + ++P+QV      +    EV  S A +E     +  L  F  + + +L A   + + +   D + K + +  I  H+ DVV +L+T +  +  S+TW  QLR    +      +    ++F Y +EY GN  +LV TPLTD+CY+TLTQ++++ + G P GPAGTGKTE+ K L   +G  V VFNC E +D  S+G I+ G+ + G+WGCFDEFNR+   VLS V++Q++ IQ AIK++     F G+ + ++    IF+T+NP   GY GR ++P+NLK LFR   M  PD ELI   +L +EGF+ A  LARK ++++QL +++LSKQ HYDWGLRA+K VL   GAL+R+  ++ E  ++++AL    + K+   D+  F  LI D+F  +     +  E  + +  A  ++ ++  +  + KV QL E    R  V V+G AG+GKS +WK L ++   L KKPL V   NPKAV   +L G ++  TREW DG+ ++  R++   TS    WIV DGDIDP W+E+LN+V+DDN++LT+ S ERI     +  LFE   L+ A+PATVSR G++YI+ +D+  +  V SW+  +  +   A++    +++   CL+   +R  KI+ I   + ++  L HL          VLL     P   P                          ++R EF K  V  F+ + +P  +   +D  ID      +  ++ +TK E++ E  +P     V T++T R+   +   ++   R   ++ G  G GK  LL+    +  ++ + +       ++S +LQ + +  ++     GR + P     +I F+  +N+P  DKY T +   L++Q + Y  ++D   L    I N Q++  MNP     + +IS RL       +L+      L +IY T L+   E++G   S  +    + +VD+    +NK+ S F PT     ++F+ RDL+N    +L    D  K    L  +   E  R++ D+L  +ND   ++ + + +      + +E V+FK+ +         GE        P+  S D +++L +++  +    A  N  L          I+R+L  P G+  L G  G G++   RL A + ++ VF   +   +       +L     +A   N  VV +L D Q+    FL  +N LLASG +  LF   E++    ++S   N+   TG +        F  +++RS + +VL      +  ++   + PA++   ++ +   +  ++L+ +      ++++  +    + A    F    VN      +Q         P  + + +  +  +L  K   L  ++ RL+ G+ KL     +V  ++ K   +   L +K A A+E L+ +       + +K+S E+  A  E+E V      + +++   +  L + +P +  A+ A+ ++   +L+E++S   PP AV D+  A +  M        D SW+A     +K+G+        D+++N++ + I     K      K  + + EE   K  S AAA L +WV   + Y +I   + P         + L++A +++  +   ++ +++ + +L+ +FE    +  + + + D    TI +A  LV  L+ E  RW  Q+E +  E+  +    L+T AF++Y+G  ++  R +L+ +    F  N+ P         PL     +    +W  +GLP+D++S+EN +IL  +   PLIID   Q +    ++     +  +  Q   +  IE A+  G  ++I++I E  D  L  +L ++   +G  + I  G K  ++NP+F++   T+      +P    Q  I+NFT T   L  QLL   ++ E+ +LE     L +     K+ L+ LE  LL +L++++GN L + AL+++L  +K +A  I + + +++     +   +++Y P +   S L+F  ++L   NPMY +S+     +F K I   E  ++   RVE L   +  +V+ + SRG+F +D+L+F   ++F      K   P E +      ++ + ++ +  L    W     L +L          F N     + +   + K ++ E      FP+  + K T  Q++  ++A++P+R+   + DFV + L    +     E    F+ES    PI FIL+ G DP +++      +     N  + +IS+GQGQEI A +A+   A +G W+ L N+HL+ +  +             HE++R++++ E          P  +L+ ++KIT EPP G+  NL ++    ++ T  +   ++     +F L + HA++ ERR F PQGW + Y F   D+ ++ + +   L AN K  WE +R +   ++YGG I +D+D K+  +YL      E ++G     +V G  +   T+ + Y  +I + +P+ + PYL+GL  N +  +    +D+   ++  +   D+  A +    + ++I QI+  + +KL    ++ + +        +P   V   E      L  ++ RS+  +   +K     +  ++    SL     P+ W S  A PS       + +      L++ E    ++    P  I    LF P  FL A+ Q  +R+ + PLD++ L    T         P +    V GL ++GA +D+    + E  +     S  P++F+         +       PVY + ER 
Sbjct: 1170 HWHEMFRF----LGLPRGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTLWAAQTEFTLADYKHSNGQNLKIIKEWKESINSLKDSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFG-----RGALPSEASRFSRVDSEYRAILNDVSKDARLVSLCSRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFSS-----TGETIISMVSSEGETVPLSKAVRIVPQVESWLQELSDEMRRTLKDLTAQAVADAQPS-----LAKYPSQV------LCLAEEVKFS-ASIENNLNGSSDLNSFKSQLLEKLKAYTNMKVDDKVSDLKLKSLILDLI--HHIDVVDQLLTNQAKSINSWTWQRQLRFYLVNGG--IVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTFGGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLI-LTKKPLKVTQFNPKAVNRSKLLGNMDMDTREWSDGIITMAAREVTKDTS-VHHWIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWL-VKTTEDLHADMPSWIEEHFWRCLKW--VRSHKISGITSFAILKNGLTHLKASKTKTQFLVLLFNGFLPTVTP--------------------------ENRQEFAKGVV--FQGMSVPDPKNICYDERIDGIMSYTDDVSQNVTKEEVEREDLRP----FVQTADTQRYSDIIGSWLQSGNRESFLITGTTGCGKQQLLKHCFQNDPESQLASLYCSAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFFDH-NLEWVSIENIQFVGSMNPIGDGAAVSISNRLFSLLRCVSLNTTDSSQLTSIYRTYLTPILEEVGERNSEII---ANRMVDI----YNKVQSNFRPTD-SVVFLFSPRDLTNWVVSLLRHELDQGK----LEAVICFEARRIFADRLPTENDKLKFEEILRNVI--PISQANETVIFKEKVYVTTGTVVPGESNTGLPLTPINMS-DFNQLLAKSINRFAFEIANFNCPLTSQLAFFCACIDRVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVALVSEAANQASFTGALQQ------FLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEIP-----KIQMESQGITTTDAILTGFNDVLVNLPEHLSIQ---------PIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENV-----RIEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMGI-----LDTSWEAMRKFLSKSGVK-------DDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLLKSMCKMF--NMPP------TFKPLSFASLETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQ-VSLFLSKFLEKSETFKAAQPDLMTQIELAIRFGKTIIIDDIVE-FDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCE--DKSSTRVETLARQMQLTVFYHISRGIFRQDRLMFA--VAFINATMPKMFQPKEWELFT--GVLVDESTDLSAL-RVQWISPDRLQSLARIRTHLPSLFNNFQIQDDATWNEFSKTLQCENA----FPKNVELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQELSEFASSM-----NVPYHSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLMLQ--AVPSIFKHLSLTTPHENFRLWLTTEGDAR-----FPSMMLQQSLKITFEPPPGVRNNLLRTYTQIDRSTKNVITCQS-----IFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFV-EQLTAN-KADWEFVRGILKFVIYGGRIENDFDFKVLDSYLNVLFCDEKINGRAGSQLVKGIDLLATTNVQEYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSIRTLALGDTKNALS---DQSDKISQIV-SLWKKLCQSDDLPKRELPTAIRSADPISEVLCLETINALSLIKQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSMWAGPSDPADYLNVVVKKTRGTLQLFESSKSSSLLSSP--IDFSDLFYPNIFLNALRQTTSRQIKIPLDQLILSSAWTPSQL-----PAKQCVQVQGLLLQGATFDS---FLRETTVSSAAYSQAPIVFLAWTSESSSTITGEQIQVPVYSSSERS 4145          
BLAST of DNAHb-1 vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 544/2101 (25.89%), Postives = 1005/2101 (47.83%), Query Frame = 1
Query: 7141 IWAF-GSCMFQDQLVDHRVEFTKWWVTEFKTIKLP--AQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQA-VLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRN---YGPSG-SKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTA--GSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKF------HYVFNLRDLSNIFQGILFA-GPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFE---EMDEMVMFKKPLLY-CHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMI-DSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISV-----------------SHRFLQEVELLPED--YKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAV-IDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKML--VDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWI-KTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRA--IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSE--ELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPF---ELDFLL-RFPIVP-------NLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNK--------TSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVE--FSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEI-VAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANS---------KVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFK-----VPPNTDYKGYH-NYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRD----SSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKEL-EIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDM 13170
            +WAF G   ++ +      E    ++ +  TI LP   Q  + DY +   +  ++PW  ++   E++  +   A ++VPT +T R    L   + + +P++L G  G+GKT+ L   L S  +  VV NV F+  TT E+L R  +   E +   N     P   S+ L+ F D++N+P  DKY T +  + +RQ ++ + +Y  +  +   +   Q++   NP    G   ++ R  RH  +  + +PGQ SL+ IY T         F+ ++LK    +  LA    N +   +L +   F      HYV++ R+L+   +GI  A  P        LVRLW HE  R++ D+L+ + + E   +L     ++ F     +DE +  K+PLLY C  ++      Y+PV R E+L   +   L+ + E    + LVLF+  + H+LRI+RI    +G+ LL+G  G+GK +LSR  A+++ L VFQ+ +   Y   D   D+  +  +AG +N  + F++ ++ + D  FL  +N LLA+GE+  LF  DE   +++ ++   +  G+I DS +  + +F  +V   L +V   +P GS LR RA   PA+ N   ++WF +W E+AL  V                 S R     EL+P    Y+D+    +  VHK V K +    +   R    TP+ FL+ I  + ++  +K ++L+ +   L  GL K+  T +QV +L+  L  +  EL++K  +AN  L+++  D +K   EK+ ++  ++++++   ++++K+   E DLA+ EPA+  AQ A+  + K+ L E+KS  +PP  V + + A C+ L    G       WKA +  +M   D F+  ++ ++ + +    LK  ++Y ++P++  +++   S+A   +  W    + Y  +   V+P R+ L+   +E  + T++   +  +I +LE+ + K ++E+ +     +  + +     + +  +  L+  L SE  RW      +  +  +L GD L++ AFL+Y G + +  R  +    W   + N    +    +L  ++ L  VDD +   W    LP D +  ENA +L    R+PLIIDP  Q +++I K   G +++      + +   +E A+  G+ +L++++E + DP+L+ +L R   + G    I +GD++ + +P F++ + T+ +   + P++ ++ T +NFTVT   L  Q L  V+  ER D++  + DL K Q +F + L+ LE +LL  L+ ++G  L D +++E LE  K  A E+ +K  +       ++     Y+  +   S +Y  L  LN+I+ +Y +SL     +F   +   E S   +   R+  +  S+  +V+   SRG+   DK++  A +  +I + +    P      D LL R   V         +   +DFL+  +   I     +  F+N+   ++ ++     ++ ++ PE    P  W +          ++  L ++ ALRPDR+  +    V       +++   V    S    E  P+ P+    + G D    +E L  +      N+   +I++G  +    A+ A+    K G WV+L+N+HL   W    + +   ++ + H  +R+F++AE         +P  IL  +  +  EP TG+ ANL +SL++   + +     E     +   +C+ HA+V ER ++ P GW+ +Y F+  DL ++ + L   ++A +         ++PW  LR L  + +YGG I + +D+ L    LE     +  + +  ++P +        PN   K     +++E    + P   GL  NAE   LT   + + + + ++   +      G          ++ ++    ++ LP +  +V+++  V    ++P      +E    + L  +IRR L E+    + E     +  AL+ SL    +P  W +   P    +  W  DL  R+K+L  I   D       WLGG F+P++++TA  QQ+A+ N W L+++ L   + + +  D+
Sbjct: 1509 VWAFSGDGKWKSR------EMMSDFIRQATTISLPPNQQACLIDYEVQL-SGDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT---------FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEAL--KRPLLYSCWLSRN-----YVPVTR-EELQDYVSARLKGFYEEELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGT-----DWKAIRQVMMK--DDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHK-WFNHVVNAG--LHFRHDLARIEYLSTVDDRL--QWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVE-AYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLL-ALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPES-NVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVE-----TNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSW--LAQLEKRLHSMKPHAQFRLFLTAEIHPK-----LPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTER--SRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKE--IVKMRRTV-ENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDV 3552          

HSP 2 Score: 577.4 bits (1487), Expect = 1.227e-164
Identity = 369/1076 (34.29%), Postives = 601/1076 (55.86%), Query Frame = 1
Query: 3868 EFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKAT---GKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGE---MVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRD--------QWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRH----RWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIK-NKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDR---------PEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQAT-------LDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKK-KPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMR---DLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPV 6978
            E  +L    +EL  +K +W  +  V + I+  K+  W  +   ++ Q        ++ L  + R++ +Y  V+  +         V EL++ A+++RHW Q+M   +V +++++  TL  +   ++   E  ++ I+  A  EM++E+ L+E+   W   E E   + +    L+K  ++L   L+E Q  L  M  S Y   F +   SW + L+  + +  +W +VQR W +LE +F GS +I   LP +S RF  I TD  AL+ +V  +  ++      G  RL ERL  +   L   +KAL EYLE +R +FPRFYFV   DLL+I+ N      + KHL K+F  +  +   +       +   A ++++GE   +V+  +  D+  ++  WL  L  EM+ T+   L+ S++   + +          +W+ +FPAQV   +++I W  E+  + A   +G EN      +  +  L  L   ++ E     R+K+  + T  VH RD  +KL++ KI  +  F WL  +R     +  D  + C + + ++QF Y  EYLG   RLV TPLTDRCY+T+TQ+LH  + G+P GPAGTGKTE+ K LG  LG  V VFNC E  D++++G I  GL Q G+WGCFDEFNR+   +LS V+ Q++ IQ+A++       D +G+ ++++S IGIFITMNPGY+GR+ LP+NLK LFR  AM  PD +LI ++ML ++GF  A  LA K + L+ LCKE LS Q HYD+GLRA+K VLV AG +KR   D+          E Q+L++++ +  +PK+V +D  +   L+ D+FP +     +  E  + +            D++ +    ++ KV+QL ++  + H + ++G++G+GK+M WK L+K     +  + +A  ++ KA++ D L+G+++P+TREW DGLF+ ++R   D     +D  +WI+ DGD+DP W+E+LN+V+DDNK+LTL + ER+ + P +R++FE++ LK AT ATVSR G++               W S   + SE     +LF++Y+ +
Sbjct:  350 EGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNLSD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY-QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADM---LAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINE-----EDRSITAFHSREGEKVDLVKIVSTKDV--RINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLAD-GKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMV---------------WFSEEVVTSE-----MLFERYLSI 1388          
BLAST of DNAHb-1 vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 544/2101 (25.89%), Postives = 1005/2101 (47.83%), Query Frame = 1
Query: 7141 IWAF-GSCMFQDQLVDHRVEFTKWWVTEFKTIKLP--AQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQA-VLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRN---YGPSG-SKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTA--GSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKF------HYVFNLRDLSNIFQGILFA-GPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFE---EMDEMVMFKKPLLY-CHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMI-DSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISV-----------------SHRFLQEVELLPED--YKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAV-IDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKML--VDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWI-KTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRA--IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSE--ELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPF---ELDFLL-RFPIVP-------NLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNK--------TSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVE--FSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEI-VAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANS---------KVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFK-----VPPNTDYKGYH-NYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRD----SSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKEL-EIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDM 13170
            +WAF G   ++ +      E    ++ +  TI LP   Q  + DY +   +  ++PW  ++   E++  +   A ++VPT +T R    L   + + +P++L G  G+GKT+ L   L S  +  VV NV F+  TT E+L R  +   E +   N     P   S+ L+ F D++N+P  DKY T +  + +RQ ++ + +Y  +  +   +   Q++   NP    G   ++ R  RH  +  + +PGQ SL+ IY T         F+ ++LK    +  LA    N +   +L +   F      HYV++ R+L+   +GI  A  P        LVRLW HE  R++ D+L+ + + E   +L     ++ F     +DE +  K+PLLY C  ++      Y+PV R E+L   +   L+ + E    + LVLF+  + H+LRI+RI    +G+ LL+G  G+GK +LSR  A+++ L VFQ+ +   Y   D   D+  +  +AG +N  + F++ ++ + D  FL  +N LLA+GE+  LF  DE   +++ ++   +  G+I DS +  + +F  +V   L +V   +P GS LR RA   PA+ N   ++WF +W E+AL  V                 S R     EL+P    Y+D+    +  VHK V K +    +   R    TP+ FL+ I  + ++  +K ++L+ +   L  GL K+  T +QV +L+  L  +  EL++K  +AN  L+++  D +K   EK+ ++  ++++++   ++++K+   E DLA+ EPA+  AQ A+  + K+ L E+KS  +PP  V + + A C+ L    G       WKA +  +M   D F+  ++ ++ + +    LK  ++Y ++P++  +++   S+A   +  W    + Y  +   V+P R+ L+   +E  + T++   +  +I +LE+ + K ++E+ +     +  + +     + +  +  L+  L SE  RW      +  +  +L GD L++ AFL+Y G + +  R  +    W   + N    +    +L  ++ L  VDD +   W    LP D +  ENA +L    R+PLIIDP  Q +++I K   G +++      + +   +E A+  G+ +L++++E + DP+L+ +L R   + G    I +GD++ + +P F++ + T+ +   + P++ ++ T +NFTVT   L  Q L  V+  ER D++  + DL K Q +F + L+ LE +LL  L+ ++G  L D +++E LE  K  A E+ +K  +       ++     Y+  +   S +Y  L  LN+I+ +Y +SL     +F   +   E S   +   R+  +  S+  +V+   SRG+   DK++  A +  +I + +    P      D LL R   V         +   +DFL+  +   I     +  F+N+   ++ ++     ++ ++ PE    P  W +          ++  L ++ ALRPDR+  +    V       +++   V    S    E  P+ P+    + G D    +E L  +      N+   +I++G  +    A+ A+    K G WV+L+N+HL   W    + +   ++ + H  +R+F++AE         +P  IL  +  +  EP TG+ ANL +SL++   + +     E     +   +C+ HA+V ER ++ P GW+ +Y F+  DL ++ + L   ++A +         ++PW  LR L  + +YGG I + +D+ L    LE     +  + +  ++P +        PN   K     +++E    + P   GL  NAE   LT   + + + + ++   +      G          ++ ++    ++ LP +  +V+++  V    ++P      +E    + L  +IRR L E+    + E     +  AL+ SL    +P  W +   P    +  W  DL  R+K+L  I   D       WLGG F+P++++TA  QQ+A+ N W L+++ L   + + +  D+
Sbjct: 2441 VWAFSGDGKWKSR------EMMSDFIRQATTISLPPNQQACLIDYEVQL-SGDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT---------FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEAL--KRPLLYSCWLSRN-----YVPVTR-EELQDYVSARLKGFYEEELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGT-----DWKAIRQVMMK--DDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHK-WFNHVVNAG--LHFRHDLARIEYLSTVDDRL--QWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVE-AYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLL-ALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPES-NVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVE-----TNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSW--LAQLEKRLHSMKPHAQFRLFLTAEIHPK-----LPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTER--SRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKE--IVKMRRTV-ENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDV 4484          

HSP 2 Score: 577.015 bits (1486), Expect = 2.488e-164
Identity = 369/1076 (34.29%), Postives = 601/1076 (55.86%), Query Frame = 1
Query: 3868 EFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKAT---GKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGE---MVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRD--------QWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRH----RWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIK-NKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDR---------PEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQAT-------LDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKK-KPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMR---DLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPV 6978
            E  +L    +EL  +K +W  +  V + I+  K+  W  +   ++ Q        ++ L  + R++ +Y  V+  +         V EL++ A+++RHW Q+M   +V +++++  TL  +   ++   E  ++ I+  A  EM++E+ L+E+   W   E E   + +    L+K  ++L   L+E Q  L  M  S Y   F +   SW + L+  + +  +W +VQR W +LE +F GS +I   LP +S RF  I TD  AL+ +V  +  ++      G  RL ERL  +   L   +KAL EYLE +R +FPRFYFV   DLL+I+ N      + KHL K+F  +  +   +       +   A ++++GE   +V+  +  D+  ++  WL  L  EM+ T+   L+ S++   + +          +W+ +FPAQV   +++I W  E+  + A   +G EN      +  +  L  L   ++ E     R+K+  + T  VH RD  +KL++ KI  +  F WL  +R     +  D  + C + + ++QF Y  EYLG   RLV TPLTDRCY+T+TQ+LH  + G+P GPAGTGKTE+ K LG  LG  V VFNC E  D++++G I  GL Q G+WGCFDEFNR+   +LS V+ Q++ IQ+A++       D +G+ ++++S IGIFITMNPGY+GR+ LP+NLK LFR  AM  PD +LI ++ML ++GF  A  LA K + L+ LCKE LS Q HYD+GLRA+K VLV AG +KR   D+          E Q+L++++ +  +PK+V +D  +   L+ D+FP +     +  E  + +            D++ +    ++ KV+QL ++  + H + ++G++G+GK+M WK L+K     +  + +A  ++ KA++ D L+G+++P+TREW DGLF+ ++R   D     +D  +WI+ DGD+DP W+E+LN+V+DDNK+LTL + ER+ + P +R++FE++ LK AT ATVSR G++               W S   + SE     +LF++Y+ +
Sbjct: 1282 EGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNLSD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY-QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADM---LAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINE-----EDRSITAFHSREGEKVDLVKIVSTKDV--RINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLAD-GKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMV---------------WFSEEVVTSE-----MLFERYLSI 2320          
BLAST of DNAHb-1 vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 544/2101 (25.89%), Postives = 1005/2101 (47.83%), Query Frame = 1
Query: 7141 IWAF-GSCMFQDQLVDHRVEFTKWWVTEFKTIKLP--AQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQA-VLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRN---YGPSG-SKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTA--GSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKF------HYVFNLRDLSNIFQGILFA-GPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFE---EMDEMVMFKKPLLY-CHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMI-DSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISV-----------------SHRFLQEVELLPED--YKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAV-IDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKML--VDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWI-KTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRA--IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSE--ELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPF---ELDFLL-RFPIVP-------NLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNK--------TSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVE--FSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEI-VAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANS---------KVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFK-----VPPNTDYKGYH-NYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRD----SSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKEL-EIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDM 13170
            +WAF G   ++ +      E    ++ +  TI LP   Q  + DY +   +  ++PW  ++   E++  +   A ++VPT +T R    L   + + +P++L G  G+GKT+ L   L S  +  VV NV F+  TT E+L R  +   E +   N     P   S+ L+ F D++N+P  DKY T +  + +RQ ++ + +Y  +  +   +   Q++   NP    G   ++ R  RH  +  + +PGQ SL+ IY T         F+ ++LK    +  LA    N +   +L +   F      HYV++ R+L+   +GI  A  P        LVRLW HE  R++ D+L+ + + E   +L     ++ F     +DE +  K+PLLY C  ++      Y+PV R E+L   +   L+ + E    + LVLF+  + H+LRI+RI    +G+ LL+G  G+GK +LSR  A+++ L VFQ+ +   Y   D   D+  +  +AG +N  + F++ ++ + D  FL  +N LLA+GE+  LF  DE   +++ ++   +  G+I DS +  + +F  +V   L +V   +P GS LR RA   PA+ N   ++WF +W E+AL  V                 S R     EL+P    Y+D+    +  VHK V K +    +   R    TP+ FL+ I  + ++  +K ++L+ +   L  GL K+  T +QV +L+  L  +  EL++K  +AN  L+++  D +K   EK+ ++  ++++++   ++++K+   E DLA+ EPA+  AQ A+  + K+ L E+KS  +PP  V + + A C+ L    G       WKA +  +M   D F+  ++ ++ + +    LK  ++Y ++P++  +++   S+A   +  W    + Y  +   V+P R+ L+   +E  + T++   +  +I +LE+ + K ++E+ +     +  + +     + +  +  L+  L SE  RW      +  +  +L GD L++ AFL+Y G + +  R  +    W   + N    +    +L  ++ L  VDD +   W    LP D +  ENA +L    R+PLIIDP  Q +++I K   G +++      + +   +E A+  G+ +L++++E + DP+L+ +L R   + G    I +GD++ + +P F++ + T+ +   + P++ ++ T +NFTVT   L  Q L  V+  ER D++  + DL K Q +F + L+ LE +LL  L+ ++G  L D +++E LE  K  A E+ +K  +       ++     Y+  +   S +Y  L  LN+I+ +Y +SL     +F   +   E S   +   R+  +  S+  +V+   SRG+   DK++  A +  +I + +    P      D LL R   V         +   +DFL+  +   I     +  F+N+   ++ ++     ++ ++ PE    P  W +          ++  L ++ ALRPDR+  +    V       +++   V    S    E  P+ P+    + G D    +E L  +      N+   +I++G  +    A+ A+    K G WV+L+N+HL   W    + +   ++ + H  +R+F++AE         +P  IL  +  +  EP TG+ ANL +SL++   + +     E     +   +C+ HA+V ER ++ P GW+ +Y F+  DL ++ + L   ++A +         ++PW  LR L  + +YGG I + +D+ L    LE     +  + +  ++P +        PN   K     +++E    + P   GL  NAE   LT   + + + + ++   +      G          ++ ++    ++ LP +  +V+++  V    ++P      +E    + L  +IRR L E+    + E     +  AL+ SL    +P  W +   P    +  W  DL  R+K+L  I   D       WLGG F+P++++TA  QQ+A+ N W L+++ L   + + +  D+
Sbjct: 2441 VWAFSGDGKWKSR------EMMSDFIRQATTISLPPNQQACLIDYEVQL-SGDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT---------FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEAL--KRPLLYSCWLSRN-----YVPVTR-EELQDYVSARLKGFYEEELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGT-----DWKAIRQVMMK--DDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHK-WFNHVVNAG--LHFRHDLARIEYLSTVDDRL--QWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVE-AYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLL-ALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPES-NVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVE-----TNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSW--LAQLEKRLHSMKPHAQFRLFLTAEIHPK-----LPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTER--SRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKE--IVKMRRTV-ENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDV 4484          

HSP 2 Score: 577.015 bits (1486), Expect = 2.488e-164
Identity = 369/1076 (34.29%), Postives = 601/1076 (55.86%), Query Frame = 1
Query: 3868 EFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKAT---GKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGE---MVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRD--------QWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRH----RWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIK-NKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDR---------PEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQAT-------LDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKK-KPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMR---DLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPV 6978
            E  +L    +EL  +K +W  +  V + I+  K+  W  +   ++ Q        ++ L  + R++ +Y  V+  +         V EL++ A+++RHW Q+M   +V +++++  TL  +   ++   E  ++ I+  A  EM++E+ L+E+   W   E E   + +    L+K  ++L   L+E Q  L  M  S Y   F +   SW + L+  + +  +W +VQR W +LE +F GS +I   LP +S RF  I TD  AL+ +V  +  ++      G  RL ERL  +   L   +KAL EYLE +R +FPRFYFV   DLL+I+ N      + KHL K+F  +  +   +       +   A ++++GE   +V+  +  D+  ++  WL  L  EM+ T+   L+ S++   + +          +W+ +FPAQV   +++I W  E+  + A   +G EN      +  +  L  L   ++ E     R+K+  + T  VH RD  +KL++ KI  +  F WL  +R     +  D  + C + + ++QF Y  EYLG   RLV TPLTDRCY+T+TQ+LH  + G+P GPAGTGKTE+ K LG  LG  V VFNC E  D++++G I  GL Q G+WGCFDEFNR+   +LS V+ Q++ IQ+A++       D +G+ ++++S IGIFITMNPGY+GR+ LP+NLK LFR  AM  PD +LI ++ML ++GF  A  LA K + L+ LCKE LS Q HYD+GLRA+K VLV AG +KR   D+          E Q+L++++ +  +PK+V +D  +   L+ D+FP +     +  E  + +            D++ +    ++ KV+QL ++  + H + ++G++G+GK+M WK L+K     +  + +A  ++ KA++ D L+G+++P+TREW DGLF+ ++R   D     +D  +WI+ DGD+DP W+E+LN+V+DDNK+LTL + ER+ + P +R++FE++ LK AT ATVSR G++               W S   + SE     +LF++Y+ +
Sbjct: 1282 EGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNLSD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY-QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADM---LAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINE-----EDRSITAFHSREGEKVDLVKIVSTKDV--RINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLAD-GKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMV---------------WFSEEVVTSE-----MLFERYLSI 2320          
BLAST of DNAHb-1 vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 92.4337 bits (228), Expect = 8.751e-18
Identity = 101/399 (25.31%), Postives = 197/399 (49.37%), Query Frame = 1
Query: 9130 LEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAV-IDVSAACMCLMATNGKVPKD-----RSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKE-YCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEK-TLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAI 10302
            L+ ++  + + KKK  E++  M++ E G++K++   +QV  ++ +L   + +L + +   + L+  +  +T  V + + +    E K ++   +    + + E +LA A PAL++A EAL T+ +++++ +K+   PP AV + + A C+ L     K+  +       +  +   ++  I  FL  + ++ +D + + ++K  +E Y     F+PE +K  SLAA GLC WV+ I  Y +I   V+PKR+ L  A   +++  ++L   +  + ++ ++LQ L D+F +    KQ  + +       +E A RLV  L+ E  +W  ++     E+  ++P  V  ++A L   G      R   +          L   IP   +L  L MLV+D I
Sbjct: 2101 LKMVSTITKLAKKKREEVRKTMTKYEKGMEKMKRAEEQVAGMQGELLRLQPQLVRTSIETSMLMSTIEKETIDVENAREVVAANENKANEAATKAQSLKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKITNEIGEVVNDYWVSGQKLLSDIH-FLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKWKNKITYITHEDSLSVPYSVGSSLA-LHVFGKLPIDQREKELRKTMRSLFPRLEVTIPC--DLKTLVMLVEDPI 2495          

HSP 2 Score: 85.5001 bits (210), Expect = 1.167e-15
Identity = 111/524 (21.18%), Postives = 224/524 (42.75%), Query Frame = 1
Query: 4009 DCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQ------SELVLC----EKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTN--NCDLGGQ-VETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRD-QWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGE-----LSKDDRQKVMTICT-IDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLG 5520
            D K  A  I+  + E  S +A   +E  +      L  +  +   A++DRHW  ++  ++    +  +  + +LL++N     D+   +  +A KE  +E  ++++ S W    F     +  G  LL  + EL   ++    + Q +++S +     D +  W  TL   +  + ++ +    W  +E +F  ++DI  Q+P +   F +I   +  +           + T +  + E++++VQ      SEL +     E     YL  KR  FPR + +S   +L ++ +   P     ++  LF S           ++NTK+ +   +   E +      N +L  + VE W++ L  +++ T+RT +   +  +  K    + I   P QVA    +IA+  ++           EN++K   +  +T L + + + I +     L K DR + + +   I   +  +V KL+ +++     + W  QLR+ W    ++ +I +     RY +E  G
Sbjct:  659 DLKEKAAVIK--EHETTSKEALLKIEIVLAEFEKLLPVLGAISCQAMKDRHWKMILQDSETSVKVEGNPLVSELLEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQWVTATFV----THQGGELL--TTELNVQMQAHLARSQTILSSPHAFSILDHIRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVF-STEDIAYQMPHEFRTFKKISLRWLHI---------NNQITEERPILEQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPS-------LTTFDQNTKMEIISVSTKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEKMNYKLSPVETILNEPIQVAAVYLKIAFTWQM-----------ENSMK---QNSLTILASELKICIRDCQHAVLHKHDRWEFLPVLYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYWH--LENVFIRVGTVSTRYDYEVQG 1141          
BLAST of DNAHb-1 vs. Ensembl Fly
Match: Dhc93AB (gene:FBgn0013812 transcript:FBtr0273236)

HSP 1 Score: 5366.59 bits (13920), Expect = 0.000e+0
Identity = 2704/4476 (60.41%), Postives = 3436/4476 (76.76%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFP-TNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVS-------EGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAE--PVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVS----GNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEH----WKQYVDNIDDMIVENFQETINYSLQYMIDQI--EGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAH--GEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXX-XXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGS---NFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGP-TFVWTFNLKTKEKPSKW 13431
            D R E +G +V+KSLK K +K+ ++   +E K ++ +F ++     L ++  P    L     FP + LKSK  +F K+    I R+   N  +I+GD++   +DQ S+ V+EV++P+LSN  N  +WP +++ DV +H +SLK     V GQ  G+T+L +PVG EK+        E +   F    +S   AIE VVI+WA QI +V+ +  S     G NPTP  E  +W  R  NL  IY+QL + +++ MA +LEY  S Y P F+ +FK+VV AL E+++I LYL PL+  L+ +E+++F+E +P++ P  + + ++W + + Y    +I VL QEI NLII+    YLDP  IF  + +EA++++  S++IL  F+E F+ ++E++  +F +  E  P+ W F  N +F R N+F+ R+  ++W     +EF KLEKVEI G++GR LS  I D++ EF   F  F  ++YD LDP + +F +D+  F+  I +LD +LA  + QAF DCH  +++FKLI I G +LDRP +K EF +RY E+V+MLD+EM   + +YD  +     G+   P  + N P V   + WC ++  RI  P+     L H+  KT +   +V++++ L+  L   + +++++W   +D     NL + L+ R+     + +NF   L ++LREV Y++ +  E IPQ A D   K+D  R Y  NL+  ++WYN +++ +  VE  LIE E+  ID+ +E  +  L WNS  +      Y++++R  V  L++R+  ++ N+  IR IM  W K PLFER++ K DT+L++D+R DR +KRY EI  A   +H L+++N  +L+ D  S+     W  YVD +D+++ EN  +T+  S+ Y+ + +  E +  PLFE  ++L    +VF PSLD +    F+ ++  L+ DI K  S +KRL   +   +Y   ++EN+++   R EI    ++  E+A  +  +F+ YS LW D+REE M  FL YG+ +  +E+E     + +    +   PT++ F+ QID YE  F EIE +  F +   WF++D R F+QA LNT+ +W  MFK+HL+  VT+SL  L+ FI+  + GL +   E D+EGLV +M +L  VKER   TDEMFEP+++TI LLK Y+ ++P+EV++ L+ELPE+W NTKK+A TVKQ V+PLQ  EV +IR K A F+     FRE F+  D F F C + Y  +DR + ++   E  M ++ ES +LFEV +PEFK LKQCRKELR+LK LWD++N+V +SI+ WK T W+ ++VE MD +CK FAK IR LDKEMR WD +  +E  +KNM+TSLRAV ELQNPAIR+RHW QLM +TKVKF M+  TTL +LL LNLH  E+EV++IV+KAVKEMSMEK+L++L +TW+ MEF+HE H RTG  LLKASEELIETLE++QV LQN++TSKYI+HF +EV +WQ  L  ADQVI +WFEVQRTW+HLESIF+ S+DIRKQLP DS+RFD ID +F+ L+ E+  ++NVV +T +  L ERLE +Q EL LCEKALAEYLETKRLAFPRFYFVSSADLLD+LSNG  PE+V KHLTKLFDS+A+LK    E+ E NT  G  MYAKDGE VEF     + G VE WLNR+   MR ++R  + E+V + EEK R+QW+F++PAQV+L  SQI W TEV ++F+RLEEGY+NA+KD+ KKQI+QL+ LITLL+GELSK DRQK+MTICTIDVH+RDVV K+I  K+D+  +F W  QLRHR+ D +KDC+ NICDA+F+Y HEYLGNTPRLVITPLTDRCYITLTQSLHL M GAPAGPAGTGKTETTKDLGRA+GI VYVFNCSEQMDY+S GNIYKGLAQ+G+WGCFDEFNRI+VEVLSVVAVQVK +QDAI++K+ +F+F+GE IS    +GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGF  AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DP RPE++VLMRALRDFNIPKI+TDD PVFMGLI DLFPALDVPRKRD +FE+ V+QA  DL LQ E+NF+LKVVQL+EL  VRHSVF++GNAGTGK+ VWKTL++TY N+K+KP+  DLNPKAVTNDELFGIINP+TREWKDGLFSV+MRD AN+T D PKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI LTP+MRLLFEIS+L+TATPATVSRAGILYINPQDLGW P+V SW+ TR+I +E++NL +LFDKY+P  LE +++RFKKITP+ E++H+QMLCHLL   L+P NTPADCPKEW+ELYFVF  IWAFGS MFQDQ +D+RVEF+KWWV EFKT+K P  GTVFDY++D+ETK F PWT+++ KFE+D + PLQAV+V TSE+ R R+FLDLL++K+ PVMLVG AG GKTVL+ +KL S+ +NY V  +PFN+YTTSEMLQ++LEKPLEKKAGRNYGP G+K L YF+DD+NMPEVD Y TVQPHTL+RQH+DY HWYDR KLTLK+IHN QY+ACMNPT+GSFTI+PRLQRHFCV A+SFPG ES+  +YS+IL++   +    F+  + +   N+V   +  HNK    FLPTAIK HY+FNLRD+SN+FQG+LF+  +C+   +DL+RLW HE +RVY+DKL DD DI+++ ++Q ++ KK+FEE+DE V+F KP +YCHFA GIG+PKYMP++   +L K+L+EA+ SYN++ AAMNLVLFEDA+ H+ RINRILESPRG ALLVGVGGSGKQSL+RLAAFISSL+V QI L+KGYG+NDLK + + LY+KAG+KN+G++FL+TDAQI  E FLVL+ND+LA+GEI DLFPDDE+ENII+ +RNEVK  G++D+RENCW FFI++VR  L++VLCFSPVGSTLRVR+RKFPA++N TSI+WFHEWP++ALISV+  FL + ++LPE+++DS AKFM++VH +VN  S  YLQNERRYNYTTPKS+LEQI LY  +L  K+ +LQ K+ RLENGL+KL STA QV DLK KLA QE+EL++KN +A+ L+E V  +T+KV +EK +AD EE KV+ I  EVSKKQ+DCE DL KAEPAL AAQ+ALNTLNK NLTE+KSFG+PP AV +V+AA M L++  GKVPKDRSWKAAK   M K+D FLD+LINY+K+NI     KA + Y KDP F PE ++SKS AAAGLC+WVINII +YE++CDV+PKR AL AAN EL  A +KL+GI+ K+  LE+QL KL  +FEKA +DK RCQ EAD T  TI LANRLVGGLASENVRW + V  +  +  TLPGD+L+  AF+SYVGCFTK +R+ L+   W PFL ++ P IP T+NLDPL +L DD  IA W NEGLPSDRMSIENATIL+N++RWPL+IDPQLQG+KWIK ++G DLKV+RLGQ+ YLD+IE++++AG  VLIENI+E++DPVLD LLGRN IKKG+AIK+GDKE EYN  FRLIL TKLANPHYKPEMQAQTT+INFTVTRDGLEDQLLA VV  ER DLE LK DLTKQQN FKI LK+LED LL RLS+A  N LGD ALVENLE  K TA EIE+KV +AKIT   I++ RE YRPAAARAS+LYFILN+LN INP+YQFSLKAF VVF+KAI +AEP + L  RV NLID IT+SV+ YTSRGLFE DKLIF +QM+FQILL  +E+   ELDFLLRFPI P++TSP+DFL+N SWGGI +L++ +EF+NLDRDIE S+KRWKK VESE PEKEKFPQEWKNKT+LQRLCM+RALRPDRMTYA+ADF++EKLG KYVE   +EF++S+EE+ P+TPIFFILSPGV+PLKDVE LGK++GFS D  NF N+SLGQGQE +AE AMD  AK GHWVVLQNIHLV KWL  LEKKLE YAE+SH  YR+F+SAEP+ +P +HIIPQGILE++IKITNEPPTGMLANLHK+L+NF QET+EM  KE EFK ILF+LCYFHAVV+ERRKFGPQGWN+ YPFN GDL ISV+VLYNYLEAN+KVPWEDLRYLFGEIMYGGHITDDWDR+LC TYLEEY+QP+++DGEL + P F  PPNTDY+GYH Y+DE +PAESPYLYGLHPNAEI FLT+ ++ +F+TVFEMQPRD+   G   ++RE+++KQI+D+I+EKLP++FNMVEI  KV  EER PYV+VAFQECERMN LTSE++RSLKELDLGLKGELTIT+DME L NSL++D +P  W++RAYPSL GL  W+ DL LR++ELE W+TDF LPS +WL G FNPQS LTAIMQ  AR+N+ PLD+M LQCDVTKK KE+    PRDG  VHG+FMEGARWD Q G+I E++LKEL PSMPVI I+AI  D+QDLRN+Y CPVYKT+ RGP T+V   NLKTK+KP KW
Sbjct:   19 DPRLELMGSFVIKSLKLKPEKWTRVVTVEEHKGIIKEFLDRNTPVVLIIILTPAA-QLVPSTTFPLSQLKSKGVYFIKRYALPIPREDCGN-FIIYGDLATRTIDQLSALVEEVLVPLLSNEDNYRNWPIMVAQDVQKHVHSLKSTVHQVKGQVSGETILAMPVGVEKIVKAAKELVETEQCQFDLYLKS---AIEGVVIKWATQIHEVIKESPSNAFANGQNPTPHTEFTFWNNRLKNLSFIYDQLRNERIRAMALILEYSMSAYHPCFQTLFKNVVTALAEAKDITLYLNPLKRPLQHLEEIDFAECKPLLIPFMNTVGILWGNSRYYCQSAKITVLLQEICNLIIHQAKRYLDPSSIFHSDIDEAMQRLTLSIQILKFFRELFDYYKERLATFFTEPEERPPILWTFHPNSVFKRFNAFLERLTTIQWFFFTVIEFLKLEKVEIGGLRGRQLSTRITDVYVEFNQYFTAFASKSYDVLDPDDHEFDEDFKGFQTRILELDMKLAAILCQAFDDCHNLESIFKLISIVGSVLDRPKIKEEFTQRYAEIVRMLDDEMTICESIYDKQMELKKVGDNLYP--NYNCPPVAAFIRWCHQLETRITAPVKNFKALQHEITKTEKSQEIVERYEILMVKLGSCKTQFFDDWAGQLDGQIEENLKKSLIARDRRHNSLILNFSAALFSILREVHYMQQMKIEGIPQIAIDFAEKSDVFRSYTLNLEKTIDWYNSIQEGSSPVELRLIEPEIKMIDDLVEIGVNQLVWNSSDI----LSYLDKLRKPVAALQNRMDHTQGNLRQIRKIMGVWAKQPLFERRDCKKDTVLSIDERPDRTSKRYAEIQAASIEIHKLLQDN--MLQFDMESKQDDAVWLSYVDFVDNIVYENILKTVGVSVGYLAENMDPENNYAPLFESRLELVEPNLVFVPSLDPEDPMGFNNMLIELMRDIMKMGSLIKRLK-PNEKRNYVEMIKENQDIIDMRREILNGVDLVMEEASRFCRQFERYSYLWLDDREECMEYFLEYGRMLDPDEIELILINDPNQPPPQPCQPTIEAFREQIDNYESLFNEIEDIGPFQVFSSWFQVDVRPFRQALLNTVCKWGNMFKEHLVTTVTSSLMNLSHFIRKADEGLLQTVKEKDYEGLVSIMAYLMQVKERAAKTDEMFEPMQETIQLLKYYDMDIPEEVNVLLQELPEQWANTKKIASTVKQQVSPLQATEVVSIRNKIALFESHIQLFREVFKTYDFFRFDCYKPYLLMDRINDDMFLCESEMRDIQESGSLFEVNIPEFKVLKQCRKELRMLKQLWDYVNIVATSIDDWKTTPWRKVDVENMDIECKKFAKDIRLLDKEMRPWDTFINLESTVKNMLTSLRAVGELQNPAIRERHWNQLMNSTKVKFIMDHETTLAELLGLNLHECEEEVKNIVDKAVKEMSMEKILRDLNTTWTVMEFDHELHPRTGCNLLKASEELIETLEDNQVCLQNLITSKYIAHFLEEVSTWQNKLMIADQVITVWFEVQRTWTHLESIFMSSEDIRKQLPVDSDRFDNIDAEFRVLMDEMSVSSNVVASTNRSGLIERLEHLQKELTLCEKALAEYLETKRLAFPRFYFVSSADLLDVLSNGIQPEMVTKHLTKLFDSIARLKFNRDESNEINTASG--MYAKDGEYVEFNELASIRGPVEVWLNRIQAAMRASLRHYVMEAVIAYEEKQREQWLFDYPAQVSLCGSQIWWSTEVNIAFSRLEEGYDNAIKDYYKKQISQLSLLITLLLGELSKGDRQKIMTICTIDVHSRDVVAKMIQAKLDSGSAFMWQSQLRHRFDDVEKDCFANICDAEFQYCHEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRAIGISVYVFNCSEQMDYQSCGNIYKGLAQTGAWGCFDEFNRITVEVLSVVAVQVKSVQDAIRDKKDKFNFMGEMISCVPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFQDARVLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPGRPEEEVLMRALRDFNIPKIITDDMPVFMGLISDLFPALDVPRKRDQDFERTVKQAASDLLLQPEDNFILKVVQLEELLEVRHSVFIVGNAGTGKTQVWKTLLRTYQNIKRKPIFNDLNPKAVTNDELFGIINPATREWKDGLFSVLMRDQANITGDQPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPSMRLLFEISNLRTATPATVSRAGILYINPQDLGWNPYVTSWVETRKIPAEKSNLVMLFDKYIPPSLETIRVRFKKITPVAEMAHIQMLCHLLNCFLIPANTPADCPKEWHELYFVFACIWAFGSAMFQDQAIDYRVEFSKWWVNEFKTVKFPPGGTVFDYFLDSETKTFLPWTEKIPKFELDSDLPLQAVIVHTSESIRLRFFLDLLMDKKHPVMLVGNAGCGKTVLVNEKLQSLSENYAVTTIPFNYYTTSEMLQKILEKPLEKKAGRNYGPPGNKLLCYFVDDINMPEVDAYGTVQPHTLMRQHLDYGHWYDRNKLTLKDIHNCQYVACMNPTSGSFTINPRLQRHFCVLAVSFPGPESITVMYSSILAQHFANAEQKFTPIVTRMTPNIVAATIALHNKCLQVFLPTAIKSHYIFNLRDISNVFQGLLFSSTECLTGSTDLIRLWQHETQRVYSDKLTDDKDIDSFTKMQHDIVKKSFEEIDESVIFDKPNIYCHFAGGIGDPKYMPIKGWPELHKLLQEAMSSYNDLVAAMNLVLFEDAMMHVCRINRILESPRGSALLVGVGGSGKQSLARLAAFISSLEVVQIQLKKGYGVNDLKNEFSGLYLKAGLKNVGIMFLMTDAQIPSEDFLVLINDMLATGEIPDLFPDDEIENIIAGVRNEVKGAGLVDTRENCWKFFIDRVRKQLKIVLCFSPVGSTLRVRSRKFPAIINATSINWFHEWPQEALISVAMNFLAQNKVLPENHRDSVAKFMAYVHTSVNTTSKVYLQNERRYNYTTPKSYLEQINLYIKLLNHKNEDLQSKIERLENGLEKLRSTALQVADLKVKLAVQEIELKEKNEAADALIEIVGIETEKVQTEKAVADEEEMKVALIADEVSKKQRDCEEDLLKAEPALMAAQDALNTLNKANLTELKSFGSPPGAVTNVTAAVMVLLSQGGKVPKDRSWKAAKIA-MAKVDTFLDSLINYDKENIHPEITKAIQPYLKDPEFEPEFVRSKSGAAAGLCAWVINIIKFYEVYCDVEPKRKALAAANAELAAAQDKLAGIKRKVMSLEEQLGKLTADFEKATADKLRCQQEADATQATIALANRLVGGLASENVRWAEAVNNFVKQGITLPGDILLITAFISYVGCFTKGFRIDLLLKMWTPFLKSIDPPIPTTENLDPLSLLTDDTTIAIWTNEGLPSDRMSIENATILSNSDRWPLMIDPQLQGVKWIKQKYGEDLKVIRLGQRSYLDIIEKSINAGCNVLIENIDENLDPVLDSLLGRNLIKKGKAIKIGDKEIEYNSNFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKAERPDLEELKADLTKQQNDFKIMLKKLEDDLLSRLSSAGENILGDTALVENLETTKSTASEIEQKVAEAKITSKEIDKAREYYRPAAARASLLYFILNELNTINPIYQFSLKAFSVVFQKAIAKAEPGDTLDLRVSNLIDCITYSVFQYTSRGLFECDKLIFASQMTFQILLMNEEVTSAELDFLLRFPIKPHVTSPVDFLTNQSWGGICSLASKDEFRNLDRDIETSSKRWKKLVESELPEKEKFPQEWKNKTALQRLCMIRALRPDRMTYALADFIEEKLGSKYVESRAMEFAKSYEEASPSTPIFFILSPGVNPLKDVEALGKQMGFSMDLGNFHNVSLGQGQEAIAEAAMDTAAKHGHWVVLQNIHLVRKWLPVLEKKLEYYAEDSHPDYRMFLSAEPASTPSAHIIPQGILESSIKITNEPPTGMLANLHKALDNFTQETLEMSGKEAEFKAILFSLCYFHAVVAERRKFGPQGWNKIYPFNVGDLNISVSVLYNYLEANAKVPWEDLRYLFGEIMYGGHITDDWDRRLCITYLEEYMQPDLVDGELFLAPSFPAPPNTDYQGYHTYVDEMMPAESPYLYGLHPNAEIGFLTTRAENIFRTVFEMQPRDAGAGGGATVTREDKVKQIVDEIIEKLPEEFNMVEIMNKV--EERTPYVIVAFQECERMNFLTSEMKRSLKELDLGLKGELTITSDMEVLENSLFLDQVPPIWTQRAYPSLLGLNNWFIDLCLRLRELETWSTDFVLPSCVWLAGFFNPQSLLTAIMQSTARRNDLPLDKMCLQCDVTKKQKEEFTTAPRDGCCVHGIFMEGARWDIQQGIIMESRLKELYPSMPVINIRAITQDKQDLRNMYECPVYKTRTRGPTTYVSNLNLKTKDKPGKW 4475          
BLAST of DNAHb-1 vs. Ensembl Fly
Match: Dhc93AB (gene:FBgn0013812 transcript:FBtr0336774)

HSP 1 Score: 5361.58 bits (13907), Expect = 0.000e+0
Identity = 2704/4486 (60.28%), Postives = 3436/4486 (76.59%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFP-TNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVS-------EGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAE--PVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVS----GNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEH----WKQYVDNIDDMIVENFQETINYSLQYMIDQI--EGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAH--GEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATK----------VKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXX-XXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGS---NFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGP-TFVWTFNLKTKEKPSKW 13431
            D R E +G +V+KSLK K +K+ ++   +E K ++ +F ++     L ++  P    L     FP + LKSK  +F K+    I R+   N  +I+GD++   +DQ S+ V+EV++P+LSN  N  +WP +++ DV +H +SLK     V GQ  G+T+L +PVG EK+        E +   F    +S   AIE VVI+WA QI +V+ +  S     G NPTP  E  +W  R  NL  IY+QL + +++ MA +LEY  S Y P F+ +FK+VV AL E+++I LYL PL+  L+ +E+++F+E +P++ P  + + ++W + + Y    +I VL QEI NLII+    YLDP  IF  + +EA++++  S++IL  F+E F+ ++E++  +F +  E  P+ W F  N +F R N+F+ R+  ++W     +EF KLEKVEI G++GR LS  I D++ EF   F  F  ++YD LDP + +F +D+  F+  I +LD +LA  + QAF DCH  +++FKLI I G +LDRP +K EF +RY E+V+MLD+EM   + +YD  +     G+   P  + N P V   + WC ++  RI  P+     L H+  KT +   +V++++ L+  L   + +++++W   +D     NL + L+ R+     + +NF   L ++LREV Y++ +  E IPQ A D   K+D  R Y  NL+  ++WYN +++ +  VE  LIE E+  ID+ +E  +  L WNS  +      Y++++R  V  L++R+  ++ N+  IR IM  W K PLFER++ K DT+L++D+R DR +KRY EI  A   +H L+++N  +L+ D  S+     W  YVD +D+++ EN  +T+  S+ Y+ + +  E +  PLFE  ++L    +VF PSLD +    F+ ++  L+ DI K  S +KRL   +   +Y   ++EN+++   R EI    ++  E+A  +  +F+ YS LW D+REE M  FL YG+ +  +E+E     + +    +   PT++ F+ QID YE  F EIE +  F +   WF++D R F+QA LNT+ +W  MFK+HL+  VT+SL  L+ FI+  + GL +   E D+EGLV +M +L  VKER   TDEMFEP+++TI LLK Y+ ++P+EV++ L+ELPE+W NTKK+A TVKQ V+PLQ  EV +IR K A F+     FRE F+  D F F C + Y  +DR + ++   E  M ++ ES +LFEV +PEFK LKQCRKELR+LK LWD++N+V +SI+ WK T W+ ++VE MD +CK FAK IR LDKEMR WD +  +E  +KNM+TSLRAV ELQNPAIR+RHW QLM +TK          VKF M+  TTL +LL LNLH  E+EV++IV+KAVKEMSMEK+L++L +TW+ MEF+HE H RTG  LLKASEELIETLE++QV LQN++TSKYI+HF +EV +WQ  L  ADQVI +WFEVQRTW+HLESIF+ S+DIRKQLP DS+RFD ID +F+ L+ E+  ++NVV +T +  L ERLE +Q EL LCEKALAEYLETKRLAFPRFYFVSSADLLD+LSNG  PE+V KHLTKLFDS+A+LK    E+ E NT  G  MYAKDGE VEF     + G VE WLNR+   MR ++R  + E+V + EEK R+QW+F++PAQV+L  SQI W TEV ++F+RLEEGY+NA+KD+ KKQI+QL+ LITLL+GELSK DRQK+MTICTIDVH+RDVV K+I  K+D+  +F W  QLRHR+ D +KDC+ NICDA+F+Y HEYLGNTPRLVITPLTDRCYITLTQSLHL M GAPAGPAGTGKTETTKDLGRA+GI VYVFNCSEQMDY+S GNIYKGLAQ+G+WGCFDEFNRI+VEVLSVVAVQVK +QDAI++K+ +F+F+GE IS    +GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGF  AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DP RPE++VLMRALRDFNIPKI+TDD PVFMGLI DLFPALDVPRKRD +FE+ V+QA  DL LQ E+NF+LKVVQL+EL  VRHSVF++GNAGTGK+ VWKTL++TY N+K+KP+  DLNPKAVTNDELFGIINP+TREWKDGLFSV+MRD AN+T D PKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI LTP+MRLLFEIS+L+TATPATVSRAGILYINPQDLGW P+V SW+ TR+I +E++NL +LFDKY+P  LE +++RFKKITP+ E++H+QMLCHLL   L+P NTPADCPKEW+ELYFVF  IWAFGS MFQDQ +D+RVEF+KWWV EFKT+K P  GTVFDY++D+ETK F PWT+++ KFE+D + PLQAV+V TSE+ R R+FLDLL++K+ PVMLVG AG GKTVL+ +KL S+ +NY V  +PFN+YTTSEMLQ++LEKPLEKKAGRNYGP G+K L YF+DD+NMPEVD Y TVQPHTL+RQH+DY HWYDR KLTLK+IHN QY+ACMNPT+GSFTI+PRLQRHFCV A+SFPG ES+  +YS+IL++   +    F+  + +   N+V   +  HNK    FLPTAIK HY+FNLRD+SN+FQG+LF+  +C+   +DL+RLW HE +RVY+DKL DD DI+++ ++Q ++ KK+FEE+DE V+F KP +YCHFA GIG+PKYMP++   +L K+L+EA+ SYN++ AAMNLVLFEDA+ H+ RINRILESPRG ALLVGVGGSGKQSL+RLAAFISSL+V QI L+KGYG+NDLK + + LY+KAG+KN+G++FL+TDAQI  E FLVL+ND+LA+GEI DLFPDDE+ENII+ +RNEVK  G++D+RENCW FFI++VR  L++VLCFSPVGSTLRVR+RKFPA++N TSI+WFHEWP++ALISV+  FL + ++LPE+++DS AKFM++VH +VN  S  YLQNERRYNYTTPKS+LEQI LY  +L  K+ +LQ K+ RLENGL+KL STA QV DLK KLA QE+EL++KN +A+ L+E V  +T+KV +EK +AD EE KV+ I  EVSKKQ+DCE DL KAEPAL AAQ+ALNTLNK NLTE+KSFG+PP AV +V+AA M L++  GKVPKDRSWKAAK   M K+D FLD+LINY+K+NI     KA + Y KDP F PE ++SKS AAAGLC+WVINII +YE++CDV+PKR AL AAN EL  A +KL+GI+ K+  LE+QL KL  +FEKA +DK RCQ EAD T  TI LANRLVGGLASENVRW + V  +  +  TLPGD+L+  AF+SYVGCFTK +R+ L+   W PFL ++ P IP T+NLDPL +L DD  IA W NEGLPSDRMSIENATIL+N++RWPL+IDPQLQG+KWIK ++G DLKV+RLGQ+ YLD+IE++++AG  VLIENI+E++DPVLD LLGRN IKKG+AIK+GDKE EYN  FRLIL TKLANPHYKPEMQAQTT+INFTVTRDGLEDQLLA VV  ER DLE LK DLTKQQN FKI LK+LED LL RLS+A  N LGD ALVENLE  K TA EIE+KV +AKIT   I++ RE YRPAAARAS+LYFILN+LN INP+YQFSLKAF VVF+KAI +AEP + L  RV NLID IT+SV+ YTSRGLFE DKLIF +QM+FQILL  +E+   ELDFLLRFPI P++TSP+DFL+N SWGGI +L++ +EF+NLDRDIE S+KRWKK VESE PEKEKFPQEWKNKT+LQRLCM+RALRPDRMTYA+ADF++EKLG KYVE   +EF++S+EE+ P+TPIFFILSPGV+PLKDVE LGK++GFS D  NF N+SLGQGQE +AE AMD  AK GHWVVLQNIHLV KWL  LEKKLE YAE+SH  YR+F+SAEP+ +P +HIIPQGILE++IKITNEPPTGMLANLHK+L+NF QET+EM  KE EFK ILF+LCYFHAVV+ERRKFGPQGWN+ YPFN GDL ISV+VLYNYLEAN+KVPWEDLRYLFGEIMYGGHITDDWDR+LC TYLEEY+QP+++DGEL + P F  PPNTDY+GYH Y+DE +PAESPYLYGLHPNAEI FLT+ ++ +F+TVFEMQPRD+   G   ++RE+++KQI+D+I+EKLP++FNMVEI  KV  EER PYV+VAFQECERMN LTSE++RSLKELDLGLKGELTIT+DME L NSL++D +P  W++RAYPSL GL  W+ DL LR++ELE W+TDF LPS +WL G FNPQS LTAIMQ  AR+N+ PLD+M LQCDVTKK KE+    PRDG  VHG+FMEGARWD Q G+I E++LKEL PSMPVI I+AI  D+QDLRN+Y CPVYKT+ RGP T+V   NLKTK+KP KW
Sbjct:   19 DPRLELMGSFVIKSLKLKPEKWTRVVTVEEHKGIIKEFLDRNTPVVLIIILTPAA-QLVPSTTFPLSQLKSKGVYFIKRYALPIPREDCGN-FIIYGDLATRTIDQLSALVEEVLVPLLSNEDNYRNWPIMVAQDVQKHVHSLKSTVHQVKGQVSGETILAMPVGVEKIVKAAKELVETEQCQFDLYLKS---AIEGVVIKWATQIHEVIKESPSNAFANGQNPTPHTEFTFWNNRLKNLSFIYDQLRNERIRAMALILEYSMSAYHPCFQTLFKNVVTALAEAKDITLYLNPLKRPLQHLEEIDFAECKPLLIPFMNTVGILWGNSRYYCQSAKITVLLQEICNLIIHQAKRYLDPSSIFHSDIDEAMQRLTLSIQILKFFRELFDYYKERLATFFTEPEERPPILWTFHPNSVFKRFNAFLERLTTIQWFFFTVIEFLKLEKVEIGGLRGRQLSTRITDVYVEFNQYFTAFASKSYDVLDPDDHEFDEDFKGFQTRILELDMKLAAILCQAFDDCHNLESIFKLISIVGSVLDRPKIKEEFTQRYAEIVRMLDDEMTICESIYDKQMELKKVGDNLYP--NYNCPPVAAFIRWCHQLETRITAPVKNFKALQHEITKTEKSQEIVERYEILMVKLGSCKTQFFDDWAGQLDGQIEENLKKSLIARDRRHNSLILNFSAALFSILREVHYMQQMKIEGIPQIAIDFAEKSDVFRSYTLNLEKTIDWYNSIQEGSSPVELRLIEPEIKMIDDLVEIGVNQLVWNSSDI----LSYLDKLRKPVAALQNRMDHTQGNLRQIRKIMGVWAKQPLFERRDCKKDTVLSIDERPDRTSKRYAEIQAASIEIHKLLQDN--MLQFDMESKQDDAVWLSYVDFVDNIVYENILKTVGVSVGYLAENMDPENNYAPLFESRLELVEPNLVFVPSLDPEDPMGFNNMLIELMRDIMKMGSLIKRLK-PNEKRNYVEMIKENQDIIDMRREILNGVDLVMEEASRFCRQFERYSYLWLDDREECMEYFLEYGRMLDPDEIELILINDPNQPPPQPCQPTIEAFREQIDNYESLFNEIEDIGPFQVFSSWFQVDVRPFRQALLNTVCKWGNMFKEHLVTTVTSSLMNLSHFIRKADEGLLQTVKEKDYEGLVSIMAYLMQVKERAAKTDEMFEPMQETIQLLKYYDMDIPEEVNVLLQELPEQWANTKKIASTVKQQVSPLQATEVVSIRNKIALFESHIQLFREVFKTYDFFRFDCYKPYLLMDRINDDMFLCESEMRDIQESGSLFEVNIPEFKVLKQCRKELRMLKQLWDYVNIVATSIDDWKTTPWRKVDVENMDIECKKFAKDIRLLDKEMRPWDTFINLESTVKNMLTSLRAVGELQNPAIRERHWNQLMNSTKSLAALPKEVTVKFIMDHETTLAELLGLNLHECEEEVKNIVDKAVKEMSMEKILRDLNTTWTVMEFDHELHPRTGCNLLKASEELIETLEDNQVCLQNLITSKYIAHFLEEVSTWQNKLMIADQVITVWFEVQRTWTHLESIFMSSEDIRKQLPVDSDRFDNIDAEFRVLMDEMSVSSNVVASTNRSGLIERLEHLQKELTLCEKALAEYLETKRLAFPRFYFVSSADLLDVLSNGIQPEMVTKHLTKLFDSIARLKFNRDESNEINTASG--MYAKDGEYVEFNELASIRGPVEVWLNRIQAAMRASLRHYVMEAVIAYEEKQREQWLFDYPAQVSLCGSQIWWSTEVNIAFSRLEEGYDNAIKDYYKKQISQLSLLITLLLGELSKGDRQKIMTICTIDVHSRDVVAKMIQAKLDSGSAFMWQSQLRHRFDDVEKDCFANICDAEFQYCHEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRAIGISVYVFNCSEQMDYQSCGNIYKGLAQTGAWGCFDEFNRITVEVLSVVAVQVKSVQDAIRDKKDKFNFMGEMISCVPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFQDARVLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPGRPEEEVLMRALRDFNIPKIITDDMPVFMGLISDLFPALDVPRKRDQDFERTVKQAASDLLLQPEDNFILKVVQLEELLEVRHSVFIVGNAGTGKTQVWKTLLRTYQNIKRKPIFNDLNPKAVTNDELFGIINPATREWKDGLFSVLMRDQANITGDQPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPSMRLLFEISNLRTATPATVSRAGILYINPQDLGWNPYVTSWVETRKIPAEKSNLVMLFDKYIPPSLETIRVRFKKITPVAEMAHIQMLCHLLNCFLIPANTPADCPKEWHELYFVFACIWAFGSAMFQDQAIDYRVEFSKWWVNEFKTVKFPPGGTVFDYFLDSETKTFLPWTEKIPKFELDSDLPLQAVIVHTSESIRLRFFLDLLMDKKHPVMLVGNAGCGKTVLVNEKLQSLSENYAVTTIPFNYYTTSEMLQKILEKPLEKKAGRNYGPPGNKLLCYFVDDINMPEVDAYGTVQPHTLMRQHLDYGHWYDRNKLTLKDIHNCQYVACMNPTSGSFTINPRLQRHFCVLAVSFPGPESITVMYSSILAQHFANAEQKFTPIVTRMTPNIVAATIALHNKCLQVFLPTAIKSHYIFNLRDISNVFQGLLFSSTECLTGSTDLIRLWQHETQRVYSDKLTDDKDIDSFTKMQHDIVKKSFEEIDESVIFDKPNIYCHFAGGIGDPKYMPIKGWPELHKLLQEAMSSYNDLVAAMNLVLFEDAMMHVCRINRILESPRGSALLVGVGGSGKQSLARLAAFISSLEVVQIQLKKGYGVNDLKNEFSGLYLKAGLKNVGIMFLMTDAQIPSEDFLVLINDMLATGEIPDLFPDDEIENIIAGVRNEVKGAGLVDTRENCWKFFIDRVRKQLKIVLCFSPVGSTLRVRSRKFPAIINATSINWFHEWPQEALISVAMNFLAQNKVLPENHRDSVAKFMAYVHTSVNTTSKVYLQNERRYNYTTPKSYLEQINLYIKLLNHKNEDLQSKIERLENGLEKLRSTALQVADLKVKLAVQEIELKEKNEAADALIEIVGIETEKVQTEKAVADEEEMKVALIADEVSKKQRDCEEDLLKAEPALMAAQDALNTLNKANLTELKSFGSPPGAVTNVTAAVMVLLSQGGKVPKDRSWKAAKIA-MAKVDTFLDSLINYDKENIHPEITKAIQPYLKDPEFEPEFVRSKSGAAAGLCAWVINIIKFYEVYCDVEPKRKALAAANAELAAAQDKLAGIKRKVMSLEEQLGKLTADFEKATADKLRCQQEADATQATIALANRLVGGLASENVRWAEAVNNFVKQGITLPGDILLITAFISYVGCFTKGFRIDLLLKMWTPFLKSIDPPIPTTENLDPLSLLTDDTTIAIWTNEGLPSDRMSIENATILSNSDRWPLMIDPQLQGVKWIKQKYGEDLKVIRLGQRSYLDIIEKSINAGCNVLIENIDENLDPVLDSLLGRNLIKKGKAIKIGDKEIEYNSNFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKAERPDLEELKADLTKQQNDFKIMLKKLEDDLLSRLSSAGENILGDTALVENLETTKSTASEIEQKVAEAKITSKEIDKAREYYRPAAARASLLYFILNELNTINPIYQFSLKAFSVVFQKAIAKAEPGDTLDLRVSNLIDCITYSVFQYTSRGLFECDKLIFASQMTFQILLMNEEVTSAELDFLLRFPIKPHVTSPVDFLTNQSWGGICSLASKDEFRNLDRDIETSSKRWKKLVESELPEKEKFPQEWKNKTALQRLCMIRALRPDRMTYALADFIEEKLGSKYVESRAMEFAKSYEEASPSTPIFFILSPGVNPLKDVEALGKQMGFSMDLGNFHNVSLGQGQEAIAEAAMDTAAKHGHWVVLQNIHLVRKWLPVLEKKLEYYAEDSHPDYRMFLSAEPASTPSAHIIPQGILESSIKITNEPPTGMLANLHKALDNFTQETLEMSGKEAEFKAILFSLCYFHAVVAERRKFGPQGWNKIYPFNVGDLNISVSVLYNYLEANAKVPWEDLRYLFGEIMYGGHITDDWDRRLCITYLEEYMQPDLVDGELFLAPSFPAPPNTDYQGYHTYVDEMMPAESPYLYGLHPNAEIGFLTTRAENIFRTVFEMQPRDAGAGGGATVTREDKVKQIVDEIIEKLPEEFNMVEIMNKV--EERTPYVIVAFQECERMNFLTSEMKRSLKELDLGLKGELTITSDMEVLENSLFLDQVPPIWTQRAYPSLLGLNNWFIDLCLRLRELETWSTDFVLPSCVWLAGFFNPQSLLTAIMQSTARRNDLPLDKMCLQCDVTKKQKEEFTTAPRDGCCVHGIFMEGARWDIQQGIIMESRLKELYPSMPVINIRAITQDKQDLRNMYECPVYKTRTRGPTTYVSNLNLKTKDKPGKW 4485          
BLAST of DNAHb-1 vs. Ensembl Fly
Match: kl-5 (gene:FBgn0267433 transcript:FBtr0346772)

HSP 1 Score: 4288.03 bits (11120), Expect = 0.000e+0
Identity = 2164/3631 (59.60%), Postives = 2777/3631 (76.48%), Query Frame = 1
Query: 2608 ELLKADSVSEH--WKQYVDNIDDMIVENFQETINYSLQYM---IDQIEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIG----SSMEDYR--TDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAH----GEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKP--RLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKD-GEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSI-GDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGS---NFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSG-AGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            ELLK  S  E   +++Y   +D++I EN  +++  S  Y+   +D    +  P+FE+ M+LQ   +V+  +LD      F+  +++++ D+    S +KR+A      ++M  Y    +L++  EL K+R EI  + ++A +  +++   F E+S+LW  ++  ++S+  ++G+ ++ +E +A     G   +       P L  +K Q+DK+ +  ++I     +     + R++   FK A L+ + +W  +FK  LI+ V NSLKEL +F+   N  L  E  + DFEGLV+++  L  + E+Q   D MF+PLK+ IDLL+ YN E  D    Q+ ELP+ W   K++A T KQ +AP+Q+ +V  I ++    D   +T+R++F     F   CL  YE +D   +E+  LE+    L ESA LFE+  P+  +++ CR +L+L+KI+WD    + S+I  WKKT WK I++E MDQ+CK F + +R LDK MR+W+ +  +E  +KN+MTSLRAV ELQNPAIRDRHW +LM  TKVKF M++STTL+DL+ LNLH +E+EV++IV+K+VKEM+MEK L+++ + W  MEF  + H RT I LLKASEELIETLE+ Q +LQNM +SKYI+ F  EV  WQ  LS ADQ+I  WFEVQR W +LESIFIGS+DIR QLPEDS RFD ID +FKAL+ ++    NVV++T +   +LYE LE++   L+LCEKAL +YLETKRL++PRFYFVSSADLLDILSNGN+P +V +HLTKL+DS+ KL  +       +K    M AK+  E V F  NCD  G+VE WLNR+ ++MR T+R  L  S++  + K R  WIFE+PAQ AL  +QI W TE   +FA++++ YENALKD+NKKQITQLN LI LL+G+L+  +RQK+MTICTIDVH+RDVV  +I +K++   +F W  QLRHRW     DC+ NICDAQFRY +EYLGNTPRLVITPLTDRCYITLTQSLHL M GAPAGPAGTGKTETTKDLGRALG+MVYVFNCSEQMDYKSIG+I+KGLAQ+G+WGCFDEFNRISVEVLSVVAVQVKCIQDAIK+K++ F FLGE I+L + +G+FITMNPGYAGR ELPENLKAL+RPCAMVVPDF LI EIMLVAEGF +AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAGAL+R D  RPEDQVLMRALRDFNIPKIVTDD PVFMGLIGDLFPALDVPRKR+PEFE  ++++ LDLKLQ E+ F+LK+VQL+ELFAVRHSVF++G AGTGKS VWKTL KTY N K+KP   DLNPKAVTNDELFGI+NPSTREWKDGLFS++MRD ANL   GPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI LT  MRLLFEI+ L+TATPATVSRAGILYINPQDLGW PF+ SW+ TR   SE + L +LFDKYVP  L+  + R + ITPI +I+ +QM C+LL+ +L P+N P DCPK+WYE+YFVFC +W FGS +FQDQ++D   EF+KW++ E+K +K P  GT+F +YID ETKKF PWT  + +FE+D++ PLQ+ LV T+ETTR R+F+D LIE   P+ML+G +G+GKT+L+  KL+++  D Y V NVPFNFYTTSEMLQR+LEKPLEKKAGRNYGP G+K++IYF+DDMNMPEVDKYFTVQPHTLIRQ +DY HWYDR K+TL++IH    +ACMNP+AGSFTI PRLQRHFC FA++ P Q++L  I ++ILS+ + +    F  +++K   N+V  A+  H K+ S+FLPTAIKFHY FNLRD++NIF G+L++  +     + ++RLW+HE  RVY DKL+D  DI +++++  ++ +K  E +++ V++ +PL+YCHFA+G+ + KYMP+   + L  +L EA + YN+   AMNLVLF+DA++H+ RI+RILES RGYALL+GVGGSGKQSL+RLA+FISSLDVFQI L K Y ++DLK ++A LYMKAGVK     FL+TD+++A E+FLVLVNDLLASG+I +LFPDDE+ENI++++RNEVK  G++D+RENCW +FI KVRS L++VLCFSPVG+TLRVR+RKFPA+VNCT+IDWFHEWP+ AL SVS RFL E+ +LP++     + FM+FVHK VN +S  YL N +RYNYTTPKSFLE IALYS +L +K      +  RLENGL KL S  ++VD L+  L  QEVEL+ KN  A+ L+  V T+ +KVS E+  A  EE+ V +I+ +V+ K + CE D  KA+PAL AAQEALNTLNKNNLTE+KSFG+PP AV+ V  A + L ++ GK+PKDRSWKA +A  MG +D FLDNLINY+K +I    +KA + Y  D  F+PE+I +KS AAAGLCSWVINI  +Y+++  V+PK  AL  + +E+++A +KL+ +  ++ +LE+QL  LQ E+++A + KQ+CQDEA  T  TI++ANRL+GGLA+E +RW + V+      + LPGD+L+   F+SYVGCFT+ YR  L +  W+P   N  P IP T  +DP +M+ DDA IA WNN+GLPSDRMS ENA IL  +ER+PL+IDPQLQGIKW+KT++G  L V+RL Q+ YLD +E+AVS G V+LIENI E++DPVL+ LLGR  IKKG  +K+GD+E ++N  FRLIL TKLANPHYKPEMQAQTT+INFTVTRDGLEDQLLA VV  ER DLE ++  LT+QQN FKITLK LED LL RLS+A  N L D  LV NLE  K+TA EIE KV +AKIT V I+  RE YRPAA RAS++YFILNDL KINP+YQFSLKAF VVF  A+ +A  +E+LK RVENLIDSITF  ++YTSRGLFE+DKLIF  Q+  QIL+   E+ P ELDFLLRFP +PN TS   +L++  WGGI+AL+    FK L++DIEGS KRWKKFV+SE+PE EKFP EWK K+++QRLC+MR +RPDRM+YA+  F++EKLG KY++   +EFS++FEES P T IFF+LSPGVDPLKDVE LGK LGFS D++NF ++SLGQGQEIVAE A+++ ++ GHWV+LQNIHLV++WL +LEKK+E      H SYR+F+SAEP+G P +HI+PQGILE+AIKITNEPPTGM+AN+HK+L+NF+ ET+EMC+KE EFK ILF+LCYFHAVV+ERRKFGPQGWNRSYPFN GDL ISV VLYNYLEAN++VPWEDLRYLFGEIMYGGHITDDWDR+LC+TYLEE++QPE++DGEL    GF  P    Y GYHNYID+ LP+ESP LYGLH NAEI FLT++S++LF+ VFE+QPR + G +G   +S+E+ IK I++DI++K P  FN++E+  +V  E+R+PY++VAFQECERMN L +E++RSL ELDLGLKGELTI++ ME L   LYMD +PE W+K AYPS+ GL  W++DL+LR++ELE W  DF++PS IWL G FNPQS LTAIMQQ ARKNEWPLDRM L CDVTKK KE++   PR+GAY++GLFMEGARWD + G IA+A LKEL P+MPV++IKA+  D+QD++NVY CPVYK + RGPTFVWTFNLK++E+ SKW
Sbjct:  926 ELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLIS-----GSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQPLIYCHFAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRA-FMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRV--EDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPTFVWTFNLKSRERASKW 4548          

HSP 2 Score: 285.419 bits (729), Expect = 5.380e-76
Identity = 213/839 (25.39%), Postives = 415/839 (49.46%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSE-------GDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLN-PTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGA--EPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETD--FLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEME-------NDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEF-NXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPL---LIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDRE 2532
            D R EF  +Y+ K+++ K DK+ K+  T+E + ++++F   P  + + +     GG L     FP   + K  +F +        D      L+ GD+   PL   S   DEV  P+L+N  NQ  W +VI++D+   +  +++    + G    +T+ PLP+  ++V +       GDI+    + +   +++E +V++W   ++D+++ ++ E++ +  N P P     +W++R  NLE + EQL   ++K +  +LE + S +   ++ I + V+ +L E+++I   L+PL+ ++++ E  +  E    I PL   + L+W H + +     + +      N +I+C +  ++P  IF+G+ +EA +K++ +++ L  +K  +   R  +K+ FK G      +W +  + IFGRL+ F+ R+E +K + N   +F KLEK+ + G+KGR ++  +  + EE+ +I++ +T   Y+ +DP   +  F +D   FKA  D ++R ++    +   D H              LL RPI+K   +     +V   +EE+        N K V+     G  ++P      PKV+G + + K++R RI     +  H +H+ ++   F N       ++  ++ +    +    L      C   + Q +   LI   +   + VNF  +L   L+++K +++L   ++  + T    + D L +    L  + EWYN   +     E+ LI  E+  I+EQ++  +  + WN+      + ++I  +  +V  L  R+V ++EN++ I+  + +W K PLF+RK+     LL+ D RE
Sbjct:   12 DNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRI-IFTINSGGQLYPSYSFPVRPRYKVAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVNQVGWTNVIANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVNPLMK---HSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHLEYYKLIYNECRNSLKK-FKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERMVSFQFEKGLEDTHDLLLAGS-------LLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKEFINFKNVFT--ALGLNELPT-DDCFPKVSGAISFLKKLRHRI-----IGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLIEKDEANELRVNFTERLIFALKDIKVVRLLGC-DVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNA-----FSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPRE 824          
BLAST of DNAHb-1 vs. Ensembl Fly
Match: CG3339 (gene:FBgn0039510 transcript:FBtr0273192)

HSP 1 Score: 4002.98 bits (10380), Expect = 0.000e+0
Identity = 2190/4718 (46.42%), Postives = 3044/4718 (64.52%), Query Frame = 1
Query:  289 KSKACFFTKKAKESISRDAA-FNKVLIFGDIS-YTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGEVPRSIIYA---------IETVVIEWAHQIDDVLSKQSSEQLM------AGLNPT-------PFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREK------VKEYFKDGAEPVE-----------WQFASNLIFGR-LNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETD---FLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMEN-----DKLVYDIHVSGNEKVPKIHKNMPKVTGELEW------------CKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKIL--------DQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKN-TLTVEQPLIENELNQIDEQLEKAITNLCWNS--DALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERK-EGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENS-----------ELLKAD-SVSE-----------HWKQYVDNIDDMIVENFQETINYSLQYMIDQIE-------------------------------------------------GSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIG-----------SSMEDYRTDL------EENEELQKKRNE--------------------------ISERTEVATEKAKLYQ------------------AKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVK----QHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKH-SRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGK-PRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDG-EMVEFTN-NCD------LGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWAD------------------TDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADC------------PKEWY-------------ELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTK----RMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLL-----------------------------QDKLNSIGDNYV--------------VANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKK-LIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGS---NFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGIL---------------FAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVE-LLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEG--HWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXX----RVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            + K  +F ++        A+ F + +++GD   ++ ++  S   D+V+ P+L  A++Q  WP+++  D+      +++    + G++  +T+L L V    V E     F  V +  +           +E + I W  Q+ D++ ++S  Q +      AG  P        P  E+ +W  R  NL+ IYEQL     K +A +LE ++S Y  P+   F+ +VAA  E+Q+++L+L PL  Q      V+FS    ++ PL H++ L+W++ + YR  +R+ VL + I N++++     L+ + +F+G+ +E L K+ R++ +L  FK+    ++E+      +     +GA  V            W+F    +FG+ L+ F  ++  ++ +  A ++F +LEK+E+ G++G+ L++ + ++F EFK +F+ ++    D    + +    F ++   F + +  L+++LAT + QAF  CH +  + +L  +FG LL R  ++ E  +    ++ + D EME       +++    + G   +P +  N P +   + W             KE+ + ++  L   S L        ++N ++ + + L   L   +MK + +W   VD+     L + +L R+ D   + +NF   L  +L+E KYL  L        D  ++P+    ++   D   +    L  + E+YN +R       E  LI N+L  IDE +E A   L W +  D L  G +   EQ RDL     +R+ +S  N+D I   M  W + PL +R   G+   LL+L  ++DR   R  +  E    ++ L+  N            +L   D SV E            + +Y+ ++D++I    +E +  SL+Y+  ++                                                   +  PLFEV ++L   EI F P+ D    +NF ++V+ L+ DI +    + R+              ++  DY  +L      +  +ELQ+++ +                           S++ E   +  ++ +                  AKF  Y+ LWT    E ++  ++     +A E   H      A       ++ FK +I+ Y +  + I++      I+ W  +D +  K   LN   +WS M K+ L+ +V  +LKEL  FI      L    A  DF  L+ ++  +  ++ER+   D +F+PLK+ + LLKTYN E   ++   +E+LP++W   K  +   ++    LQ+      +R  A   +     QH  R QF+KM  F   C + Y+  D  ++ +    +        A L ++  P+   L+ C  ELR +K LWD + V+ S I  W  T W  I+ + M+ +CK F + +R+LDK +R W  Y  +   ++ ++ SLRA+ ELQNPAI +RHW +LM  TK+ +  N+ST L  LL L L + E+++++ V++A+KEM++ KVL E+ +TW+ +EFE E+H +R  I LLK SEELIETL+++Q++LQN+ TSK+I +  D++  WQK L   D +I  WFEVQR W +LE IFIGS DIR QLP D+  F+RID DF AL+ +V+E   V++   +   +  +L  +Q  L +CEKAL +YLETKRLAFPRFYF+S+ADLLDILSNGN+P+++ +HL KLFDS+ +L++       NT   + M++K+  E V F + + D       GG+VE WL  ++++MR+T+  +   ++    EK R+ W++++PAQVAL  SQI+W  +V  SF  +EEGYE  +K+ +K+QI QLNALI LL+GELS  DRQK+MTICTIDVH+RDVV K+I  K+DNS +F W  QLRHRW D                   D+DC+ NICDA+FRYA+EYLGNT RLVITPLTDRCYITLTQSL L ++GA AGPAGTGKTETTKDLGRALG+MVYVFNCSEQMDYKS GNIYKGLAQ+G+WGCFDEFNRI VEVLSVVAVQVK IQ+AIK  + +F F+GE ISL+ ++GIFITMNPGYAGRTELPENLK LFRPCAM+VPDF LICEIML+AEGF  AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG LKR D  RPEDQVLMRALRDFNIPKIVT+D P+FMGLIGDLFPALDVPRKR  EFEK +R+A  ++KLQ EE F++KVVQLQEL  VRHSVF++GNAGTGK+ +W+TL +TY   K KP+   LNPKA++NDELFGI+NP+TREWKDGLFS IMR+ AN+    PKWIVLDGDIDPMWIESLNT+MDDNK+LTLASNERI L   MRLLFE+ HLK ATPATVSRAGILYINPQDLGW P+V+SW+ TR    E+  L  LF+KY P CL   +  F++ITPI +++ +QM CHLLE LL  +   AD             P   +             E  FV+  +W+FGS + QD ++D   EF KWW+ EFK IKLP+QGTVFDY ++ +T KF+PW++    +  + ++D E PLQ VL+ T+ET R  YFL LLI++    MLVG +G GK  +                              Q   N  G   V              V    FNFYT+SE+ Q++L++PLEKK+GR Y PSG K+ LIYF++D+NMPEVD Y TVQPHT++RQ +DY  WYDR +L LK+I + Q+ ACMNPTAGSFTI PRLQRHFCVF+++ PG+++L  IY +ILS  L S    F+  +    S LV + +  H ++   FLPTA+KFHY+FNLRDL+ I+QG++                 G     +PS+L+RL++HE  RVY+D+L+D  DI++++   +++ KK FE+ DE  +F +PL+Y HFAQ + + KYMP++  + L ++L EA  SYNEV   MNLVLFEDA+ H+ RINRILESPRG ALL+GVGGSGKQ+L+RLAAFISSL+V QI +++G+G+ D++ ++  LYMK G+KN+  VFL++DAQI DE  L+L+NDLLASGEI +LF DD+++ I + +RNEVK +G +D++ENCW +F+ KVR  L++VLCFSPVG TLRVRARKFPA+++ T+IDWFHEWP+ AL SVS +FL E+  +L          FM++VH  VN++S  YLQNE+RYNYTTPK+FLE I LY  +L  K+ E   +++RL++G+ KL   A+QVD LK +LA QEV+L  KNA+A++L+  V+ +++KV  E+ IA  EE++V  I+ +VS K + CE DL +AEPAL AAQ ALNTLNKNNLTE+KSFG+PP AV++V AA M L+A+NGK+P+DRSWKA+K  +M ++D FL++L+NYNKDNI    ++  +EY KDP FNP+++  KS+AAAGLC+WVIN+  Y+++F  V PK+ AL+ +++EL EA E+L  ++ KI  LE +L ++Q EFE A  +KQRCQ EAD T  TI+LA+RLV GLA+ENVRW + V+    +  TLPGD+L+  +FLSYVGCFT+ YR  L    WLP    + P IP T+ +D L +  DDA IA+WNNEGLP DRMS ENATIL  + RWPL+IDPQLQGIKWIK R G DL V+RL QKG+L+ +E+++S GD VLIE IEESMD VL+ LL R  IKKGR +++GDKE E++  FRLIL TK+ANPHYKPEMQAQTT+INFTVT DGLE+QLLA VV  ER DLE +K ++T QQN+FKI+LK LED LL RL+++  N L D+ALV NLEN KRT  EIE KV +A++T + I++TR +YR AA RA++LYF+L DL++INP+Y+FSLK+F  VF +AI  A  S+  + RV +L++SIT   Y YT RGLFE DKL FT+ M+ +IL+  +++   E DFLLRFP  P   SP+DF+  ++WGGIK+L+ +E F  +D+D+E   KRW+KF+ S+TPE+E+FP EWK++T LQ+LC++R+LRPDRMTYA+  FV++ +G  Y E     F   F+E   ATP FFILSPGVDP++DVE  G++ GF  ++    NISLGQGQE++AE+A+ +GA E    WV+LQNIHLV  WL  LEK +E    +S        R+FISAEP+  P+ H+IPQGILE+++K+ NEPP+GM ANLHK+ +NF+Q+ +E C +E EFK+ILFALCYFHAV  ERRKFGPQGWN+ YPFN GDL IS NVL+NYLE ++++PWEDLRYLFGEIMYGGHITDDWDR+LC+TYLEE LQ +++DG+  + PGF  PPN D++GYH+YI E LP ESP LYGLHPNAEI FLT+ S++L +T+FE+QPR+S  +   G  REE +K ++DD ++KL D+FN+  +  +V  E + P+VVVA QECERMN L  EI+RSL+EL LGL+GELTIT +ME L ++++ D +P +W++ AYPS+ GL  W+ADLL RIKEL  W  DF+LP  IWLGGLFNPQSFLTAIMQ+ ARK++ PLDRM + CDVTKK K+D+  PP +GA+VH L+M+GA WD Q   I   + KE+  +MPVI+IK+I  ++Q+L+ VY CP+YKT+ RG T+VWTFNLKT+E+PS+W
Sbjct:  158 RGKCAYFVRRNTSDGPLTASNFAESVLYGDFPVHSKIETMSLLFDDVLQPLLEQAQSQ--WPAIVRKDLQARIKEVRNTLTEIKGKTNNRTILSLLVSPTIVEE----VFAHVSQGHLRPALDPKFRNLLEEMFINWTTQMHDIVLERSECQPLGSTTQSAGHQPKYITLVSLPAQEIGFWTNRKLNLQNIYEQLRESTHKTLAQILERIESVYYEPYATAFRKLVAAWLEAQDVSLWLQPLLRQTAAFNSVQFSNGHDLVAPLVHIVHLVWSNARYYRSTQRMSVLLRCICNMLVHRAAEDLELQLLFQGDADEGLLKINRTIAVLELFKQRMLDYKERYAGSQVLLPALSEGAAAVASSPSPDDQQQLWRFCHEDVFGQTLDGFSLQLLELRQVFEAAVQFQQLEKLEVGGLRGKILTERVREIFGEFKVLFEQWSNVDIDLTATVASKWKCFRREQTLFFSRMQLLEQKLATVLLQAFEQCHSWMHLLRLTLMFGSLLQREAVRPELARVLPHILFIYDTEMEQLEDSVGEVLLGYEIRGLAALP-LANNFPPIANAMMWLEQHISRCDEFGAKELSQLVEQLLKEKSELQTLPI---QWNSLLSRRNILTTKLSNLQMKIWISWHECVDKLIIQGLDESVLSRSQDLSQLHLNFSQVLFTLLKETKYLLALQATGSLSGDLFQLPEPLLTLYGHRDAYWERRIRLIKIGEFYNGIRSGECAAAELQLIRNDLASIDEHVEVACQQLTWRNYNDELVAGIF---EQSRDLF----ARLQQSHGNLDAILASMRRWSREPLHQRSLYGR--NLLDLRHQQDRVRLRLLQCDETKMLLNRLLIANFCLFFNYESQEFQLYSRDLSVQEFIREFPEEQRRQYNKYLASVDELICREVREAMRISLEYLYKEMTATATATTTPTAPPVDPGCSAGMARLVLQQITTPQATSTAGAGASGAPPTANDAPLFEVKLELTETEIRFSPAFDASVENNFQQIVEQLLLDIKQTCDCMPRIVADNAPSEDDEDDDTATVDYEQELRWEPREDRAQELQERKKKDLELEQEQGDPKPQAVQFNLLAAAKAYSQKMECTADGLEMLERAIRDALADTVAAASAYAAKFQAYAFLWTQQSSEVLAACMQ-----TAREQTHHVSAGGYAI------METFKKEIENYNEVHDAIDQCENRECINGWLALDIKPLKYGLLNLACKWSHMCKKWLLRYVQGTLKELNAFIARGFETLQLHIARQDFATLLRVLAIMSEIREREPYADNVFKPLKEIMGLLKTYNVEFEPQLLRGIEQLPQQWQQLKHSSTVKQEA---LQDTRFHQQQRVTALIGLHTCHLQHYAR-QFQKMPFFRVPCPQVYDVCDEVYLRLHRFRRQQRLYTRWARLLDIQPPDPATLQFCEVELRRVKQLWDFVRVIESCIVAWHATPWLLIDTDDMEHECKKFTRDLRTLDKCIREWAPYVHIVGVLRELVASLRAITELQNPAITERHWMELMQLTKLSYKCNKSTRLAQLLTLQLQHHEEDIKNTVDRAIKEMTVTKVLDEIKATWAHLEFELEQHHTRPHIQLLKVSEELIETLDDNQMQLQNISTSKHIEYLLDKLTHWQKVLGGIDTLIVNWFEVQRKWIYLECIFIGSADIRAQLPADAANFERIDEDFTALLAKVQEVRVVMQVVLRHDDVLAQLLQLQHRLAVCEKALNDYLETKRLAFPRFYFISAADLLDILSNGNNPQVIDRHLIKLFDSILRLQYET-----NTPNALGMHSKENDEYVPFVSFDPDQPAFIVCGGRVELWLRAIIQQMRSTLHELFRRALRVFGEKPRELWLYDWPAQVALCCSQISWTADVNRSFGCMEEGYEGVMKELHKRQIAQLNALINLLLGELSPGDRQKIMTICTIDVHSRDVVGKIIASKVDNSLAFQWQSQLRHRWDDDQAGSSSGRASTAISCGGGDEDCFANICDAEFRYAYEYLGNTSRLVITPLTDRCYITLTQSLRLRLAGATAGPAGTGKTETTKDLGRALGVMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRICVEVLSVVAVQVKTIQEAIKMHKTQFIFMGERISLEPSVGIFITMNPGYAGRTELPENLKTLFRPCAMIVPDFALICEIMLMAEGFQDARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGTLKRDDHSRPEDQVLMRALRDFNIPKIVTEDVPIFMGLIGDLFPALDVPRKRVFEFEKTIRRAVNEIKLQPEEGFLMKVVQLQELLDVRHSVFIVGNAGTGKTKIWQTLRETYRIQKLKPVCHVLNPKALSNDELFGIVNPTTREWKDGLFSSIMREQANMPPGNPKWIVLDGDIDPMWIESLNTLMDDNKILTLASNERISLKREMRLLFEVGHLKAATPATVSRAGILYINPQDLGWSPYVSSWLETRVDMIERGILNALFEKYFP-CLMQRQRDFRRITPITDMAMIQMTCHLLECLLDSDEGNADGRGRGSATGGAANPHSLHHGELSHEAMVMALETIFVYATVWSFGSALSQDVIIDWHREFHKWWIGEFKDIKLPSQGTVFDYQLNVQTLKFQPWSELAAHQSLEGQIDSETPLQNVLISTAETIRLAYFLKLLIDRNLACMLVGNSGCGKGAIFRQLFGQYANDQELLEVAVSAATAGDSSHQQQSGNPAGAVVVRRKASSSATPLLTTVQATHFNFYTSSEIFQKMLDRPLEKKSGRCYAPSGPKRRLIYFVNDLNMPEVDAYGTVQPHTIMRQFMDYRQWYDRQRLQLKDIRHCQFAACMNPTAGSFTIDPRLQRHFCVFSVAPPGEDTLHHIYGSILSSHLESPSQGFTKEIRSIGSLLVRVGIALHRRVEYAFLPTALKFHYLFNLRDLTGIYQGLMNSVGAPASAGGGGASGFGGTICSRPSELMRLYVHEAFRVYHDRLVDPYDIKSFKSSIRDIFKKDFEDFDEDFVFAEPLIYSHFAQSLVDQKYMPLKSWDSLYQLLIEAQASYNEVVGYMNLVLFEDAMIHVCRINRILESPRGNALLIGVGGSGKQTLARLAAFISSLNVSQIQIKRGFGLLDMREEIGNLYMKVGLKNLASVFLISDAQIPDESILMLINDLLASGEIPELFNDDQLDTITNGIRNEVKQSGTLDTKENCWRYFVEKVRRLLKVVLCFSPVGQTLRVRARKFPAIISRTAIDWFHEWPKSALESVSQKFLNEINGILEPALVPPIGCFMAYVHGTVNQISRIYLQNEKRYNYTTPKTFLEYIFLYRKLLVDKNGEFAERIARLQSGMSKLAECARQVDTLKHQLAIQEVQLAAKNAAADKLIVIVSAESEKVKRERYIASEEEKRVRIIEEDVSIKTKMCEEDLRQAEPALVAAQAALNTLNKNNLTELKSFGSPPKAVVNVCAAVMVLLASNGKIPRDRSWKASKL-MMVRVDQFLNDLLNYNKDNIHPNIIETLQEYLKDPEFNPDKVVQKSVAAAGLCAWVINLHRYHQVFLIVGPKQQALQDSHQELLEARERLQYLKAKINNLEAKLAEIQAEFENAVGEKQRCQREADKTAFTIDLAHRLVNGLANENVRWKESVQSLLAKIGTLPGDILLISSFLSYVGCFTRRYREELQHKMWLPNFRKIDPHIPHTEGVDTLALFSDDAQIAAWNNEGLPMDRMSTENATILQYSTRWPLMIDPQLQGIKWIKNRFGTDLVVLRLRQKGFLEALEKSISQGDTVLIEQIEESMDTVLEPLLSRALIKKGRYLRIGDKEIEFHASFRLILHTKMANPHYKPEMQAQTTLINFTVTPDGLEEQLLAEVVKIERPDLEQMKTEVTVQQNKFKISLKALEDELLARLASSGENVLDDHALVINLENTKRTVDEIEAKVREARVTTLQIDDTRNIYRSAAKRAAILYFVLTDLSRINPIYKFSLKSFMNVFRQAIAMAAESKNYEKRVLHLVESITLQTYRYTLRGLFEADKLTFTSHMTLRILIAAEQVAKDETDFLLRFPHDPTTLSPLDFVGRSAWGGIKSLTLIEHFYGIDKDMENYTKRWRKFMASDTPEREQFPGEWKHRTPLQKLCIIRSLRPDRMTYAMRQFVEQTMGRSYAEIQTPPFGAIFQELNAATPAFFILSPGVDPIRDVERYGQRQGFHSESDTLVNISLGQGQELLAEQAI-IGALESGQQWVILQNIHLVVNWLPTLEKLIERIVLQSESKGESNFRLFISAEPAPDPQYHVIPQGILESSLKVVNEPPSGMAANLHKAWDNFSQDALETCTQEAEFKSILFALCYFHAVAGERRKFGPQGWNKVYPFNIGDLTISSNVLHNYLEGSNRIPWEDLRYLFGEIMYGGHITDDWDRRLCQTYLEELLQQDLIDGDFELCPGFPAPPNLDFEGYHSYITEMLPEESPLLYGLHPNAEIGFLTTASEQLLRTIFELQPRESELSSHCGAPREELVKIMIDDFLDKLQDEFNLQALLNRV--ERKTPFVVVALQECERMNALIREIKRSLRELMLGLRGELTITQEMERLDHAIFYDHVPAAWARLAYPSMLGLQSWFADLLHRIKELAGWLNDFKLPCAIWLGGLFNPQSFLTAIMQESARKHDLPLDRMLISCDVTKKQKDDVTLPPMEGAFVHDLYMDGASWDCQLNSIVALRPKEMLCAMPVIYIKSIVQEKQELQRVYECPLYKTRSRGNTYVWTFNLKTRERPSRW 4831          
BLAST of DNAHb-1 vs. Ensembl Fly
Match: Dhc98D (gene:FBgn0013813 transcript:FBtr0301302)

HSP 1 Score: 1917.51 bits (4966), Expect = 0.000e+0
Identity = 1241/3744 (33.15%), Postives = 1992/3744 (53.21%), Query Frame = 1
Query: 2635 EHWK-QYVDNIDDMIVENFQETINYSLQYMIDQIEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVK---RLAIGSSM--------EDYRTDLEENEELQKKRN------EISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSC-LEHYEDL-DRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNEST-TLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGIT---LLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMR---TXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLE-EGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLD---LKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLAN-LTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTR-EIQSEQAN--LTILFDKYVPVCLEALKLR-----FKKITPIVEISHVQMLCHLLEVLL---VPENTPADCP------KEWYELYFVFCAIWAFGSCMFQDQ--LVDHRVEFTKWWVTEFKTIKLPAQG--------TVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNY-VVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAK-LTLKEIHNTQYLACMNPTAGSFT-ISPRLQRHFCVFALSFPGQESLKAIYSTIL-SEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQR-LQKELTKK---AFEEMDEMV------------------------------------------------MFKKPLLYCHFAQGIGEPKYMPVERSEDLSKI---LKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRH-GADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNT-IKKGRA-IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIV---PNLTSPIDFLSNNSWGGIKALS--ALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKT-SLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKL-GFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLE--ANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDY----------KGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTK-KNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKER----GPTFVWTFNLKTKEKPSKW 13431
            E+W+ +    I DM  +N +  IN  L         S  P+FEV+  L  +EIV +PS+         EL +++VT      S+++   R   G+ +        + ++ +    E++ + R+       I +       +A+ + ++F +Y NLW   +     +FL                       E+  TL +   +   Y    E +     F  I K  RI+      +     + W     + L+ HV ++++ +   +K  +  LNK   E   E    +M  +G V+      ++    +++T  +L  +    P E  L    L ++W      A+   + + P++ +       +   F      F + + +  P +    LE    L D    +I+  E   EEL  +  LF++ + ++ +  + + E   L+ L+        + E W KTLW D++   + +  +S+ K  R   K +R+      +E  +K    ++  +  L++ A+R+RHW QLM  T   FDM+ +  TLE++  + LH +++    I+  A+KE+ +E+ ++ +  TW+ M F+  KH +       +L   +E+++ LE++ + LQ+M  S++I  F + V  W++TL+   ++I  W  VQR W +LE IFIG D IR QLPE++ +FD ID  ++ ++ +  +   VV     P     ++ +   L  C+K+L EYL++KR  FPRFYF+S+ +LL IL + + P  V  H+ K++D++  L+ +KE    +  +   M + +GE++EF ++    G+VE W+N +L+EMR + R           +  + SR  W+  +   V L++SQ+ W  EV  +F + +  G   A+KDF  K   Q+  L+  +   LS++DR K    CT+DVH RD++   +   + ++  F+W  QLR  W     + ++  C   F + +EY+G   RLVITPLTDR Y+T+TQ+L + + GAPAGPAGTGKTET KDL +A+G++  V NC E MDY+++G I  GL Q G+WGCFDEFNRI + VLSV++ Q++ I++ +  K  RF F G EI LD   G+F+TMNPGYAGRTELPE++KALFRP   + PD ELIC I L ++GFL A++LA+K   LY L +  LSKQ HYDWGLR++ SVL +AG +KR   D PE  VLMR LRD N PK V +D P+F+GLI DLFP +D PR   P+F   VR   ++   + L  +E+   KVVQ+ E    RHS  ++G  G GK++V   L+K  +++      + LNPKA +  EL+G ++  TR+W DGLFS I R++   +  +  ++   DGD+D +WIE++N+VMDDNK+LTLA+ ERI L     LLFE+ +L  A+PATVSRAG++Y++P++L + PF   W+ TR E Q E  N     +  + +   LE L         K +    +++ V   C+L + LL   V ++   D P       +  E  F+     + G+C+ +    + D  ++    +     T + PA G        T++DY+ D +   ++ W   +  +  D +     +LVPT + TR    L L+ E +RPV+LVG AGT KT  +   L ++  +  V+ N+ F+  T+S  +Q  LE  +EK+    YGP   K++  FIDDMNMP+VD Y T QP  L++   +    YDR K L  K+  +  + A M    G    + PR    F  + + FP  ESL  IYS+I     +   F    +     +V + L     +     PT  KFHY+FNL+DLS IF G+L   P C K   DL+R+W +E  R+  D+LI DNDI   +R L  E+ ++    FEE    +                                                + + PLL+  F     E +    E   D + +     E LE Y E    M LVLFED + H+ R++R L   RG+ LL+GVGGSGK+ ++RLAAF +  DVF+IT+ +GY     + DL  LY  AGVK   VVFL T AQ+A+E FL L+N++L  G++  LFPD++ + I++ +R   +  G+  S++  W +F+      L +VLC SP G  LR R R FP ++  T IDW   WP  AL +V+  FL E  L+P  ++++  + +  VH ++ + S  YL   RR N+ TPK +L+ I  Y  +L++K   +  + SRL  G++K+E  + Q+D+L+  +  Q+  +   +     +L  + + T+K + +K  A  +  +V     +++ ++ + E  LA+A PAL+ A+ AL+ L K  +TE++SF TPP A   V   C C+    G   K+ +WK+AK G+M  ++ FL +L+  + + + +  +   +++ K  N   E++   S+A AGL  +V  ++ +++++ +VKPK++ L+   EE     + L+ +  +I++LE++L +L + +  +    +   +      + +  +++L+ GL SE +RW K++     +     G  L++ +FL+Y G FT  +R  ++   WL  +A+L   IPI         L  D  I+ W+NEGLP D +SI+N  +   A R+PL IDPQLQ ++WI+ R    +LKV+      +L  +E A+  G  VL E++++ +DPV+D +L +N  I+ GR  + LGDKE +++P FR+ L TK +NP + P + A+  +IN+TVT+ GLEDQLL+ VV  ER DLE  +  L  Q ++ K  L++LEDSLL  LS + GN L +  L+E LEN K  A  + E+++ A  T   I   R  YRPAA R ++L+F L+D+  +N MYQ++L A+  VF  ++ +A P   L  R+ N+I ++T +VY Y   G+FE+ KL+F+ Q++ ++      +   ELDF ++  I       ++P  +LS  SW  +  L+    + F  L          WK++ + E PE+   P ++  K  + Q+L  +R  R DR+  ++  ++ E +   Y+    V FS  +E++    P+ F+LS G DP  D+  L   + G S    NF +ISLGQGQE  A + +D   K+G W++LQN HL+ ++     +K  +  E  H  +R++I+ +P+ +      P GIL+ ++K+  EPP G+  NL  +     QE +E C+    F+ +++ L +FHAVV ERRK+   GWN +Y FN  D  +   +L  YL      K+PW  L+YL GE+MYGG + DD+DR++   Y+ EY+   + D E  +   F    N DY          + Y  +ID+      P ++GLHPNAEI + T  +  ++ ++ E+QP+  +G G  GISR++ I  +   I++KLP  F    I+ ++     +P  VV  QE +R N+L   I+++L+ L   + GE+ +   ++ ++NSL+  ++P +WSK A  +   LA W   L LR  + + WT   + P V+WL GL  PQS+LTA++Q   R+N WPLDR  L   VTK  + +D+   P  G  VHGL++EG R+D  +  +A +  K L   + ++ ++ I   R  L+N Y  PVY T  R    G   V+  NL T E  S W
Sbjct: 1403 EYWEGETFKCIVDMTYQNLKCYINRLL---------SNKPMFEVNAVLLMSEIVLEPSV--------QELQNTIVTATKDYISRLRIFTRWMTGTCIACPLVEMGKQFKYNYTYYEDVIQIRSIVDLVINIHDLASRVANEARGFVSQFRKYFNLWAFEKSFICQKFL-----------------------EKQVTLIEIDEKFTFYSSIVETLANTRKFQDI-KCVRINLEPLLASITQHAQDWCTTLGEELLRHVNDNMRAMRNEVKTLSLNLNKTTRE--LEDFKLVMTTIGTVQSSTLTNEQKIHEMQETFTILSEHKIMFPYEDMLMAHHLEKRWKRLFLSALYRYEKLQPIKQKFADMTSVEIDEFCDDLAEFIKDYDENGPGSVGAELERGVRLMDPYGQKIAERESRREELANAERLFDMAMVDYHEFARVQTEFEGLQQLYKLYKAQKYAREGWGKTLWADLDPNVLTEGVESYLKEFRKFTKAVRTLPVGVQLEIHMKQFKGTVPLMVSLKHEALRERHWLQLMEKTGQYFDMSPARFTLENMFAMQLHKYQEIAEQILTNAIKELQIERGVQAVIETWASMAFKTFKHFKGSDDRGWVLGPVDEIMQILEDNAMNLQSMGASQFIGPFLETVNKWERTLALISEIIDEWLVVQRKWLYLEGIFIGGD-IRTQLPEEARKFDDIDKSYRRIMVDCAKNPLVVPFCTVPGRLVEIQGLGIGLENCQKSLNEYLDSKRRIFPRFYFISTDELLSILGS-SEPSAVQNHIIKMYDNIKSLRLVKEG---SQTIVTGMISSEGEVMEFRHSARAAGRVEYWMNDVLDEMRRSNRFINKTAIYDFGTDLQISRPDWLMNYQGMVGLAASQVWWTAEVEEAFDQAQNHGNMRAMKDFLGKNNYQIEELVLKVRSNLSRNDRLKFKAQCTVDVHARDIIDNFVRDNVLDASEFSWESQLRFYWIKFYDNLHVLQCSGSFDFGYEYMGLNGRLVITPLTDRIYLTITQALLMNLGGAPAGPAGTGKTETVKDLAKAMGLLCVVTNCGEGMDYRAVGTILSGLVQCGAWGCFDEFNRIDISVLSVISTQLQTIRNGLIRKLDRFVFEGVEIHLDPKCGVFVTMNPGYAGRTELPESVKALFRPVTCIKPDLELICLISLFSDGFLTAKVLAKKMTVLYSLAQAQLSKQCHYDWGLRSLNSVLRMAGVMKRQSEDLPEAVVLMRVLRDMNFPKFVFEDVPLFLGLIKDLFPGIDCPRIGYPDFNAAVRHVLVNDGYILLPDQED---KVVQMYETMMTRHSTMLVGPTGGGKTVVINALVKAQTHMGLPTKCLVLNPKACSVIELYGFLDMETRDWIDGLFSNIFREMNKPIEREERRYACFDGDVDALWIENMNSVMDDNKLLTLANGERIRLENYCALLFEVGNLNYASPATVSRAGMVYVDPKNLRYSPFWQRWVLTRPEPQRELLNDFFEKIITQSIAFILEGLDGTTQGNPLKLVIMQTDLNMVTQFCNLYDALLPNYVMDSKNYDEPVQQNYNTDSLECCFLQAVYGSMGACLVEKHQPVFDEYMKRISGFPLVQDTPENPASGGQFPQSKPTLYDYFWDVKDNVWKAWEWVVQPYTHDPQVKFSEILVPTVDNTRTNRTLSLMSEIKRPVLLVGEAGTSKTATIMQYLRNLNPSVNVILNINFSSRTSSLDVQHTLEAAVEKRTKDTYGPPMGKRIACFIDDMNMPQVDDYGTQQPIALLKLFFERGGMYDRDKDLNWKKFKDLTFYAAMGTAGGGRNEVDPRFISMFSTYNIIFPNDESLIQIYSSIFKGHMVFVKFQPEYMLIADMIVHMTLKLFKMVIVDLPPTPSKFHYIFNLKDLSRIFAGMLLIEPTCFKGLRDLIRVWRNEYTRIICDRLITDNDIANVRRNLAVEVAERFPPTFEEEHGFIDAAAAEAEAQARLLYEPSKADIDGGEEEGEEEEEGEEAPQVILSLKDYVLRDPLLFGDFRNFTNESEPRLYEDLLDYNSVYFLFTEILEEYCERKQKMTLVLFEDCLEHLTRVHRTLRMNRGHVLLIGVGGSGKKCITRLAAFAAECDVFEITISRGYNEAAFREDLKVLYTIAGVKRKKVVFLFTGAQVAEEGFLELINNILTVGQVPALFPDEDKDGIVNQVRKFAEEDGVSASKDAVWGYFLRTCAENLHVVLCMSPAGDALRNRCRNFPGLIGSTYIDWVFPWPRQALYAVAKLFLTEHRLIPASHREAIVEHVVHVHTSIQQYSKDYLAKLRRNNFVTPKHYLDYINTYRGLLEEKAKFITQQRSRLGEGIKKIEEASVQIDELRIIVTEQKKNVAVASEECEAMLVTIESSTQKANVKKAEASEKSVEVEIKGKQIAIEKDEAEEILAEAMPALEEARLALSQLEKAQITEIRSFATPPAA---VQVVCECVAILKGY--KEINWKSAK-GMMSDVN-FLKSLMEMDCEALTQKQITQCRQHMKTGNL--EDMAKISVAGAGLLRFVRAVLGFFDVYKEVKPKKERLDFLVEEQEVQIKLLNHLNGEIQKLEEKLNELNENYATSMKQMRALTEMMQQAERRLIASDKLISGLTSELIRWSKEMASLGQQLIDSVGGCLISASFLAYTGAFTWEFRKAMVFDDWLEDIASLG--IPIQLPFKIDGYLTTDVEISQWSNEGLPPDELSIQNGILTMRASRFPLCIDPQLQALQWIRKREFKNNLKVLSFSDSDFLKQLEMAIMYGTPVLFEDVDDYIDPVIDDILQKNIRIQGGRKFVMLGDKEVDWDPSFRVYLTTKFSNPKFDPAVYAKALVINYTVTQTGLEDQLLSVVVGTERPDLEAQRESLIAQTSENKQLLQQLEDSLLRELSTSTGNMLDNVELIETLENTKTKAGVVMEQLKLAADTAADIEVLRNGYRPAAKRGAVLFFALSDMATVNSMYQYALAAYLDVFVYSLRKAVPDASLNKRLNNIIKTLTENVYCYGCTGIFERHKLLFSFQIATKLAQRDGILLQSELDFFIKGSIALTKSERSNPCKWLSEKSWEDVLKLAFDFPDIFGTLPDHFGRYLTEWKEWFDLENPEEVPCPGDYNIKCNAFQKLMFLRCFRVDRIFRSINQYIVETMDEFYIMPPVVSFSAIYEQTSSTIPVCFVLSAGSDPTNDLIKLADTIVGMS----NFCHISLGQGQEKAALRLLDGAIKQGMWLMLQNGHLLIRF-VRELEKHLDRIENPHPDFRLWITTDPTPT-----FPIGILQKSLKVVTEPPNGLKLNLRSTYFKVRQERLESCS-HVAFRPLVYVLAFFHAVVQERRKYDKLGWNIAYDFNDTDFDVCTEILRTYLTRCGTGKIPWNSLKYLIGEVMYGGRVIDDFDRRITNCYMNEYMGDFLFD-EFKVF-HFYEDDNVDYCLPEEETILKEDYIAHIDKLPLVNKPDVFGLHPNAEIGYYTMAARNIWNSLIELQPQ--TGEGTGGISRDDFIDSVAAGILKKLPPAFETWRIRKQI-QMSLSPTGVVLLQELDRFNLLVVRIKKTLELLRKAIAGEIGMDNVLDNIANSLFNGLLPAAWSKLAPATCKQLASWLEHLRLRAVQYKYWTLSGE-PLVMWLSGLHIPQSYLTALVQIACRRNAWPLDRSTLFTYVTKFADPDDVEERPVTGCLVHGLYIEGGRFDLATNQLARSHPKVLVEELAILAVEPIEAHRLKLQNTYLAPVYTTSLRRNAMGVGLVFEANLATSEDLSHW 5067          
BLAST of DNAHb-1 vs. Ensembl Zebrafish
Match: dnah9l (dynein, axonemal, heavy polypeptide 9 like [Source:ZFIN;Acc:ZDB-GENE-050506-1])

HSP 1 Score: 4700.96 bits (12192), Expect = 0.000e+0
Identity = 2356/3936 (59.86%), Postives = 2996/3936 (76.12%), Query Frame = 1
Query: 1660 RPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKV----PKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEG--SKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXX----NTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKL-GSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAK-EYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            RP +   F   Y +L+ M  EE+   + + D   +  EK+    P + KNMP V G L+W +E+RERI    +  S L H   +++E   V++  + +LE+L   + + YNNW  G+DE C  +L++PLLI + ++   S+NF+  L +VLRE KYL IL    IP++A  ++SK + L  Y + L  + +WYN L    L VE  L+E+EL ++   L+ A+  L W    +D     YI+   DLV  +  RV KSK N++ ++ +M  +  S    RK      LLNL D E+   ++Y  I   GE++H LV+EN+ELL AD  SE W+ Y + +D  I+  F   +  SLQY+++  +   S  PLFEV + L   +++F PSL+     NF +++D +V+DIFK AS +KR+A     E Y+ D+++  EL +    +  R   A  K K +Q  FD Y  LWT +R EFM QFL YG A+SAEE E + + ++    + PP L  F+ QI ++E  +E++  +    +   W ++D   FK++ +N IK+WS MFK+HL++HV  S++EL  FI+ TN GL K   +GD+  LV++M HL  +++RQ +T+++F PLK T DLLKTYNQ++P+ V++ LE LPEKW N KKVA TVK  VAPLQ+ EVA IRRKC  F++KQH FREQFR    F     E Y+ +D+ +  ++ LE  M +L ++A LFEV+ P++KQL+QCR ++ L+K +WD +  V SSI  W KT WK+INVEQMD + + FAK +++LDKE+R WD Y G+E  +KN++TSLRAVNELQN A+R+RHW QLM  T V F M+E+TTL DLL+L LH  E+EV++IV+KAVKEM +EK+L E+  TWS M   +E H+ TG  LLKA E LI+TLE++QV+LQN++ SKY+ +F  EV  WQ+ L  AD VI IW  VQRTW+HL+SIF  S+DIR QL   +ERF  I  DF+  +  + ET NV+K T +P   E+LE +Q  L +CEKALAEYLETKRL FPRFYFVS++DLL+I+S G  P  V +HL KLFD+LA L F +E +       T + + MY+++GE V F+  C   GQ E WLN L + M +T+R  +SE+V++ E+K RDQW+F++PAQVAL+ SQI W T+V ++F R+EEG+E ALKD+N+KQI+QLN+LI +L+GEL+  DRQK+MTI TIDVH RDVV KLI+QK+ + Q+F WL QLRHRWA+  K CYINICDAQF++++EYLGNT RLVITPLTDRCYITLTQSLHLTMSGA +GPAGTGKTETTKDLGR+LGIMVYVFNCSEQMDYKSIGNIYKGLAQ+G WGCFDEFNRISVEVLSVVAVQVK IQDA++NK++RF FLGE+I L S +GIFIT+NPGYAGRTELPENLKALFRPCAMV+PD+ELICEI+LVAEGFL AR+LARKFI+LY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR D   PE+QVLMRALRDFN+PK+VT D P+F+GLI DLFP LD+PRKRD   E++VRQ+  +L LQ EE+F+LKV QL+EL AVRHSVFV+G  G+GKS + KTL KTYSN+K KP+  D+NPKAVT DELFG ++P+TREWKDGLFS  MR+L+ ++ DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI L P+MRLLFEISHLK ATPATVSRAGILY+NPQDLGW  +V SWI TR+ QSE+ANLTILFDKYVP CLE ++   K ITPI E S VQ LC LL+ LL  ENTP D P+E YELYFVF ++WAFG  +FQD L+D+R EF++WW  E + +K P+QG+VFDYYID  TK+F PW++R   FE++ + PLQ VLV ++ET    YF++LL++K +PVMLVG AG GKT+L+ DK++ + + ++VA VPFN+YTTS MLQRVLEKPLEKKAGRN+ P G+KKLIYF+DD+NMPEVD Y TVQPHTLIRQH+DYSHWYDR +L LKEIHN QY+ CMNPTAGSF+I+PRLQRHF VFA+ FPG ++L  IYS+ILS       +S  + +  S LV  A+  H K++  FLPTAI+FHY+FNLRD+S+IFQGILFA P+ ++ P DLV LW+HE  RVY+DKL+++ D+E + ++  +  K+ FE +DE +   +PL+Y HFA G+GEP+Y  V   E L K L +ALE YNE+++ MNLVLFE+A+ HI RI+RILESP G ALL+GVGGSGKQSL RLAAF+S L+VFQITLRKGYGI+DL+ D+AALY+K GVKNIG VFL TDAQI DE+FLVL+ND+LASG+I DLF ++E++ I++S+R E+++ G++D+RENCW FFI+++R  L++VLCFSPVG TLR RARKFPA+VNCT IDWFH WP+ AL SVS  F+Q +  L  D + S ++F+SF H  VN+VS+ Y QNE+R+NYTTPKSFLE + LY N+L  K TEL+ K  RLENGLQKL +TA QV+DLKAKLA QEVEL  +N     L+ K+   ++K+S E+ +AD EE+KV  I+AEV+K+QQ+ E DL KAEPALQAA  ALNTLN+ NLTE+++F  PP  V +V+AA + L++ NG++PKDRSWKA+K  +M K+D FL  L+N++K+ IPE +++  K EY  DP FNPE ++ KS AAAGL +WVINII ++E+FC+V+ KR  L  AN +L EA EKL  I+ K+ +L+  L+ L   FEKA S+K RCQDE + T  TI LANRLV GL SEN+RW   V QY+ +E TL GDVL+T AF+SY G F+K YR  L+   W+P+L      IP+++  DP+ ML DDA IA WNNEGLP D+MS +NATILTN ERWPL+IDPQLQGIKW+K+R+G  LKV+ L QKGY+DVIEQAV +G+ VLIEN+EE+++PV+D LLGR+TIKKGR IK+GDKEC ++P+FRLIL TKLANPHYKPE+QAQTT+INFTVTRDGLEDQLLA VVN ER DLE LK +LTKQQN FKI LK+LED LL RLSAAE NFLGD  LVE LE+ K TA EIE KV +AK+ EV INE RE YRP A RAS+LYFI+NDLNKINPMYQFSLKAF VVF KA+  A+ S ++K RV  LID ITFS + Y +RGLFE+DKL F AQ++FQ+LL  KE++P ELDFLLRF I  +  SP+DFLSN+ W  +K +S  +EF+ LDRDIEGS KRWKK VESE PEKEK PQEWK+K+SLQ+L ++RALRPDRMTYAV +FV+EKLG +Y EG  +EF++SF+E GPA+P+FFILSPGVDPLKDVE+LGKKLGF+ D     N+SLGQGQE VAE AM+  ++EGHWV+LQNIHLV+KWL  LEK LE   E+SH+ YRVF+SAEPS +P+ HIIPQGILEN+IKITNEPPTGMLANLH +L+NF+Q+ ++ C++E EFKTILF+LCYFHA V+ERRKFGPQGWNR YPFNTGDL ISVNVLYNYLEANS+VPWEDLRYLFGEIMYGGHITDDWDR+LC+TYLEEY+QP   D ++++ PGF VP N DY+GYH YIDE LP ESP  YGLHPNAEIEFLT +SD LF T+ E+Q RDSS       + EE++K ILDDI+EKLP+++NM +I +K    ER+P+++V FQECERMNML +EIRRSLKELDLGLKGEL I+++ME +  +L+ D +P++W++ AYPS+Y L  WY D+LLR +EL+ WT D  LPSV+W+ GLFNPQSFLTA+MQ +ARKNEWPLD+M L  DVTKK KE+   P R+GAY++GL+MEGARWD Q G I EA+LKEL PSMPVI ++AIP DRQ+ RN Y CPVYKTK R  T++WTF+LK++E+P+KW
Sbjct:    1 RPRVHQLFAPNYSQLLVMFQEEVSLCQRILD---TQREKLRTGSPILGKNMPAVAGNLKWSQELRERILSNRSKLSQLTHMPLESSEAKQVLQMCECVLEVLDVMDEEVYNNWSVGMDELCQTHLNKPLLILDEESSLYSLNFNPALMSVLREAKYLGILKNHNIPKAAVSLYSKREMLHMYTSTLLQITQWYNKLHSTILAVELRLVESELEEVRNTLKPALQELQW----IDEDLADYIKSTCDLVRGVSERVQKSKANLEKLQGLMGVFSHSACITRKTSHRGNLLNLTDVEENFKRQYGLIARTGEKIHELVQENAELLGADLDSEAWQSYTEYVDRHILTGFCSAVRCSLQYLVENTDAALSIAPLFEVQLTLT-TDMIFHPSLNLSRKGNFYDIIDQMVSDIFKMASFIKRVAKSKQSETYKEDVDQIPELVELAQLVRYRARGAIAKVKEFQHSFDSYRYLWTGDRAEFMRQFLLYGHALSAEEAELYADYELP---KNPPKLQNFREQISEFEDLYEKVRVLEEKRVFCGWCQVDINPFKRSLMNIIKKWSWMFKEHLLNHVNASVQELGSFIESTNLGLAKTVTDGDYGKLVDIMSHLKAIRDRQMSTEQLFRPLKATSDLLKTYNQQLPEHVYILLEALPEKWKNLKKVAFTVKHEVAPLQSNEVAVIRRKCVRFEIKQHEFREQFRSEPIFFIRLEEPYKLIDKTNRAVAHLESEMAKLQQTANLFEVSFPDYKQLRQCRSDIILVKAVWDMVMFVKSSISDWTKTPWKEINVEQMDMELRRFAKEMKTLDKEVRVWDVYNGLESIVKNLLTSLRAVNELQNSAVRERHWQQLMHTTGVSFVMDENTTLGDLLELQLHRVEEEVKNIVDKAVKEMGIEKILGEIQQTWSMMSLSYEMHTSTGTPLLKADENLIDTLEDNQVQLQNILMSKYVEYFMVEVSGWQRKLVVADLVIGIWLAVQRTWAHLQSIFTNSEDIRNQLAHVAERFQGIHQDFQGSMISIVETDNVIKVTNQPGFLEQLETLQQRLSVCEKALAEYLETKRLTFPRFYFVSASDLLEIVSKGTQPRQVTRHLLKLFDNLADLSFKEEKDNGELDPQTTIALGMYSREGEYVPFSQPCVCEGQAECWLNALEKAMCSTVRQEISEAVAAYEDKPRDQWLFDYPAQVALTGSQIWWATDVGIAFERVEEGFETALKDYNRKQISQLNSLINMLLGELTPGDRQKIMTISTIDVHARDVVAKLISQKVTSGQAFAWLSQLRHRWAEQQKHCYINICDAQFQFSYEYLGNTNRLVITPLTDRCYITLTQSLHLTMSGATSGPAGTGKTETTKDLGRSLGIMVYVFNCSEQMDYKSIGNIYKGLAQTGVWGCFDEFNRISVEVLSVVAVQVKTIQDAVRNKKQRFHFLGEDIELRSTVGIFITLNPGYAGRTELPENLKALFRPCAMVIPDYELICEILLVAEGFLDARLLARKFISLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKREDRSCPEEQVLMRALRDFNLPKVVTSDVPIFLGLISDLFPLLDIPRKRDHLLEQNVRQSVAELHLQPEESFILKVTQLEELLAVRHSVFVVGGPGSGKSQILKTLHKTYSNMKLKPIWTDINPKAVTTDELFGFLHPATREWKDGLFSSTMRELSGISHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERISLAPSMRLLFEISHLKAATPATVSRAGILYVNPQDLGWSSYVTSWIDTRQAQSERANLTILFDKYVPYCLEQVRCNLKTITPIPETSMVQTLCCLLDCLLTDENTPPDSPRELYELYFVFASVWAFGGALFQDHLIDYRSEFSRWWCKEMRAVKFPSQGSVFDYYIDPNTKRFTPWSERTPPFELEPDIPLQTVLVHSAETICLTYFIELLLQKGKPVMLVGNAGVGKTILVWDKISKLKEEFMVAKVPFNYYTTSAMLQRVLEKPLEKKAGRNFAPPGTKKLIYFVDDLNMPEVDAYGTVQPHTLIRQHLDYSHWYDRQRLVLKEIHNCQYITCMNPTAGSFSINPRLQRHFSVFAVHFPGADALSTIYSSILSGHFQQGGYSYGVSRMSSTLVQAAICLHQKMSQNFLPTAIRFHYIFNLRDISSIFQGILFALPEHVRYPIDLVHLWLHESSRVYSDKLMEEKDVELFNKILLDTGKRYFEGIDESIFINQPLIYSHFAHGVGEPRYAQVTDLEKLQKTLMDALEHYNELHSDMNLVLFEEAMQHICRISRILESPVGNALLIGVGGSGKQSLCRLAAFLSVLEVFQITLRKGYGISDLRSDIAALYIKVGVKNIGTVFLHTDAQIPDERFLVLINDMLASGDIPDLFSEEEIDMIVTSIRVELRALGLLDTRENCWNFFIDRIRRQLKVVLCFSPVGFTLRTRARKFPALVNCTVIDWFHPWPQHALQSVSSTFIQNIPDLEPDVRVSISEFISFAHTCVNEVSVKYQQNEKRFNYTTPKSFLEFMKLYGNLLGSKRTELRQKTERLENGLQKLLTTASQVEDLKAKLAIQEVELHLRNTDTEALIAKIGQQSEKLSQERSVADAEEKKVEAIQAEVTKQQQETEADLEKAEPALQAANAALNTLNRLNLTELRTFPNPPAIVSNVTAAVLVLLSPNGRIPKDRSWKASKV-VMSKVDDFLQALVNFDKERIPEATVRVIKDEYLSDPEFNPEFVRLKSSAAAGLSAWVINIIRFHEVFCEVEVKRLCLAQANADLVEAAEKLEIIRKKLAELDGSLETLTAAFEKATSEKLRCQDEVNQTNTTILLANRLVKGLESENIRWAHSVAQYREQESTLCGDVLLTAAFISYAGSFSKRYRYELLHNLWMPYLRAQKVPIPMSEGSDPISMLTDDATIAKWNNEGLPGDKMSTQNATILTNCERWPLLIDPQLQGIKWLKSRYGNSLKVINLSQKGYVDVIEQAVVSGEPVLIENLEETIEPVIDPLLGRHTIKKGRCIKVGDKECYFHPDFRLILHTKLANPHYKPEIQAQTTLINFTVTRDGLEDQLLAEVVNLERPDLEYLKSELTKQQNMFKIELKQLEDELLTRLSAAESNFLGDNVLVEKLESTKHTAAEIEMKVLEAKVNEVKINEAREHYRPVAVRASLLYFIINDLNKINPMYQFSLKAFNVVFHKAVQNADASADVKIRVNTLIDCITFSTFNYINRGLFERDKLTFAAQLTFQLLLMNKEVDPRELDFLLRFNIDHSYISPLDFLSNSVWSAVKTMSFTDEFRGLDRDIEGSPKRWKKMVESECPEKEKLPQEWKSKSSLQKLILLRALRPDRMTYAVRNFVEEKLGVQYTEGRKMEFARSFKECGPASPVFFILSPGVDPLKDVESLGKKLGFTIDLGKLHNVSLGQGQESVAELAMEKASREGHWVILQNIHLVAKWLGNLEKLLEHCCEDSHQDYRVFMSAEPSPTPQEHIIPQGILENSIKITNEPPTGMLANLHAALDNFDQDILDQCSREQEFKTILFSLCYFHACVAERRKFGPQGWNRKYPFNTGDLTISVNVLYNYLEANSQVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEYMQPNQFDRKMSLAPGFIVPSNLDYQGYHAYIDEMLPHESPVHYGLHPNAEIEFLTVMSDSLFHTLLELQSRDSSMGEGASQTTEEKVKTILDDILEKLPEEYNMSDITSKTA--ERSPFILVCFQECERMNMLINEIRRSLKELDLGLKGELAISSEMEQIQTALFFDNVPDTWARLAYPSIYSLGQWYNDVLLRCRELDSWTHDLSLPSVVWISGLFNPQSFLTAVMQSLARKNEWPLDKMNLTVDVTKKFKEEFNQPAREGAYIYGLYMEGARWDIQGGTITEARLKELTPSMPVIAVRAIPNDRQETRNTYECPVYKTKLRANTYIWTFSLKSRERPAKW 3922          
BLAST of DNAHb-1 vs. Ensembl Zebrafish
Match: dnah9l (dynein, axonemal, heavy polypeptide 9 like [Source:ZFIN;Acc:ZDB-GENE-050506-1])

HSP 1 Score: 4495.26 bits (11658), Expect = 0.000e+0
Identity = 2235/3615 (61.83%), Postives = 2809/3615 (77.70%), Query Frame = 1
Query: 2611 LLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEG--SKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXX----NTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKL-GSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAK-EYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            LL AD  SE W+ Y + +D  I+  F   +  SLQY+++  +   S  PLFEV + L   +++F PSL+     NF +++D +V+DIFK AS +KR+A     E Y+ D+++  EL +    +  R   A  K K +Q  FD Y  LWT +R EFM QFL YG A+SAEE E + + ++    + PP L  F+ QI ++E  +E++  +    +   W ++D   FK++ +N IK+WS MFK+HL++HV  S++EL  FI+ TN GL K   +GD+  LV++M HL  +++RQ +T+++F PLK T DLLKTYNQ++P+ V++ LE LPEKW N KKVA TVK  VAPLQ+ EVA IRRKC  F++KQH FREQFR    F     E Y+ +D+ +  ++ LE  M +L ++A LFEV+ P++KQL+QCR ++ L+K +WD +  V SSI  W KT WK+INVEQMD + + FAK +++LDKE+R WD Y G+E  +KN++TSLRAVNELQN A+R+RHW QLM  T V F M+E+TTL DLL+L LH  E+EV++IV+KAVKEM +EK+ +    TWS M   +E H+ TG  LLKA E LI+TLE++QV+LQN++ SKY+ +F  EV  WQ+ L  AD VI IW  VQRTW+HL+SIF  S+DIR QL   +ERF  I  DF+  + E +      K T +P   E+LE +Q  L +CEKALAEYLETKRL FPRFYFVS++DLL+I+S G  P  V +HL KLFD+LA L F +E +       T + + MY+++GE V F+  C   GQ E WLN L + M +T+R  +SE+V++ E+K RDQW+F++PAQVAL+ SQI W T+V ++F R+EEG+E ALKD+N+KQI+QLN+LI +L+GEL+  DRQK+MTI TIDVH RDVV KLI+QK+ + Q+F WL QLRHRWA+  K CYINICDAQF++++EYLGNT RLVITPLTDRCYITLTQSLHLTMSGA +GPAGTGKTETTKDLGR+LGIMVYVFNCSEQMDYKSIGNIYKGLAQ+G WGCFDEFNRISVEVLSVVAVQVK IQDA++NK++RF FLGE+I L S +GIFIT+NPGYAGRTELPENLKALFRPCAMV+PD+ELICEI+LVAEGFL AR+LARKFI+LY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR D   PE+QVLMRALRDFN+PK+VT D P+F+GLI DLFP LD+PRKRD   E++VRQ+  +L LQ EE+F+LKV QL+EL AVRHSVFV+G  G+GKS + KTL KTYSN+K KP+  D+NPKAVT DELFG ++P+TREWKDGLFS  MR+L+ ++ DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI L P+MRLLFEISHLK ATPATVSRAGILY+NPQDLGW  +V SWI TR+ QSE+ANLTILFDKYVP CLE ++   K ITPI E S VQ LC LL+ LL  ENTP D P+E YELYFVF ++WAFG  +FQD L+D+R EF++WW  E + +K P+QG+VFDYYID  TK+F PW++R   FE++ + PLQ VLV ++ET    YF++LL++K +PVMLVG AG GKT+L+ DK++ + + ++VA VPFN+YTTS MLQRVLEKPLEKKAGRN+ P G+KKLIYF+DD+NMPEVD Y TVQPHTLIRQH+DYSHWYDR +L LKEIHN QY+ CMNPTAGSF+I+PRLQRHF VFA+ FPG ++L  IYS+ILS       +S  + +  S LV  A+  H K++  FLPTAI+FHY+FNLRD+S+IFQGILFA P+ ++ P DLV LW+HE  RVY+DKL+++ D+E + ++  +  K+ FE +DE +   +PL+Y HFA G+GEP+Y  V   E L K L +ALE YNE+++ MNLVLFE+A+ HI RI+RILESP G ALL+GVGGSGKQSL RLAAF+S L+VFQITLRKGYGI+DL+ D+AALY+K GVKNIG VFL TDAQI DE+FLVL+ND+LASG+I DLF ++E++ I++S+R E+++ G++D+RENCW FFI+++R  L++VLCFSPVG TLR RARKFPA+VNCT IDWFH WP+ AL SVS  F+Q +  L  D + S ++F+SF H  VN+VS+ Y QNE+R+NYTTPKSFLE + LY N+L  K TEL+ K  RLENGLQKL +TA QV+DLKAKLA QEVEL  +N     L+ K+   ++K+S E+ +AD EE+KV  I+AEV+K+QQ+ E DL KAEPALQAA  ALNTLN+ NLTE+++F  PP  V +V+AA + L++ NG++PKDRSWKA+K  +M K+D FL  L+N++K+ IPE +++  K EY  DP FNPE ++ KS AAAGL +WVINII ++E+FC+V+ KR  L  AN +L EA EKL  I+ K+ +L+  L+ L   FEKA S+K RCQDE + T  TI LANRLV GL SEN+RW   V QY+ +E TL GDVL+T AF+SY G F+K YR  L+   W+P+L      IP+++  DP+ ML DDA IA WNNEGLP D+MS +NATILTN ERWPL+IDPQLQGIKW+K+R+G  LKV+ L QKGY+DVIEQAV +G+ VLIEN+EE+++PV+D LLGR+TIKKGR IK+GDKEC ++P+FRLIL TKLANPHYKPE+QAQTT+INFTVTRDGLEDQLLA VVN ER DLE LK+ LTKQQN FKI LK+LED LL RLSAAE NFLGD  LVE LE+ K TA EIE KV +AK+ EV INE RE YRP A RAS+LYFI+NDLNKINPMYQFSLKAF VVF KA+  A+ S ++K RV  LID ITFS + Y +RGLFE+DKL F AQ++FQ+LL  KE++P ELDFLLRF I  +  SP+DFLSN+ W  +K       F+ LDRDIEGS KRWKK VESE PEKEK PQEWK+K+SLQ+L ++RALRPDRMTYAV +FV+EKLG +Y EG  +EF++SF+E GPA+P+FFILSPGVDPLKDVE+LGKKLGF+ D     N+SLGQGQE VAE AM+  ++EGHWV+LQNIHLV+KWL  LEK LE   E+SH+ YRVF+SAEPS +P+ HIIPQGILEN+IKITNEPPTGMLANLH +L+NF+Q+ ++ C++E EFKTILF+LCYFHA V+ERRKFGPQGWNR YPFNTGDL ISVNVLYNYLEANS+VPWEDLRYLFGEIMYGGHITDDWDR+LC+TYLEEY+QP   D ++++ PGF VP N DY+GYH YIDE LP ESP  YGLHPNAEIEFLT +SD LF T+ E+Q RDSS       + EE++K ILDDI+EKLP+++NM +I +K    ER+P+++V FQECERMNML +EIRRSLKELDLGLKGEL I+++ME +  +L+ D +P++W++ AYPS+Y L  WY D+LLR +EL+ WT D  LPSV+W+ GLFNPQSFLTA+MQ +ARKNEWPLD+M L  DVTKK KE+   P R+GAY++GL+MEGARWD Q G I EA+LKEL PSMPVI ++AIP DRQ+ RN Y CPVYKTK R  T++WTF+LK++E+P+KW
Sbjct:  662 LLGADLDSEAWQSYTEYVDRHILTGFCSAVRCSLQYLVENTDAALSIAPLFEVQLTLT-TDMIFHPSLNLSRKGNFYDIIDQMVSDIFKMASFIKRVAKSKQSETYKEDVDQIPELVELAQLVRYRARGAIAKVKEFQHSFDSYRYLWTGDRAEFMRQFLLYGHALSAEEAELYADYELP---KNPPKLQNFREQISEFEDLYEKVRVLEEKRVFCGWCQVDINPFKRSLMNIIKKWSWMFKEHLLNHVNASVQELGSFIESTNLGLAKTVTDGDYGKLVDIMSHLKAIRDRQMSTEQLFRPLKATSDLLKTYNQQLPEHVYILLEALPEKWKNLKKVAFTVKHEVAPLQSNEVAVIRRKCVRFEIKQHEFREQFRSEPIFFIRLEEPYKLIDKTNRAVAHLESEMAKLQQTANLFEVSFPDYKQLRQCRSDIILVKAVWDMVMFVKSSISDWTKTPWKEINVEQMDMELRRFAKEMKTLDKEVRVWDVYNGLESIVKNLLTSLRAVNELQNSAVRERHWQQLMHTTGVSFVMDENTTLGDLLELQLHRVEEEVKNIVDKAVKEMGIEKIQQ----TWSMMSLSYEMHTSTGTPLLKADENLIDTLEDNQVQLQNILMSKYVEYFMVEVSGWQRKLVVADLVIGIWLAVQRTWAHLQSIFTNSEDIRNQLAHVAERFQGIHQDFQVFIVETDNVI---KVTNQPGFLEQLETLQQRLSVCEKALAEYLETKRLTFPRFYFVSASDLLEIVSKGTQPRQVTRHLLKLFDNLADLSFKEEKDNGELDPQTTIALGMYSREGEYVPFSQPCVCEGQAECWLNALEKAMCSTVRQEISEAVAAYEDKPRDQWLFDYPAQVALTGSQIWWATDVGIAFERVEEGFETALKDYNRKQISQLNSLINMLLGELTPGDRQKIMTISTIDVHARDVVAKLISQKVTSGQAFAWLSQLRHRWAEQQKHCYINICDAQFQFSYEYLGNTNRLVITPLTDRCYITLTQSLHLTMSGATSGPAGTGKTETTKDLGRSLGIMVYVFNCSEQMDYKSIGNIYKGLAQTGVWGCFDEFNRISVEVLSVVAVQVKTIQDAVRNKKQRFHFLGEDIELRSTVGIFITLNPGYAGRTELPENLKALFRPCAMVIPDYELICEILLVAEGFLDARLLARKFISLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKREDRSCPEEQVLMRALRDFNLPKVVTSDVPIFLGLISDLFPLLDIPRKRDHLLEQNVRQSVAELHLQPEESFILKVTQLEELLAVRHSVFVVGGPGSGKSQILKTLHKTYSNMKLKPIWTDINPKAVTTDELFGFLHPATREWKDGLFSSTMRELSGISHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERISLAPSMRLLFEISHLKAATPATVSRAGILYVNPQDLGWSSYVTSWIDTRQAQSERANLTILFDKYVPYCLEQVRCNLKTITPIPETSMVQTLCCLLDCLLTDENTPPDSPRELYELYFVFASVWAFGGALFQDHLIDYRSEFSRWWCKEMRAVKFPSQGSVFDYYIDPNTKRFTPWSERTPPFELEPDIPLQTVLVHSAETICLTYFIELLLQKGKPVMLVGNAGVGKTILVWDKISKLKEEFMVAKVPFNYYTTSAMLQRVLEKPLEKKAGRNFAPPGTKKLIYFVDDLNMPEVDAYGTVQPHTLIRQHLDYSHWYDRQRLVLKEIHNCQYITCMNPTAGSFSINPRLQRHFSVFAVHFPGADALSTIYSSILSGHFQQGGYSYGVSRMSSTLVQAAICLHQKMSQNFLPTAIRFHYIFNLRDISSIFQGILFALPEHVRYPIDLVHLWLHESSRVYSDKLMEEKDVELFNKILLDTGKRYFEGIDESIFINQPLIYSHFAHGVGEPRYAQVTDLEKLQKTLMDALEHYNELHSDMNLVLFEEAMQHICRISRILESPVGNALLIGVGGSGKQSLCRLAAFLSVLEVFQITLRKGYGISDLRSDIAALYIKVGVKNIGTVFLHTDAQIPDERFLVLINDMLASGDIPDLFSEEEIDMIVTSIRVELRALGLLDTRENCWNFFIDRIRRQLKVVLCFSPVGFTLRTRARKFPALVNCTVIDWFHPWPQHALQSVSSTFIQNIPDLEPDVRVSISEFISFAHTCVNEVSVKYQQNEKRFNYTTPKSFLEFMKLYGNLLGSKRTELRQKTERLENGLQKLLTTASQVEDLKAKLAIQEVELHLRNTDTEALIAKIGQQSEKLSQERSVADAEEKKVEAIQAEVTKQQQETEADLEKAEPALQAANAALNTLNRLNLTELRTFPNPPAIVSNVTAAVLVLLSPNGRIPKDRSWKASKV-VMSKVDDFLQALVNFDKERIPEATVRVIKDEYLSDPEFNPEFVRLKSSAAAGLSAWVINIIRFHEVFCEVEVKRLCLAQANADLVEAAEKLEIIRKKLAELDGSLETLTAAFEKATSEKLRCQDEVNQTNTTILLANRLVKGLESENIRWAHSVAQYREQESTLCGDVLLTAAFISYAGSFSKRYRYELLHNLWMPYLRAQKVPIPMSEGSDPISMLTDDATIAKWNNEGLPGDKMSTQNATILTNCERWPLLIDPQLQGIKWLKSRYGNSLKVINLSQKGYVDVIEQAVVSGEPVLIENLEETIEPVIDPLLGRHTIKKGRCIKVGDKECYFHPDFRLILHTKLANPHYKPEIQAQTTLINFTVTRDGLEDQLLAEVVNLERPDLEYLKVCLTKQQNMFKIELKQLEDELLTRLSAAESNFLGDNVLVEKLESTKHTAAEIEMKVLEAKVNEVKINEAREHYRPVAVRASLLYFIINDLNKINPMYQFSLKAFNVVFHKAVQNADASADVKIRVNTLIDCITFSTFNYINRGLFERDKLTFAAQLTFQLLLMNKEVDPRELDFLLRFNIDHSYISPLDFLSNSVWSAVKV-----SFRGLDRDIEGSPKRWKKMVESECPEKEKLPQEWKSKSSLQKLILLRALRPDRMTYAVRNFVEEKLGVQYTEGRKMEFARSFKECGPASPVFFILSPGVDPLKDVESLGKKLGFTIDLGKLHNVSLGQGQESVAELAMEKASREGHWVILQNIHLVAKWLGNLEKLLEHCCEDSHQDYRVFMSAEPSPTPQEHIIPQGILENSIKITNEPPTGMLANLHAALDNFDQDILDQCSREQEFKTILFSLCYFHACVAERRKFGPQGWNRKYPFNTGDLTISVNVLYNYLEANSQVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEYMQPNQFDRKMSLAPGFIVPSNLDYQGYHAYIDEMLPHESPVHYGLHPNAEIEFLTVMSDSLFHTLLELQSRDSSMGEGASQTTEEKVKTILDDILEKLPEEYNMSDITSKTA--ERSPFILVCFQECERMNMLINEIRRSLKELDLGLKGELAISSEMEQIQTALFFDNVPDTWARLAYPSIYSLGQWYNDVLLRCRELDSWTHDLSLPSVVWISGLFNPQSFLTAVMQSLARKNEWPLDKMNLTVDVTKKFKEEFNQPAREGAYIYGLYMEGARWDIQGGTITEARLKELTPSMPVIAVRAIPNDRQETRNTYECPVYKTKLRANTYIWTFSLKSRERPAKW 4257          

HSP 2 Score: 372.089 bits (954), Expect = 4.133e-102
Identity = 218/648 (33.64%), Postives = 359/648 (55.40%), Query Frame = 1
Query:  421 VILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGE--------VPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVK---EYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCW 2331
            V + VL +  NQ +WP V+  D+ RH   L+ +   + G+++G+TLL LP+  E+  E  +             + R+++Y+IET+VI+W   +  VL + S++ L  G +P P VEL +W  +  NL  I +QL +PKV ++  +L  + S+Y  PF  I + V  A+ E+++I+L+L  LR  +   E+  F+++EP+I  LFH L LIW H   Y  P RIV L  E  NL+I+    YL P+E+FK E EE +++V +++++   FK SF+ HR+K+     Y + G     W F   L+F R +S M R+ +++ +  + L+F KLE++E+ G +G+ LS+ + +M +EF + ++   E  YD LD    +F+ DY +F     D D+RL T ++ AF      ++ FKL+ +FG LL+RP +   F   Y +L+ M  EE+   + + D   +  EKV  ++ N+               R   PL           +++E   V++  + +LE+L   + + YNNW  G+DE C  +L++PLLI + ++   S+NF+  L +VLRE KYL IL    IP++A  ++SK + L  Y + L  + +WYN L    L VE  L+E+EL ++   L+ A+  L W
Sbjct:    1 VFISVLGSPLNQSAWPRVVGQDICRHLEHLRSEAVTLKGRAQGRTLLALPLCVERKDEHQLRCVYANQCSDTCLIDRALLYSIETMVIQWCRLMGSVLQRDSAKLLHQGDHPGPTVELTFWTKQKENLIGIQKQLQNPKVDQVLEILRRIKSSYYTPFDDIIQKVNYAVMEAEDIDLHLKTLRRPIAAFEERSFTDLEPLIPALFHTLALIWTHSDFYCHPARIVTLLTEFCNLLIDKASVYLIPEELFKMELEEGMDRVRKAIQVFCSFKRSFQLHRDKLTPTGPYSRPGLTVKPWDFPIELVFHRTDSIMERLRMIEELFASALDFLKLERIELGGSRGKILSEMVYNMNDEFLDSWRTLRESKYDPLDYNNKEFMSDYKRFMEQNQDFDQRLGTVINLAFQHSPGLESAFKLLQMFGTLLERPRVHQLFAPNYSQLLVMFQEEVSLCQRILD---TQREKV-SMNYNVCVRVRACVCVCVCVFR---PL-----------ESSEAKQVLQMCECVLEVLDVMDEEVYNNWSVGMDELCQTHLNKPLLILDEESSLYSLNFNPALMSVLREAKYLGILKNHNIPKAAVSLYSKREMLHMYTSTLLQITQWYNKLHSTILAVELRLVESELEEVRNTLKPALQELQW 630          
BLAST of DNAHb-1 vs. Ensembl Zebrafish
Match: dnah9l (dynein, axonemal, heavy polypeptide 9 like [Source:ZFIN;Acc:ZDB-GENE-050506-1])

HSP 1 Score: 4454.05 bits (11551), Expect = 0.000e+0
Identity = 2222/3618 (61.42%), Postives = 2793/3618 (77.20%), Query Frame = 1
Query: 2611 LLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEG--SKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEV-VQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDG------LFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLG-SNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAK-EYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            LL AD  SE W+ Y + +D  I+  F   +  SLQY+++  +   S  PLFEV + L   +++F PSL+     NF +++D +V+DIFK AS +KR+A     E Y+ D+++  EL +    +  R   A  K K +Q  FD Y  LWT +R EFM QFL YG A+SAEE E + + ++    + PP L  F+ QI ++E  +E++  +    +   W ++D   FK++ +N IK+WS MFK+HL++HV  S++EL  FI+ TN GL K   +GD+  LV++M HL  +++RQ +T+++F PLK T DLLKTYNQ++P+ V++ LE LPEKW N KKVA TVK  VAPLQ+ EVA IRRKC   + K +        +   +F C   +  L   +  ++ LE  M +L ++A LFEV+ P++KQL+QCR ++ L+K +WD +  V SSI  W KT WK+INVEQMD + + FAK +++LDKE+R WD Y G+E  +KN++TSLRAVNELQN A+R+RHW QLM  T V F M+E+TTL DLL+L LH  E+EV++IV+KAVKEM +EK+L E+  TWS M   +E H+ TG  LLKA E LI+TLE++QV+LQN++ SKY+ +F  EV  WQ+ L  AD VI IW  VQRTW+HL+SIF  S+DIR QL   +ERF  I  DF+  +   +      K +     Y  + V V   L +CEKALAEYLETKRL FPRFYFVS++DLL+I+S G  P  V +HL KLFD+LA LK         T + + MY+++GE V F+  C   GQ E WLN L + M +T+R  +SE+V++ E+K RDQW+F++PAQVAL+ SQI W T+V ++F R+EEG+E ALKD+N+KQI+QLN+LI +L+GEL+  DRQK+MTI TIDVH RDVV KLI+QK+ + Q+F WL QLRHRWA+  K CYINICDAQF++++EYLGNT RLVITPLTDRCYITLTQSLHLTMSGA +GPAGTGKTETTKDLGR+LGIMVYVFNCSEQMDYKSIGNIYKGLAQ+G WGCFDEFNRISVEVLSVVAVQVK IQDA++NK++RF FLGE+I L S +GIFIT+NPGYAGRTELPENLKALFRPCAMV+PD+ELICEI+LVAEGFL AR+LARKFI+LY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR D   PE+QVLMRALRDFN+PK+VT D P+F+GLI DLFP LD+PRKRD   E++VRQ+  +L LQ EE+F+LKV QL+EL AVRHSVFV+G  G+GKS + KTL KTYSN+K KP+  D+NPKAVT DELFG ++P+TREWKDG      LFS  MR+L+ ++ DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI L P+MRLLFEISHLK ATPATVSRAGILY+NPQDLGW  +V SWI TR+ QSE+ANLTILFDKYVP CLE ++   K ITPI E S VQ LC LL+ LL  ENTP D P+E YELYFVF ++WAFG  +FQD L+D+R EF++WW  E + +K P+QG+VFDYYID  TK+F PW++R   FE++ + PLQ VLV ++ET    YF++LL++K +PVMLVG AG GKT+L+ DK++ + + ++VA VPFN+YTTS MLQRVLEKPLEKKAGRN+ P G+KKLIYF+DD+NMPEVD Y TVQPHTLIRQH+DYSHWYDR +L LKEIHN QY+ CMNPTAGSF+I+PRLQRHF VFA+ FPG ++L  IYS+ILS       +S  + +  S LV  A+  H K++  FLPTAI+FHY+FNLRD+S+IFQGILFA P+ ++ P DLV LW+HE  RVY+DKL+++ D+E + ++  +  K+ FE +DE +   +PL+Y HFA G+GEP+Y  V   E L K L +ALE YNE+++ MNLVLFE+A+ HI RI+RILESP G ALL+GVGGSGKQSL RLAAF+S L+VFQITLRKGYGI+DL+ D+AALY+K GVKNIG VFL TDAQI DE+FLVL+ND+LASG+I DLF ++E++ I++S+R E+++ G++D+RENCW FFI+++R  L++VLCFSPVG TLR RARKFPA+VNCT IDWFH WP+ AL SVS  F+Q +  L  D + S ++F+SF H  VN+VS+ Y QNE+R+NYTTPKSFLE + LY N+L  K TEL+ K  RLENGLQKL +TA QV+DLKAKLA QEVEL  +N     L+ K+   ++K+S E+ +AD EE+KV  I+AEV+K+QQ+ E DL KAEPALQAA  ALNTLN+ NLTE+++F  PP  V +V+AA + L++ NG++PKDRSWKA+K  +M K+D FL  L+N++K+ IPE +++  K EY  DP FNPE ++ KS AAAGL +WVINII ++E+FC+V+ KR  L  AN +L EA EKL  I+ K+ +L+  L+ L   FEKA S+K RCQDE + T  TI LANRLV GL SEN+RW   V QY+ +E TL GDVL+T AF+SY G F+K YR  L+   W+P+L      IP+++  DP+ ML DDA IA WNNEGLP D+MS +NATILTN ERWPL+IDPQLQGIKW+K+R+G  LKV+ L QKGY+DVIEQAV +G+ VLIEN+EE+++PV+D LLGR+TIKKGR IK+GDKEC ++P+FRLIL TKLANPHYKPE+QAQTT+INFTVTRDGLEDQLLA VVN ER DLE LK+ LTKQQN FKI LK+LED LL RLSAAE NFLGD  LVE LE+ K TA EIE KV +AK+ EV INE RE YRP A RAS+LYFI+NDLNKINPMYQFSLKAF VVF KA+  A+ S ++K RV  LID ITFS + Y +RGLFE+DKL F AQ++FQ+LL  KE++P ELDFLLRF I  +  SP+DFLSN+ W  +K       F+ LDRDIEGS KRWKK VESE PEKEK PQEWK+K+SLQ+L ++RALRPDRMTYAV +FV+EKLG +Y EG  +EF++SF+E GPA+P+FFILSPGVDPLKDVE+LGKKLGF+ D     N+SLGQGQE VAE AM+  ++EGHWV+LQNIHLV+KWL  LEK LE   E+SH+ YRVF+SAEPS +P+ HIIPQGILEN+IKITNEPPTGMLANLH +L+NF+Q+ ++ C++E EFKTILF+LCYFHA V+ERRKFGPQGWNR YPFNTGDL ISVNVLYNYLEANS+VPWEDLRYLFGEIMYGGHITDDWDR+LC+TYLEEY+QP   D ++++ PGF VP N DY+GYH YIDE LP ESP  YGLHPNAEIEFLT +SD LF T+ E+Q RDSS       + EE++K ILDDI+EKLP+++NM +I +K    ER+P+++V FQECERMNML +EIRRSLKELDLGLKGEL I+++ME +  +L+ D +P++W++ AYPS+Y L  WY D+LLR +EL+ WT D  LPSV+W+ GLFNPQSFLTA+MQ +ARKNEWPLD+M L  DVTKK KE+   P R+GAY++GL+MEGARWD Q G I EA+LKEL PSMPVI ++AIP DRQ+ RN Y CPVYKTK R  T++WTF+LK++E+P+KW
Sbjct:  621 LLGADLDSEAWQSYTEYVDRHILTGFCSAVRCSLQYLVENTDAALSIAPLFEVQLTLT-TDMIFHPSLNLSRKGNFYDIIDQMVSDIFKMASFIKRVAKSKQSETYKEDVDQIPELVELAQLVRYRARGAIAKVKEFQHSFDSYRYLWTGDRAEFMRQFLLYGHALSAEEAELYADYELP---KNPPKLQNFREQISEFEDLYEKVRVLEEKRVFCGWCQVDINPFKRSLMNIIKKWSWMFKEHLLNHVNASVQELGSFIESTNLGLAKTVTDGDYGKLVDIMSHLKAIRDRQMSTEQLFRPLKATSDLLKTYNQQLPEHVYILLEALPEKWKNLKKVAFTVKHEVAPLQSNEVAVIRRKCVRANSKMY--------LRVLHFICFNEHNVLVGTNRAVAHLESEMAKLQQTANLFEVSFPDYKQLRQCRSDIILVKAVWDMVMFVKSSISDWTKTPWKEINVEQMDMELRRFAKEMKTLDKEVRVWDVYNGLESIVKNLLTSLRAVNELQNSAVRERHWQQLMHTTGVSFVMDENTTLGDLLELQLHRVEEEVKNIVDKAVKEMGIEKILGEIQQTWSMMSLSYEMHTSTGTPLLKADENLIDTLEDNQVQLQNILMSKYVEYFMVEVSGWQRKLVVADLVIGIWLAVQRTWAHLQSIFTNSEDIRNQLAHVAERFQGIHQDFQVFLFRKKC-----KKSENLNNYICVSVNVYFRLSVCEKALAEYLETKRLTFPRFYFVSASDLLEIVSKGTQPRQVTRHLLKLFDNLADLKLDP-----QTTIALGMYSREGEYVPFSQPCVCEGQAECWLNALEKAMCSTVRQEISEAVAAYEDKPRDQWLFDYPAQVALTGSQIWWATDVGIAFERVEEGFETALKDYNRKQISQLNSLINMLLGELTPGDRQKIMTISTIDVHARDVVAKLISQKVTSGQAFAWLSQLRHRWAEQQKHCYINICDAQFQFSYEYLGNTNRLVITPLTDRCYITLTQSLHLTMSGATSGPAGTGKTETTKDLGRSLGIMVYVFNCSEQMDYKSIGNIYKGLAQTGVWGCFDEFNRISVEVLSVVAVQVKTIQDAVRNKKQRFHFLGEDIELRSTVGIFITLNPGYAGRTELPENLKALFRPCAMVIPDYELICEILLVAEGFLDARLLARKFISLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKREDRSCPEEQVLMRALRDFNLPKVVTSDVPIFLGLISDLFPLLDIPRKRDHLLEQNVRQSVAELHLQPEESFILKVTQLEELLAVRHSVFVVGGPGSGKSQILKTLHKTYSNMKLKPIWTDINPKAVTTDELFGFLHPATREWKDGVCVCGCLFSSTMRELSGISHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERISLAPSMRLLFEISHLKAATPATVSRAGILYVNPQDLGWSSYVTSWIDTRQAQSERANLTILFDKYVPYCLEQVRCNLKTITPIPETSMVQTLCCLLDCLLTDENTPPDSPRELYELYFVFASVWAFGGALFQDHLIDYRSEFSRWWCKEMRAVKFPSQGSVFDYYIDPNTKRFTPWSERTPPFELEPDIPLQTVLVHSAETICLTYFIELLLQKGKPVMLVGNAGVGKTILVWDKISKLKEEFMVAKVPFNYYTTSAMLQRVLEKPLEKKAGRNFAPPGTKKLIYFVDDLNMPEVDAYGTVQPHTLIRQHLDYSHWYDRQRLVLKEIHNCQYITCMNPTAGSFSINPRLQRHFSVFAVHFPGADALSTIYSSILSGHFQQGGYSYGVSRMSSTLVQAAICLHQKMSQNFLPTAIRFHYIFNLRDISSIFQGILFALPEHVRYPIDLVHLWLHESSRVYSDKLMEEKDVELFNKILLDTGKRYFEGIDESIFINQPLIYSHFAHGVGEPRYAQVTDLEKLQKTLMDALEHYNELHSDMNLVLFEEAMQHICRISRILESPVGNALLIGVGGSGKQSLCRLAAFLSVLEVFQITLRKGYGISDLRSDIAALYIKVGVKNIGTVFLHTDAQIPDERFLVLINDMLASGDIPDLFSEEEIDMIVTSIRVELRALGLLDTRENCWNFFIDRIRRQLKVVLCFSPVGFTLRTRARKFPALVNCTVIDWFHPWPQHALQSVSSTFIQNIPDLEPDVRVSISEFISFAHTCVNEVSVKYQQNEKRFNYTTPKSFLEFMKLYGNLLGSKRTELRQKTERLENGLQKLLTTASQVEDLKAKLAIQEVELHLRNTDTEALIAKIGQQSEKLSQERSVADAEEKKVEAIQAEVTKQQQETEADLEKAEPALQAANAALNTLNRLNLTELRTFPNPPAIVSNVTAAVLVLLSPNGRIPKDRSWKASKV-VMSKVDDFLQALVNFDKERIPEATVRVIKDEYLSDPEFNPEFVRLKSSAAAGLSAWVINIIRFHEVFCEVEVKRLCLAQANADLVEAAEKLEIIRKKLAELDGSLETLTAAFEKATSEKLRCQDEVNQTNTTILLANRLVKGLESENIRWAHSVAQYREQESTLCGDVLLTAAFISYAGSFSKRYRYELLHNLWMPYLRAQKVPIPMSEGSDPISMLTDDATIAKWNNEGLPGDKMSTQNATILTNCERWPLLIDPQLQGIKWLKSRYGNSLKVINLSQKGYVDVIEQAVVSGEPVLIENLEETIEPVIDPLLGRHTIKKGRCIKVGDKECYFHPDFRLILHTKLANPHYKPEIQAQTTLINFTVTRDGLEDQLLAEVVNLERPDLEYLKVCLTKQQNMFKIELKQLEDELLTRLSAAESNFLGDNVLVEKLESTKHTAAEIEMKVLEAKVNEVKINEAREHYRPVAVRASLLYFIINDLNKINPMYQFSLKAFNVVFHKAVQNADASADVKIRVNTLIDCITFSTFNYINRGLFERDKLTFAAQLTFQLLLMNKEVDPRELDFLLRFNIDHSYISPLDFLSNSVWSAVKV-----SFRGLDRDIEGSPKRWKKMVESECPEKEKLPQEWKSKSSLQKLILLRALRPDRMTYAVRNFVEEKLGVQYTEGRKMEFARSFKECGPASPVFFILSPGVDPLKDVESLGKKLGFTIDLGKLHNVSLGQGQESVAELAMEKASREGHWVILQNIHLVAKWLGNLEKLLEHCCEDSHQDYRVFMSAEPSPTPQEHIIPQGILENSIKITNEPPTGMLANLHAALDNFDQDILDQCSREQEFKTILFSLCYFHACVAERRKFGPQGWNRKYPFNTGDLTISVNVLYNYLEANSQVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEYMQPNQFDRKMSLAPGFIVPSNLDYQGYHAYIDEMLPHESPVHYGLHPNAEIEFLTVMSDSLFHTLLELQSRDSSMGEGASQTTEEKVKTILDDILEKLPEEYNMSDITSKTA--ERSPFILVCFQECERMNMLINEIRRSLKELDLGLKGELAISSEMEQIQTALFFDNVPDTWARLAYPSIYSLGQWYNDVLLRCRELDSWTHDLSLPSVVWISGLFNPQSFLTAVMQSLARKNEWPLDKMNLTVDVTKKFKEEFNQPAREGAYIYGLYMEGARWDIQGGTITEARLKELTPSMPVIAVRAIPNDRQETRNTYECPVYKTKLRANTYIWTFSLKSRERPAKW 4208          

HSP 2 Score: 329.717 bits (844), Expect = 3.037e-89
Identity = 197/633 (31.12%), Postives = 325/633 (51.34%), Query Frame = 1
Query:  451 NQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGE---VPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVK---EYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCW 2331
            NQ +WP V+  D+ RH   L+ +   + G+++G+TLL LP+  E+  E  +    +   + R+++Y+IET+VI+W   +  VL + S++ L  G +P P VEL +W  +  NL  I +QL +PKV ++  +L  + S+Y  PF  I + V  A+ E+++I+L+L  LR  +   E+  F+++EP+I  LFH L LIW H   Y  P RIV L  E  NL+I+    YL P+E+FK E EE +++V +++++   FK SF+ HR+K+     Y + G     W F   L+F R +S M R+ +++ +  + L+F KLE++E+ G +G+ LS+ + +M +EF + ++   E  YD LD    +F+ DY +F     D D+RL T ++ AF      ++ FK            +L        F +V++                +G+   P + KNMP V G L+W +E+RERI    +  S L H   K          H  +           YNNW  G+DE C  +L++PLLI + ++   S+NF+  ++   ++ K +  L         T +                + +WYN L    L VE  L+E+EL ++   L+ A+  L W
Sbjct:   14 NQSAWPRVVGQDICRHLEHLRSEAVTLKGRAQGRTLLALPLCVERKDEHQLRCVSDTCLIDRALLYSIETMVIQWCRLMGSVLQRDSAKLLHQGDHPGPTVELTFWTKQKENLIGIQKQLQNPKVDQVLEILRRIKSSYYTPFDDIIQKVNYAVMEAEDIDLHLKTLRRPIAAFEERSFTDLEPLIPALFHTLALIWTHSDFYCHPARIVTLLTEFCNLLIDKASVYLIPEELFKMELEEGMDRVRKAIQVFCSFKRSFQLHRDKLTPTGPYSRPGLTVKPWDFPIELVFHRTDSIMERLRMIEELFASALDFLKLERIELGGSRGKILSEMVYNMNDEFLDSWRTLRESKYDPLDYNNKEFMSDYKRFMEQNQDFDQRLGTVINLAFQHSPGLESAFK------------VLCTHTTSVLFYVVQLR---------------TGS---PILGKNMPAVAGNLKWSQELRERILSNRSKLSQLTHMYIKD-------LTHLFMTLKYMYICFWIYNNWSVGMDELCQTHLNKPLLILDEESSLYSLNFNPAVRHTHKQTKPMYQLSLSPFKLRFTLLQ---------------ITQWYNKLHSTILAVELRLVESELEEVRNTLKPALQELQW 594          
BLAST of DNAHb-1 vs. Ensembl Zebrafish
Match: dnah11 (dynein, axonemal, heavy chain 11 [Source:ZFIN;Acc:ZDB-GENE-100922-8])

HSP 1 Score: 3668.63 bits (9512), Expect = 0.000e+0
Identity = 1786/3044 (58.67%), Postives = 2365/3044 (77.69%), Query Frame = 1
Query: 4309 KVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGS-NFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDE-MVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAK-EYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            KVL E+   W++MEF +E+H RT I +LK S+EL+E+LEE QV+LQ ++ SK    F+++V   Q  L+ AD V+ +W EVQRTW+HLESIF+ S+DI++QLPE++++F  ID+DFK L+ +   T NV+ AT +P L   LE +Q  L +CEKALA+YLE KR+AFPRFYF+SSADLLDILS G+ P  V  HL KLFDS+  L+F  +   + T   V M+++DGE V F ++CD  G VE WLN L + M+  +R  ++E+V   EE+SR+ W+ E PAQV L++SQI W  ++ L+F RL EG+E AL+D+NKKQI QLN+LI +L+GEL+  DRQK+MT+CTIDVH RDVV KLI QK+ ++Q+F W+ QLRH W D  K C+INIC+AQFRY++EYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSIGNI+KGLAQ+G+WGCFDEFNRI+VEVLSVVAVQVK I DAI+N+ KR  FL EEISL  +IGIFITMNPGYAGRTELPENLKALFRPCAMVVPD ELICEIML++EGF  A+IL  KFITLY+LCKELLSKQDHYDWGLRA+K VL VAGAL+R+D  RPEDQVLM+ALRDFN+PK++++D PVF+GLI DLFP L+V R  D EFE  VRQ + +LKLQ E+ F+ KVVQL+EL +V HSVFV+G AGTGKS + KTL KTY N+ +KP   DLNPK+++NDELFG  +P+TREWKDGL S  MRD A+ +  GPKWIVLDGDIDPMWIESLNTVMDDNKVLTLA+NERIPLTP+MRLLFEISHL+ ATPATVSRAGILYINPQ+L W   V SWI  RE Q+E+A+LTILFDKY+P C+E ++  FK I PI E S VQ LC LL+ LL PEN PAD P+E YE+YFVF  +WAFG    QDQL D+R EF++WW+ E K++K P QG+VFD+ +D  +K+F PWT R+  FEMD + P+QAVLVPT ET R +Y + +L++  +PVMLVGGAGTGKT ++++ L ++ +N++   VP +FYTT+ MLQ+ +EKPLE+KAGR++ P  +K+L+YFIDDMNM  VD Y T QPH LIRQH+DY HWYD  KLT+K+I+NT Y++CMNPT+GSFTI+PRLQRHF V A+S P +E+L +IY +IL+  L    FS ++++  + ++  AL  H ++   FLP++ KF+++FNL DLS IFQG+LF+ P+C+K+ +DL +LW+HE  RVY+D+  + +D++ + R Q ++ ++A EE++E  V+F++P++Y H + G  E  Y PV   E L+ +L +AL +YNE+++ MNLVLF++A+ H+ RI+RIL  PRG+ALL+GVGGSGKQSL+RLAA +S++DVFQ  L KGYGI DLK+DLA LY+K GVKNI  V LLTDAQI +++F V+++ L++SGEI DL  ++E+E +  ++++EV+  G++D+ ENCW FF+N+VR  L++VLC SPVG+ LR+R R+FPA+++CT++DWF EWP++AL SVS ++LQE+  +     +S + FM+  H +V +VS  Y  NE+R+NY+T KSFLEQ+ LY ++L+ +  EL  ++ RL++GLQK++STA QV+DL  KL +QEVEL  KN +A  L+ ++   T++VS ++  AD+EE+KV+ ++AEVS++ ++CE+DLAKAEPAL AA  AL TLNK NLTE+K+F  PP AVI+V+AA M L+A  G++PKDR WKAA+   MGK+D FL  L++Y+K++IP+  L   K EY K+P F+P+ +++KS AAAGLC+W+INI+ YYE++C+V PKR AL  AN EL  AT KL  ++ K++ L+  LQ L  +FE+A ++K RCQ+E   T +TI+LANRLVGGL +ENVRW +   + + + KT+ GDVL+  AF+SY G FT+PYR  L+    +PFL  L   +P+T  LDP+ ML D A +A W N+GLP+DR+SIENA IL +++RWPLI+DPQ Q  KWI+  +G  L+V++ GQKGYLDVIEQA++ G+VVLIEN++E +DP+L+ LLGR T+KKGR I+LGDKECEY+  FRL+L TK ANPH+ PE+QAQTT+INFTVTR GLEDQLL  VV +ER +LE +KL+L+ QQN  +I LK LED LL +LSAAEGNFL D ALVE LE+ K TA  I+ K   A+  E+  NE R+LYRPAA RA++LYFI+ +L+ +NPMYQ+SLKAF  VF KAI RA   E++  RV +L +SIT S   YT +GLF++D+L F    + Q+LL    I+  +L+ LLRFP+    +SP+ FLS  +WG IK++S  + F+ LDRD+EGSAKRWKK VESE PE+E+FPQ+WK K+ LQRL ++RA+RPDRMTYA+ +F+++ LG KYV    +EF + FEE  P TP+FFILSPGV+P+KDVE LG KLGF+ D  NF N+SLGQGQE VAE A++  AK GHWV+LQNIHL+S+WLS LE+ LE  A  +H +YRVF+S EP+ +P  H+IP+ ILEN++K+T EPPTGM + LH +L+NF+++T+EMC++E EFK ++F+LCYFHA VSERRKFGPQGWN  YPFN GDL IS NVLYNYLEA++KVPWEDL YLFGEI+YGGHITD+ DR LC+TYL+E++ P+M +GEL + PGF  PP+ DY  YH Y+DE LP+ESP L+ LHPNAEIEF+T+ S+ LFKT+ E+QPRDS+ A       EE+++ ++D+++EKLP+++N+ E+ +K    +R+PYV+V  QECERMN+L   I  SLKEL L LKGEL++++DME L  +L+ DV+PESWS+  +PS   L  W++D+L + +EL+ WT DF  P+V+W+ GLF+PQSFLTAIMQ +ARKN+WPL++M+L  DVTKK+K+D G PPR+GAY+HGL++EGARWD  SG+++EA LK+L P+MPV++I+A+PVD+QDL+N Y CPVY+TK+RG T++W+F LKT   P+KW
Sbjct:   13 KVLTEISQMWARMEFVYEEHYRTAIPMLKCSDELLESLEESQVQLQVLLHSKQAVFFHEQVLELQAQLTQADSVLLLWLEVQRTWAHLESIFMSSEDIQQQLPEEAQQFCSIDSDFKNLMFKNGNTRNVIAATNRPNLLPTLEDLQRRLSVCEKALAKYLEAKRMAFPRFYFLSSADLLDILSKGHQPRQVTCHLGKLFDSMTDLQFSDKEGGKATS-AVGMFSRDGEYVSFFSSCDCVGPVELWLNCLEDVMKEGVRRFIAEAVVMYEERSREHWVLELPAQVVLTASQIWWSADMNLAFERLAEGFETALRDYNKKQIAQLNSLINMLLGELNPGDRQKIMTLCTIDVHARDVVSKLIAQKVSSAQAFAWVSQLRHSWNDEQKHCFINICNAQFRYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSIGNIFKGLAQTGAWGCFDEFNRIAVEVLSVVAVQVKTIHDAIRNQSKRILFLEEEISLKPSIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDMELICEIMLMSEGFQSAQILGNKFITLYRLCKELLSKQDHYDWGLRAVKPVLAVAGALRRADRTRPEDQVLMQALRDFNMPKMISEDVPVFLGLIRDLFPGLEVERGIDAEFEHLVRQTSQELKLQPEDTFIQKVVQLEELLSVHHSVFVIGEAGTGKSQILKTLHKTYFNMGRKPFWNDLNPKSMSNDELFGFFHPATREWKDGLLSHFMRDQASNSHSGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLANNERIPLTPSMRLLFEISHLRHATPATVSRAGILYINPQELSWSLSVMSWIDRRERQTERAHLTILFDKYIPRCIEKMRSSFKTIIPIPENSMVQTLCSLLDCLLTPENIPADSPRELYEMYFVFACVWAFGGATVQDQLHDYRAEFSQWWIKEMKSVKFPVQGSVFDFCLDPHSKRFVPWTDRIPAFEMDPDIPVQAVLVPTVETVRLQYLMSMLLKASQPVMLVGGAGTGKTAVVKNLLETLPENFITTKVPLHFYTTALMLQKEMEKPLERKAGRSFAPPRNKRLLYFIDDMNMAAVDSYGTSQPHALIRQHLDYQHWYDSQKLTMKDINNTDYVSCMNPTSGSFTINPRLQRHFTVLAVSSPSRETLSSIYGSILNIHLQILPFSPAVMRCSAFVLKAALTLHERVLQHFLPSSSKFYHLFNLWDLSRIFQGLLFSRPECVKRGADLFQLWIHESRRVYSDRFSEPSDLQMFLRFQVDIARQASEEIEEDSVLFQEPVIYLHSSLGSAESSYKPVSGWEHLTCVLNDALNNYNELHSTMNLVLFQEAMQHVCRISRILACPRGHALLIGVGGSGKQSLTRLAAHLSNMDVFQPKLSKGYGIQDLKMDLARLYIKTGVKNIPTVLLLTDAQIPEDQFFVIISTLISSGEIPDLLSEEEVEGVRKAVKSEVRDLGLLDNNENCWRFFMNRVRHQLKVVLCMSPVGNALRLRVRRFPALLSCTTLDWFQEWPQEALQSVSLKYLQEIPSIEPTIWESISLFMAHAHTSVKRVSERYCCNEKRHNYSTSKSFLEQLRLYKSLLENREKELHQRLDRLQSGLQKIKSTASQVEDLTVKLNSQEVELTMKNQAAEALMARIGLQTERVSQKREDADLEEQKVAAMQAEVSRRLKECEKDLAKAEPALDAATAALQTLNKVNLTELKTFPNPPEAVINVTAAVMVLLAPRGQIPKDRGWKAARV-FMGKVDDFLQALLSYDKEHIPQSCLNVVKQEYLKNPEFHPDHVRTKSYAAAGLCAWIINIVRYYEVYCEVAPKRLALAQANSELETATTKLLSVRRKLEDLDRHLQSLTAQFERAATEKLRCQEEVTRTSQTIKLANRLVGGLQAENVRWSEGQLELEGQLKTVCGDVLIAAAFVSYAGYFTQPYRHQLLHDMLIPFLRELRTPVPLTDGLDPVLMLTDQATVAGWQNQGLPADRLSIENAAILKSSQRWPLIVDPQQQASKWIRNLYGPSLRVLQYGQKGYLDVIEQALACGEVVLIENMKERVDPLLEPLLGRQTLKKGRYIRLGDKECEYDKGFRLLLHTKQANPHFPPELQAQTTLINFTVTRSGLEDQLLGQVVTQERPELEMMKLELSTQQNLCQIELKRLEDELLSKLSAAEGNFLRDTALVEQLEHTKNTARHIQNKAVAARENEIKTNEARDLYRPAAERAALLYFIIKELHNVNPMYQYSLKAFNKVFLKAIARAPSDEDVSVRVLSLTESITHSALQYTCQGLFQRDRLTFLTHTALQVLLMRGFIDGEDLEILLRFPVEICESSPVSFLSPQAWGAIKSISMQDAFRGLDRDVEGSAKRWKKLVESECPERERFPQDWKTKSPLQRLIILRAIRPDRMTYALRNFIEDSLGPKYVHISHMEFEKCFEECSPTTPVFFILSPGVNPVKDVEKLGLKLGFTTDRGNFHNVSLGQGQETVAEIALETAAKNGHWVMLQNIHLLSQWLSRLEEMLENTASNAHSNYRVFMSGEPAPNPHEHLIPRTILENSLKLTTEPPTGMNSTLHAALDNFSKDTLEMCSREQEFKGLMFSLCYFHACVSERRKFGPQGWNHKYPFNNGDLNISANVLYNYLEASTKVPWEDLCYLFGEIIYGGHITDERDRMLCRTYLQEFINPKMFEGELFLCPGFPAPPDLDYSEYHRYVDERLPSESPALFRLHPNAEIEFMTATSESLFKTLLELQPRDSTTAEGATQYTEEKVRSVVDELLEKLPEEYNVAELMSKT--AQRSPYVLVCLQECERMNLLLEHIHTSLKELHLALKGELSLSSDMELLQTALFYDVVPESWSRLTFPSTKTLPQWFSDVLAQCRELDTWTHDFVFPAVVWISGLFSPQSFLTAIMQSIARKNKWPLNKMSLSVDVTKKSKDDYGHPPREGAYIHGLYIEGARWDCSSGLLSEAVLKDLTPAMPVLYIRAVPVDQQDLKNTYECPVYRTKQRGTTYIWSFPLKTHHPPAKW 3052          
BLAST of DNAHb-1 vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2270.74 bits (5883), Expect = 0.000e+0
Identity = 1485/4510 (32.93%), Postives = 2379/4510 (52.75%), Query Frame = 1
Query:  166 TDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSV----ISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVE------ISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTL---ASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIR-NMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNS----DALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTI-RIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEG----SKDPLFEVSMDLQGNEIVFQPSLDRDYAD--------NFSELVDSLVTDIFKQASKVKRLA-----IGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEH--YEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRS--WDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNEST-TLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXX--XRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKK-QITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKP-------LAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPEN--TPADCPK--EWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIK--LPAQGTVFDYYIDTETKKFEPWTKRMTK-FEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNF--YTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFT-ISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFE-EMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAA--MNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPED-YKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVS----KIKAEVSKKQ---QDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKT-RHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRA--IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPID-----FLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTS-LQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXX-RVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDG---ELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPR-DSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERG-----PTFVWTFNLKTKEKP 13422
            T+E +Q +  F     ++ L V   P  G L +    P  +  +  +F + A +S+  + +F   + FG +    ++     ++ V  P ++ +    +WP       S+++ R    L      +LG +     +PL     +  E   N      ++++  +E VVI W  QI  VLS QS   +   L P    E+ +WK+R  +L+ I  QL  P V+ +  +L+   STY PPF  + K +  +  ++Q+   +L+ L+   EE+ Q++  E+ P +  + +++ +IW +   +   +RI  L ++ISN II  C   +    IF+G    + + +   ++    +KE +    +   ++   G     W      IF  ++SFM R + +  I     +F + E  E       +G  G  ++Q ++ +   F    +   +   D LD     + +DY +F+A + DL+  +   ++  F   +C +   +L+D+F  L  R  +K   D++  ++  +   E+       +I++        I   MP+  G++ W K +  R++  + +   A  L H        + +   + +L + L +   + + +W   + + C  +L QPL+IR    T  + +NF+  L  +  E+ Y   L Q EIP   T+++ + + L     N+ L+V  YN + K+    E  L    +  +D++++  ++ L W++     A  N    +  +V+ +V   ++  + + ++ + I  +++ +     ++   E + D   +   +  R    +++I +   RV+G        L    V +HW  Y++ ID M+ E F+  I  SLQ +   I G    S +PLF V       E+V  P   R  A           + +V+S+ + + K  S  KRL        S  +   + +E++EE+ K +  I+          + Y   +D++  +W   ++ F+ ++ R                         PT+  F   I +Y +    ++K      + ++  +DC   K + L     W   F Q L    ++ LKEL  F++     L++         L E +  L  ++      +    P+ +   +L  Y   +   V   LE L  +W   ++V +     +   ++   + +      F  K  TF + F    PF  S   H   + +     ++  L++  + +     +F +  P  K +    K++  L+ +W+           WK      +  E MD   ++  K++  L +  +   W+     + +I+     +  + +L+N A+R+RHW Q+    +  FD + +  TLE ++ L L +  + +  I   A KE+S+E+ L+ +  TW +M  +   H   G   L+ ++E+ + LE++QV L  +  S+++  F  EV  W++ LS   +VI++   VQR W +LE+IF+ +DDIRKQL  ++  FD + + +K ++  +++  N ++ T  P L E+L  + ++L   +K+L  YLETKR  FPRFYF+S+ DLL+IL    +PE V  HL K FD++  L+  K     N      M++ DGE V+FT+   L G VE WL  +   MR T++  L     ++++    R +W+ ++P Q+ +++SQI W T+V  +    +E  + +     KK Q++ LN     + G L+K  R K++ + T++VH RDV+ KL      +  +F WLCQLR  W     DC I   +  FRY +EYLGN+ RLVITPLTDRCY+TLT +LHL   G+P GPAGTGKTET KDLG++LG+ V V NCSE +D+KS+G +Y GLAQ+G+WGCFDEFNRI++EVLSVVA Q+  I  A+      F F G +I+L  + GIFITMNPGYAGRTELP+NLK++FRP +MVVPD  LI EI L AEGF   ++LA+K  TLY L  + LSKQDHYD+GLRA+ S+L  AG  +R+ PD  ++++L+ +++D NI K+ + D P+F G+I DLFPA++ P     + ++ V        LQ     V KV+QL E    RHS  ++G  G+GK++ W+TL  T S L +             LNPKAV+  EL+G  N ST EW DG+ S +MR          KWIV DG +D +WIES+N+VMDDNKVLTL + ERI +   + LLFE+  L  A+PATVSR G++Y +  DLGW+P+V SW+  R+ + E   L  LF++Y+   L   K   K++  I E++ V  LC L + L   EN   PAD        EL+F+F  IW+   C   D+    +++      T  + I+   P + T+++YY+DT+ K +  +  ++ K +      P   ++VPT +T R+ Y +  L+  + PV+L G  GTGKT + Q  L S+ DN   A +  N    T+S  +Q ++E  +EK+    Y P G KK++ F+DD+NMP VD + +  P  L+R  IDY  WYDR K TLK I +   L  M P  G  T IS RLQ  F +  ++FP +  +K IY T++S+KL   F   +      L    L  ++ I S FLPT  K HY+FNLRD+S +FQG+L A  D       + RLW+HE  RV++D+L+D  D+ET+  +  E     F+     +   K+P L+  F +      Y  +   + L   ++  LE YN       M+LVLF DA+ H+ R+ R++   RG  LLVG+GGSG+QSL+RLAA+I    VFQ+ + K Y   + + D+  LY   GV+N   VFL  D QI DE FL  +N++L+SGE+ +L+  DE++ I S++ +  +   ++++ +  + + I +VR+ L +VLC SPVG   R R R++PA+VNCT+IDWF EWP DAL+ V+ R L  + L  +D  +   A     VH++V + S       +R+NY TP ++LE ++ Y  +L +K  EL  ++S+L NGL K       +DD + K+ A  VELE+      E  ++       +  +KR AD +++ V     KI+AE  K +   ++ +RDL +A PAL+ A +AL +LNK ++TE+KS+G PP  V  V  A M L         + +W  AK   +G+ + F+  L+N++KDNI +  LK   +YC  P+F PE I   SLAA  LC WV  +  Y  IF  V+PKR  L  A  +L E    L+  Q K++++ ++L  L+ ++++  + K+  + +++     ++ A +LV GLA E VRW + V+  +     L GD L+  AFLSY+G F   +R  L+   W+  +  L   +P +        L     +  WN +GLPSD  S EN  I+T   RWPL++DPQ Q +KWIK       LKV+ L    +L ++E AV  G  VL++N++E +DP L  +L ++  + G    +KLGDKE EY+PEFR  + TKL+NPHY PE+ ++TTI+NF V   GLE QLL  VV KER +LE  K  L       K  L+ELED +L  L+ A G+ L D  LV  L+ +K TA E+ E++E +++TE  I+  RE YRP A RAS+L+F+LNDL  I+PMYQFSL A+  +F  +I+ +  S +L+ R+ NL    T++VY YT RGLFE  KL+F+  M  +IL  + ++N  E +F LR  +V +    +D     +LS+++W  I  L  L  F  L    E   + W  +  +  PEK   P EW+N  + LQ++ ++R+LR DR++  V  FV   LG ++VE   ++      +S   TP+ F+LSPGVDP   +  L +    SG  + F  +SLGQGQ  +A + +  G   GHWV L N HL   W+  L+K ++E   +      R+++S+ P   PE    P  IL+  IKIT EPP G+  N+ +     ++     C++   ++ +LF+LC+FH+V+ ERRKF   GWN  Y FN  D  +S N+L  YL+   ++PW+ L++L   I YGGH+TDDWDR+L  TY+ +Y  P ++D    +++ +  + VP +     Y +YI +    E P L+G +PNA+I    + +  LF T+  +QP+  S+   + G SRE+++ ++  D+++K+P + +  E   K+  ++ +P  VV  QE +R N L   IR SL EL+ G+KG + +++ +E   N ++   +P  W K AYPSL  LA W  DL  R+++   W    + P + WL G   P  FLTA++Q  AR+N   +D ++ +  VT     ++  PP+DG  + GLF+EGA WD ++  + EA+  +L   MP I  K +   ++  +N+Y+CP Y    R       +FV   +LK+   P
Sbjct:   92 TEENEQALDKFISDSSVRLLVVYHDPFTG-LYVDYAMPAQVVEQMSYFIR-APDSMITEESFRSSVQFGSVRGGAIEGLLRMMNGVHTPQVTLST---TWPETSKNNYSAELHRFLTKLTDSRFKLLGSTV--LYIPLEALQHRPEEAVKN------KNLVQRLEMVVIHWTRQIKAVLSAQSVSDIGDTLGP--LEEISFWKSRCADLDSISTQLQKPGVRHIQEILQLYTSTYIPPFCKLAKQIQESSLQAQSNVTFLSLLKEPCEELAQLKPCEIAPKLAHILNLIRVIWVNSSYFNTRDRITALLRKISNEIIRLCCREISLNRIFQGYAVSSKQILNDCIQCCLAWKELYLHTSQLHHKHSSQG-----WSLDQISIFALVDSFMQRCKDLIEICECQQQFARWEDGERVPLPCFAGRLGSEVTQKLLYIEATFDKSLQ-VLQSVQDILDVRNPSWHEDYSRFRAKLKDLEVMMQNLITSTFEMVNCVEEGVQLLDVFQHLSGREAIKRTIDRKTVDVYNLFHSEL------VEINLVMCRTSSLIPVQMPRYAGQIHWTKALHSRVERSMEVLRRAHFLPH----VRSADEMHVIYVKLCQTLDEKVRRIFTDWSQSLSKECHSSLDQPLMIRCKGKTGLLDINFNKNLLKLFNEIHYWDRL-QFEIPHFVTEVYQRREELHNLRENVLLVVRDYNRIIKDLNADELGLFSERIRFLDKKIQPGLSKLHWSTKGTPSAFINDCRVHANKVQLMVDEYKAANLATSKHCEQISELLLVHLDGKTVYRDHEFQEDQQTHQHSQMLRLQNAHQDIIKIMARVYGTFH-----LDGPEVQQHWTSYMEKIDQMLEEAFRVNIKRSLQELSKAINGDGKISPNPLFRV-------EVVLTPETARSTAQVDFSPSPQKLAHIVNSISSQLIKTISGFKRLPDLLTRQQSQRKPIHSIIEQDEEICKIQGAIAAGMVTNASYLQTYLKTWDKHREIWEIEKDSFIQRYQRLN-----------------------PTVTSFDADIARYTEVANNVQKEETLLSV-QFVLLDCSPLKFSLLQHCNEWQSKFTQLLSLMASSKLKELHSFLQENAVRLSQPPQ--TLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAVDPAVLELLEALNAEWVWFQQVVIDSDIMLKKHKDTMKSGLILSSEEFQKKTQTFLQSFSSNGPFGSSVTPHSALQQVSELRAQLEALKEEEQNICSGLNIFTIEQPASKDILALEKDVDYLQQVWEIARQWEDLWAEWKGGHLASLQTEVMDNTAQTMFKTLHKLSRAFKDKHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKDKGHHKLRGTDEVFQALEDNQVTLSVIKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFL-ADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTG-NKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWPGQMLITASQIQWTTDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEAIRGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSFEGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDIVDEEILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSWMEKRQ-KVETDLLWQLFERYIDKTLAFKKTHCKELVAITELNGVASLCRLYQSLATAENGVKPADSENYGRMVELWFIFSLIWSV--CASVDEEGRKKID------TFLREIEGSFPNKDTIYEYYVDTKNKTWASFEDKLPKGWRYASNAPFYKIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVAQSVLQSL-DNITWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDYGFWYDRQKQTLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIYGTMISQKL-QEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLR--ESQIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSLGSDDGIQTKVASIFVTVHQSVAQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFK-------IDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGC------EPTWAEAKRQ-LGEGN-FIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELE--VPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELDKLTNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLAET---SGMGQRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSP--HPE---FPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYEEIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTPFFKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPAEIDY-EGTRKLLKDDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEK-AYPSLKPLASWTRDLCQRVEQFARWAETARPPVLFWLSGFTFPTGFLTAVLQSSARQNNVSVDTLSWEFSVTTVEDNNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKRLAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVP 4489          
BLAST of DNAHb-1 vs. Ensembl Xenopus
Match: myh2 (myosin, heavy chain 2, skeletal muscle, adult [Source:Xenbase;Acc:XB-GENE-5760121])

HSP 1 Score: 5446.71 bits (14128), Expect = 0.000e+0
Identity = 2698/4035 (66.86%), Postives = 3250/4035 (80.55%), Query Frame = 1
Query: 1348 ILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHV-SGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSKD--PLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSI-GDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLG-SNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPL-LYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLN-KNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            +L   L+  KLEK+  +G+KG +L Q ++ M++EF+ +FK F++++ DCLD    +F +D  +F+  + D+DRRL     Q F D    +  FKL+D+FG LL+RP++  E   +Y  L+ M D+E+++ K++Y+ H+ +  E    I++NMP V G L+W +++RER+++     S+  H+                            Y  W   V E   +NL++PL++R+ +T  I VNFD +L +VLREVKYL+ L  E IP  A DI S  ++ R +  NL+L    YN + +  L VE PLIE +L  ID +L++A   L W +    NG W+YI++VRD+VH+L  RV K+++N+D I+ IM  W   P+FERK+G+ + LL+LDDR DR  KRY  I E+G ++H L+KEN EL  AD  S+ WK YVD IDDM+++ F   I  SL+ ++D  +      PLFEV MDL   ++VF+P L+   +D   ++++ L+ DI++ ++ V RLA  S+   Y+ D+E+  +L   RN I E  +        Y+  FD Y+ L+ D+R+EFM QFL YG  ++AEE+EAH E  +    E PP+L QFK QID YEK +EEI ++   NI D W R+D + FK A LN +KRWSLMFKQHLIDHVTNSL +L EFIK+   GL+K+  EGD+ GLVE+MGHL  VKERQ  TD++FEPLKQTI+LLK Y+QE+PDEV+ QLEELPEKWNN KK+A+TVKQ VAPLQ  EVA +RR CATFDV+QH FRE FRK  PF F  +  Y+ LD K++EI  +E  M  + ESAALFEV +P++KQLKQCRKE+ LLK LWD I +V S++  W+ T W++INVE MD +CK FAK IR+LDKEMR+WDA+TG+++Q+KN++TSLRAV ELQNPAIR+RHW+QLM AT V+F M+E TTL DLLKLNLHNFEDEVR IV+KAVKEM MEKVLKEL +TW  M F +E H RT + L+K+ EELIETLE++QV+LQN+MTSKYI+ F +EV  WQK LSTAD VI IWFEVQRTWSHLESIFIGSDDIR QLPEDS RF+ IDTDFK L  +  +T NV++AT KP LYERLE +Q  L LCEKALAEYL+TKRLAFPRFYF+SSADLLDILSNG +P++VM+HL+KLFD++AK+KF ++++   +K+G+ MY+K+ E V F   CD  GQVETWLNR+L+ MR T+R  ++E+V++ EEK R+QW+F++PAQVAL+ +QI W TEV +SFARLEEGYEN +KD+ KKQ+ QLN LIT+LIG+LSK DRQK+MTICTIDVH RDVV K+I QKIDN+Q+F WL QLRHRW D  K C+ NICDAQF Y++EYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKS GNIYKGL+Q+G+WGCFDEFNRISVEVLSVVAVQVK IQDAI++K+KRF+FLGEEI+L  ++GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGF++AR+LARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DPDRPEDQVLMRALRDFNIPKIVTDD PVFMGLIGDLFPALDVPRKRD EFE  V+QA LDLKLQAE+NFVLKVVQL+EL AVRHSVF++GNAGTGKS V K+L KTY  +K++P+  DLNPKAVTNDELFGIINPSTREWKDGLFS IMR+LAN+T DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPL PTMRL+FEISHL+TATPATVSRAGILYINP DLGW P V SWI  REIQSE+ANLTILFDKY+P+CL+ L+ RFKKI P+ E S VQMLC+LLE LL  ENTP DCPKE YELYFVF A+WAFG  MFQDQLVD+RVEF+KWWVTEFKTIK P+QGTVFDYYID E+KKFEPW+K + KFE D E PLQA LV T+ET R RYF+D L+E+RRPVMLVG AGTGK+VL+ DKL+S+  D Y++ NVPFN+YTTS MLQ VLEKPLEKK+GRNYGP G+KKLIYFIDDMNMPEVD Y TVQPHTLIRQH+DY HWYDR KL++KEI N QY++CMNPTAGSFTI+PRLQRHFCVFALSFPG ++L  IY+TIL++ L   NFS  L K+   L++LAL+FH KI S+FLPTAIKFHY+FNLRDLSNIFQGILF+ P+C+K P DLV+L++HE  RVY DK++++ D +T+ ++Q E+ KK +++M+EM+   K + +YCHFA G+GEPKYMPV+  E L+KIL E L++YNEVNA M+LVLFEDA+ HI RINRILESPRG ALLVGVGGSGKQSL+RLAAFISSLDVFQITLRKGYGI DLK+DLA  Y+KAGVKN+G VFL+TDAQ+ADEKFLVLVNDLLASGEI DLFPDDE+ENIISS+RNEVKS G++D+RENCW FFI++VR  L++ LCFSPVG+ LRVR+RKFPAVVNCT+IDWFHEWP++AL SVS RFLQE E +    K S +KFM++VH +VN++S SYL NERRYNYTTPKSFLEQI LY N+L KK  EL  KM RLENGLQKL ST+ QVDDLKAKL          N  A++L++ V  +T+ VS EK IAD EE+KV+ I  EV                          TL    NLTE+KSFG PP AV +V+AA M L A  GKVPKDRSWKAA+  +MGK+D FLD+LI + K++I E  +KA + Y +DP FNPE I SKSLAAAGLCSWVINI+ ++E++C+V+PKR AL  AN EL  A EKLS I+ KI  L + L KL  +FEKA +DK +CQ EA+ T  TI LANRLVGGLASENVRW + V  +K++E TL GDVL+  AF+SY+G FT+ YR  LMD  W P+L  L   IP+T +LDPL ML DDA IA+W NEGLP+DRMS ENATILTN ERWPL++DPQLQGIKWIK ++G  L+V+R+GQ+GYLD +E+A++ G+VVLIENIEES+DPVL  LLGR TIKKGR IK+GDKECEY+P FRLIL TKLANPHY+PEMQAQ T+INFTVTR GLEDQLLA VV+ ER DLE LK +LTKQQN FKITLK LED+LL RLS+A GNFLGD ALVENLE  K+TA EIEEKV++AK+TE  INE RE YRPAAARAS+LYFI+NDLNKI+PMYQFSLKAF VVF++A+ +A   E LK RV NLIDSITFSV+ YT+RGLFE DKL +TAQ++FQILL  KEIN  ELDFLLR+P  P LTSP+DFLSN SWGGIKALS ++EF+NLDRDIEGSAKRWKKFVESE PEKEKFPQEWKNK++LQRLCMMRA+RPDRMTYAV DFV+EKLG KYV G  ++F+ S+EESGPATP+FFILSPGVDPLKDVE  G+KLG++ DN NF N+SLGQGQEIVAE+A+DL AKEGHWV+LQNIHLV+KWL  LEK+LE+ +E SH+++RVFISAEP+GSPE HIIPQGILEN+IKITNEPPTGM ANLHK+L+NFNQ+T+EMC+K++EFK+ILFALCYFHAVV+ERRKFGPQGWNRSYPFNTGDL ISVNVL+NYLEAN+KVP++DLRYLFGEIMYGGHITDDWDR+LC+TYLEE+++ EML+G L + PGF +P N DY GYH YID+ LPAESPYLYGLHPNAEI FLT  S+KLF+TV EMQPRDSS     G++REE++K  LD+I+EKLPD+FN+ E+ AKV  EER PY+VVAFQECERMN LTSEI+RSL+ELDLGLKGELT+T+DME L N++++D +PESW+KRAYPS+ GLA W+ DLL RIKELE WT DF LPS +WL G FNPQSFLTAIMQ MARKNEWPLD+M LQCDVTKKN+ED   PPR+GAYVHGLFMEGARWDT +G+I +++LK+L P+MPVIFIKA+PVD+Q+ RNVY CPVYKT++RGPT+VWTFNLKTKE PSKW
Sbjct:  317 LLLTALDMMKLEKIVFAGVKGNSLGQKVLTMYDEFQEVFKVFSDRSDDCLDLQNKEFERDIFEFEQRVQDMDRRLGAIFCQGFDDASNLEYAFKLLDMFGSLLERPLIAAEAFDKYPLLISMFDQELDSAKMIYNRHMQTAAEPGDYINQNMPPVAGNLKWTQQLRERLQNTY---SNFRHEKL--------------------------YEEWCRTVSEKSQYNLTRPLIVRDENTKLIFVNFDPQLVSVLREVKYLQELRMETIPTEAGDIFSSKESYRTFTANLELTANRYNKVMRTILEVEFPLIEGQLQNIDVRLKEAEETLNWKA----NGVWEYIQEVRDMVHDLERRVQKARDNVDEIQAIMKTWV-LPIFERKDGRKEALLSLDDRSDRLEKRYSLIRESGTKLHALLKENRELFSADPSSDVWKAYVDYIDDMVLDGFFNAIECSLKCLLDNTDAKAGLAPLFEVQMDLLIPDMVFRPGLEHGSSDGLYDIIEGLINDIYRISALVPRLAEHSTFSHYQADMEDMADLADMRNAIMESVQNVMTSCTDYRNTFDHYAYLYVDDRKEFMRQFLLYGHVLTAEEIEAHAEDGVP---ETPPSLQQFKEQIDSYEKIYEEIGRVEPVNIFDCWMRVDAQPFKSALLNVVKRWSLMFKQHLIDHVTNSLADLEEFIKVAERGLSKQLKEGDYNGLVEIMGHLMAVKERQANTDDLFEPLKQTIELLKVYDQELPDEVYKQLEELPEKWNNIKKMAITVKQQVAPLQANEVALLRRNCATFDVEQHKFREAFRKQAPFRFDSISPYQTLDAKNVEIKAMESTMSSIYESAALFEVNIPDYKQLKQCRKEVCLLKELWDMIFLVKSNMNDWQTTRWREINVENMDLECKKFAKDIRNLDKEMRAWDAFTGLDNQVKNILTSLRAVAELQNPAIRERHWSQLMQATGVRFTMDEDTTLADLLKLNLHNFEDEVRGIVDKAVKEMGMEKVLKELDTTWCSMNFNYEPHPRTSVPLIKSDEELIETLEDNQVQLQNLMTSKYIAFFLEEVSGWQKKLSTADSVISIWFEVQRTWSHLESIFIGSDDIRSQLPEDSSRFEGIDTDFKELANDANKTPNVIEATNKPGLYERLEGIQERLSLCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTNPQLVMRHLSKLFDNMAKMKFQEDSDGSQSKMGLGMYSKEDEYVPFNEPCDCSGQVETWLNRVLDTMRATVRHEMTEAVTAYEEKPREQWLFDYPAQVALTCTQIWWTTEVGISFARLEEGYENGMKDYFKKQVNQLNTLITMLIGQLSKGDRQKIMTICTIDVHARDVVSKMIAQKIDNAQAFVWLSQLRHRWDDQKKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLSQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKKRFNFLGEEINLIPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPDRPEDQVLMRALRDFNIPKIVTDDMPVFMGLIGDLFPALDVPRKRDLEFESFVKQAVLDLKLQAEDNFVLKVVQLEELLAVRHSVFIVGNAGTGKSQVLKSLNKTYQIMKRRPVWTDLNPKAVTNDELFGIINPSTREWKDGLFSSIMRELANITHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPPVTSWIDKREIQSERANLTILFDKYLPLCLDTLRTRFKKIIPVPEQSMVQMLCYLLECLLTKENTPPDCPKELYELYFVFAAVWAFGGAMFQDQLVDYRVEFSKWWVTEFKTIKFPSQGTVFDYYIDPESKKFEPWSKLIPKFEFDPEMPLQACLVHTNETIRVRYFMDKLLERRRPVMLVGNAGTGKSVLVGDKLSSLDSDEYMIKNVPFNYYTTSAMLQAVLEKPLEKKSGRNYGPPGTKKLIYFIDDMNMPEVDTYGTVQPHTLIRQHMDYGHWYDRGKLSMKEIMNVQYVSCMNPTAGSFTINPRLQRHFCVFALSFPGTDALSTIYNTILTQHLKMGNFSGPLQKSTQQLINLALSFHQKITSSFLPTAIKFHYIFNLRDLSNIFQGILFSTPECLKVPQDLVKLYLHESNRVYRDKMLEEKDFDTFDKMQTEMVKKFYDDMEEMLEQTKTMNMYCHFASGVGEPKYMPVQSWESLNKILVETLDNYNEVNAVMSLVLFEDAMCHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLDVFQITLRKGYGIPDLKVDLANQYIKAGVKNVGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLFPDDEVENIISSVRNEVKSQGLMDTRENCWKFFIDRVRRQLKVALCFSPVGNKLRVRSRKFPAVVNCTAIDWFHEWPQEALESVSLRFLQETENIESSVKPSISKFMAYVHTSVNEMSKSYLSNERRYNYTTPKSFLEQIKLYQNLLDKKGKELSAKMERLENGLQKLNSTSAQVDDLKAKL----------NDDADKLIQVVGVETENVSREKAIADEEEKKVAVIAEEVGG-----------------MVFTFNPTLTYTTNLTELKSFGAPPLAVTNVTAAVMVLTAPGGKVPKDRSWKAARV-VMGKVDGFLDSLITFKKESIHENCIKAIQPYLQDPEFNPEFIASKSLAAAGLCSWVINIVKFFEVYCEVEPKRQALNKANAELAAAEEKLSSIKAKIAHLNENLAKLTAKFEKATADKLKCQQEAEATALTISLANRLVGGLASENVRWAESVRNFKLQESTLCGDVLLITAFVSYLGYFTRKYRQDLMDRMWRPYLGELKVPIPVTPSLDPLTMLTDDADIAAWQNEGLPADRMSTENATILTNCERWPLMVDPQLQGIKWIKNKYGEGLRVIRIGQRGYLDTLERALAGGEVVLIENIEESLDPVLGPLLGRETIKKGRYIKIGDKECEYSPNFRLILHTKLANPHYQPEMQAQCTLINFTVTRYGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTALVENLEITKKTAAEIEEKVQEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQQAVQKAPTDEVLKQRVNNLIDSITFSVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINSTELDFLLRYPAQPGLTSPVDFLSNQSWGGIKALSTMDEFRNLDRDIEGSAKRWKKFVESECPEKEKFPQEWKNKSALQRLCMMRAIRPDRMTYAVRDFVEEKLGSKYVVGRSLDFATSYEESGPATPMFFILSPGVDPLKDVEKQGRKLGYTFDNCNFHNVSLGQGQEIVAEQALDLAAKEGHWVILQNIHLVAKWLGTLEKRLEQLSEGSHQNFRVFISAEPAGSPEGHIIPQGILENSIKITNEPPTGMHANLHKALDNFNQDTLEMCSKDSEFKSILFALCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLFNYLEANAKVPFDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIKSEMLEGALYLAPGFPIPRNMDYNGYHQYIDDTLPAESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDSSAGEGGGVTREEKVKSTLDEILEKLPDEFNIPELMAKV--EERTPYIVVAFQECERMNALTSEIKRSLRELDLGLKGELTMTSDMENLQNAIFLDQVPESWTKRAYPSMAGLAGWFVDLLSRIKELETWTGDFALPSAVWLAGFFNPQSFLTAIMQSMARKNEWPLDKMTLQCDVTKKNREDFSSPPREGAYVHGLFMEGARWDTPAGVIMDSRLKDLTPAMPVIFIKAVPVDKQETRNVYPCPVYKTRQRGPTYVWTFNLKTKENPSKW 4284          

HSP 2 Score: 259.996 bits (663), Expect = 6.062e-68
Identity = 135/277 (48.74%), Postives = 189/277 (68.23%), Query Frame = 1
Query:   82 NDKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKV----SEGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAA 900
            +DKR +F+ DYVLK+LK K D++ K   T+E +Q + +F +K + Q L V+     G L    EFP   K+KA FF K++   +S DA     LI+GD+SY+PLD FS+ V+EV++P+L+N KN ++WP V+S DV RH N LK +T V++GQ KGKTLLPLP GSEKV    +E + N+  E+ R++I+AIE+ +I+W+HQ+  VL K+SSE L+ G NP P  E+D+WK R  +LECI+ QL   +V+KMA LLE V S Y P FK +F+ VVA 
Sbjct:    8 SDKRLQFLEDYVLKTLKLKPDRWQKCVATEEYRQTLQEFLDKAD-QLLLVVTLNPAGLLVPVLEFPKGSKNKAVFFLKRSTSPLSADA-MKSSLIYGDLSYSPLDHFSAVVEEVVVPILANQKNHQNWPHVVSDDVTRHVNQLKSRTFVMVGQVKGKTLLPLPAGSEKVDYIDNENEKNN-DELDRTMIHAIESAIIQWSHQVHGVLKKKSSEPLLQGKNPNPNAEIDFWKNRYADLECIHNQLRMTRVRKMAELLERVQSCYFPAFKALFRDVVAG 281          
BLAST of DNAHb-1 vs. Ensembl Xenopus
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:NCBI gene;Acc:100494270])

HSP 1 Score: 5229.07 bits (13563), Expect = 0.000e+0
Identity = 2649/4462 (59.37%), Postives = 3378/4462 (75.71%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFG----EVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQ--IEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKS----IRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRF-KKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKE-YCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            D R +F+GD + + +K K+DK++K    +  ++++ DFFE  +   L     P G  L    E   N KSK  +  KK   +I  +  +   L+FG+++   ++Q S+ V+EV++P+LSN KN  SWP   S D+ +H   +K++  V+ G   GKT LP+P  +  ++E ++N        V R+ ++A E+++I+W++QI +VL + SS+ L+ GL+P P  EL +WK R  NL CIYEQL +P V+KMA++L+  +S Y P F +I   V  AL E+++I+L+L+ LRN ++ +E+ +F ++  ++ PL H +CLIWAH K Y +P R++VL QE  NL+I    +YL P+++FK E EE+LE V+ +LK+L  FK +F +HR  ++ Y+ D  +   W F S ++F + + F+ R+  ++ I    LEF KLEK+E  G KG+ L++ I ++ EEF++  K F E T D  D    +F Q+Y  FKA + D D R+A+ +S+AF D    ++ FKL+ I G  L+R ++   F   YF L++M D+E++  KL+YD HV   E    +H+NMP V G L++ +E+++RI+   +    + H      E + V +K+ E++ LL ++E   Y  W + VDE C FNL +PLL+RN D   +SVNFD KL AVLREV+YL+   Q +IP+ A  I  K + L KYI +LD +V WYN L++  L VE PLI+++L  IDEQL ++     W     D+  W YI +V+ +V +L  RV  SK+NI T++ IM  W +  LF RK+ + +TL+NLDD+ +  NK+Y+ I E   ++  L  EN ELLKA    + WK YV+ ID ++ +    TI +SL + ++   +     PLFE  M L   EI+F+PSL ++  D   +LV+ +++DIFK + +VKR+A     ++Y+ D+++  +L   R EI ER      K   Y++ +D YS LWTD+R+EFM QFL YG  ++++E+EAH +  +    E PPT+DQFK QID +E  +  +   +   + ++WFR+D + FK + L  IK+WS MFK+HL+  V +SL EL EFIK  N+ L K+  EGD+  LV +M  L  V++RQ ATDE+FEPLKQTI LL++Y Q++PD++++QLEELPEKWN+TKK+AV+VK  VAPLQ  EV  IR++C  FD+KQ  FRE+F    PF+F+    Y  LD+ +  +  +E+    L +SA LF+V VP++KQLK+  KE++LLK LWD I+ V SSI  W KT W+ INVEQMD + + FAK+    + SLDK  RSWDAY+G++  IKN++TSLRA+ +LQNPAIRDRHW QLM ATKV+F M E TTL DLL L LH  EDEVR+IV+KAVKEM  EK+L E+  TW+ MEF +E H RTG  L++  E L ETL+ +QV+LQ +M SKY+ +F ++V SWQK L+ AD VI IW EVQRTWSHLESIFIGS DIR QLP D++RF  +D DFK L+ E E+  NV+ AT +P LY+ LE +Q  L LCEKAL+EYLETKRLAFPRFYFVS+ADLLDILS G  P+ V +HL KLFD++A L+F    E  N   G  MY+K+ E V F+ NC   GQVE WL ++ E M  T+   ++ESV++ E+K RDQW+F++PAQVAL+SSQI W  +V ++F RLEEG+E ALKD+ KKQI QLNALI +L+GELS  DRQK+MT+CTIDVH RDVV KLI  K+ N+Q F WL QLRHRW +  K C++NICDAQF+Y++EYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALG+MVYVFNCSEQMDYKS+GNIYKGLAQ+G+WGCFDEFNRISVEVLSVVAVQVK IQDAI+NKR+RF FLGE I+L  ++GIFITMNPGYAGRTELPENLKALFRPCAMVVPD ELICEIMLVAEGF+ AR LARKFITLY LCKELLSKQDHYDWGLRA+KSVLVVAG+LKR D  RPEDQVLMRALRDFN+PKIVTDD P+FMGLI DLFPALDVPRKRD  FE+ V+Q+TL+L LQ EE+F+LKVVQL+EL AVRHSVFV+GNAGTGKS V +TL KTY N K+KP+  DLNPKAV+ DELFG I+P+TREWKDGL S +MR+ ANLT +GPKWIVLDGDIDPMWIESLNTVMDDNKV+TLASNERIPLTPTMRLLFEI HL+TATPATVSRAGILY+NPQDLGW P+V SWI TR  Q+E+ANLTILFDKYVP CL+  +  F K +TPI+E S VQ LC LL+ LL  +N P D  +E YELYFVF  IWAFG  + +DQL D+RVEF++WW  E K++K PAQGT+FDY++D++ ++F  W +R+  FEMD++  +QAV V T+ETT   YF DLLI+K +PVMLVG AG GKTV L D+L S+ D+Y++A VPFN+YTTS  LQRVLEKPLEKKAGRNYGP G+KKL+YFIDDMNMPEVDK+ TVQPHTLIRQHIDY HWY+R K++LKEIHN QY+ACMNPTAGSFTI+ RLQRHF VFA++FP  ++++ I+S ILS     + FS S+LK  ++++   +   +K+   FLPTAIKFHY+FN+R+++NIFQGILFA  +C+KQPSDL+ LW HE  RVY DK+++  D + ++R+ ++  ++ FE    ++  ++PL++CHFA G+    YMPV+  E L K L EAL SYNE++AAMNLVLFEDA+ H+ RI+RILE PRGYALL+GVGGSGKQSLS+LAA+I SL+VFQITL+ GY + DLK+DLA LY++ G KN+  VFLLTDAQ+ DE+FLVL+NDLLASGEI DLF ++E ++I+S +R+EV+  G+ DS+ENCW FF+ +VR  L++VLCFSPVG TLRVRARKFPA+VNCTSIDWFHEWP++AL SVS RF+Q++E +    KDS ++FM++VH +VN +SI YLQ E+RYNYTTPKSFLEQI LY N+L+KK  EL  +M  L NGLQKL +TA QV+DLK KLA+QE EL+Q+N  A  L+ K+   T+KVS EK  AD EE+KV+ I+ EVS KQ+DCE DL+KAEPAL AA  AL+TLNK NLTE+K+F  PP AV +V+AA M L+A  G+VPKDRSWKAAK   MGK+D FL  LI Y+K++I E  LK AKE Y  DP F+P+ +++KS AAAGLC+WVINI+ YYE++CDV+PKR AL  ANE+L+ ATEKL+ I+ K+  L++ L+KL   FEKA ++K RCQ+E + T  TIE+ANRLV GL  +N+RW + ++ +K +EKTL GDVL+T AF+SYVG F+K YR  LM+  W+PFL +   +IP+++ LDP+ ML DDA +A WNNEGLPSDRMS ENATIL NAERWPL+IDPQ QGIKWIK ++G  LKV+ LGQKGYL  IE A+++GD VLIEN+ E++DPVLD LLGRNTIK+GR IK+GDKECEYN  FRLIL TKLANPHYKPE+QAQTT+INFTVT DGLEDQLLA VV+ ER DLE LK  LTKQQN FKI LK LED LL RLSAAEG+FLGD  LVE LE+ K TA EIE KV +AK  E+ INE RE YR AAARAS+LYFI++DL+KINP+YQFSLKAF VVF KAI RAE SE++  RV  L + IT+S +LYTS+GLFEKDKL F +Q +FQILL  KEI+  ELD LLRFPI  +  SP+DFLS  SW  IK +S L+EFK LDRDIEGSAKRWKKFVESE PE E+ PQ+WKNKTSLQ+L ++RALRPDRMTYA+ +F++EKLG KYVE    +F++S+EE+ PATP+FFILSPGV+PLKDVE LGKKLGF+ D+  F NISLGQGQE VAE+AM+  A++GHWV+LQN+HLV+KWL  LEK L +Y+  SHE YR+FISAEP+ SPE HIIPQGILEN+IKITNEPPTGMLANLH +L+NF+Q+T+EMCA+E EFK ILF+LCYFHA V+ R KFGPQGWNR YPFN+GDL I VNVLYNYLEAN+KVPWEDLRYLFGEIMYGGHITDDWDRKLC+TYLEE++ P  L+GE  + PGF  PPN DY GYH YIDE LPAE+P LYGLH NAEI+FLT  SD LFKT+ EMQP+++     +G+S EE++K ILD+I+EKLP++FNM+E+  K    ER+PY++V FQECERMN+LT EIRRSLKEL+LGLKGELTI++DMEAL +SL+ D +P++W+K AYPS + L  W  DLLLR +EL+ WT D  LP+V+WL GLFNPQSFLTAIMQ MARKNEWPLD+M L  DVTKK KED G PPR+GAY+ GLFMEGARWD Q+ +IAEA+LK+L P MPVI+++AIPVD+++LRN Y CP+Y+TK RGPT+VWTFNLKTKE P+KW
Sbjct:   47 DVRVQFMGDRIQQMMKIKTDKWIKFVEDETNEKIIRDFFELGDHVTLVFSIGPNG-ILTASKEITMNTKSKTVYIRKKKPANIGMEN-YKTDLMFGELACASINQTSALVEEVLVPILSNKKNHLSWPQFTSLDMDQHVEYMKNKMHVIQGLISGKTHLPIPTVA-TITEQNLNVTSNKENHVQRAALHAFESILIKWSYQIVEVLERDSSQPLLQGLDPGPHAELKFWKERRDNLTCIYEQLQAPAVQKMASILQDTESAYYPTFTNIVCEVKKALIEAEDIDLHLSTLRNHIKLLEETDFPQIYILLPPLLHTICLIWAHSKCYNIPARVIVLLQEFCNLLIEQAKTYLSPEDLFKAEPEESLEHVQAALKVLQSFKHAFFTHRASLQTYYTDRTQFKAWDFRSEMVFAKFDRFLERLLKIEDIFVIMLEFQKLEKLEFGGKKGKALNEKIFNLNEEFQDNSKVFKESTLDPTDRNNKEFEQEYSDFKAKVLDCDTRIASLLSEAFNDSSGLESAFKLLAICGLFLERSVILDIFSPNYFTLLQMYDKELDRCKLLYDAHVKQLENYA-VHRNMPAVAGTLKFTREIKDRIQISWSNFRFIHH----LPEASSVYQKYMEMMTLLDQYEDSVYEKWTSKVDEECEFNLDRPLLVRNNDDGLLSVNFDPKLIAVLREVRYLQKQSQADIPKEALAIFDKREMLHKYIASLDQLVFWYNKLKRTVLEVEYPLIKDDLKNIDEQLRESEERYTWK----DDNCWDYIVKVKSVVQDLEKRVQTSKDNIITMQQIMKVWAEQWLFSRKDNRKETLINLDDKNEIVNKKYQTIQEDSVKIQSLAMENMELLKATPGLDSWKMYVEYIDTIVTDGLYNTILHSLTFFMENTDVRLKPAPLFEAQMILASTEIIFKPSLQKEDGDGLYDLVEEMLSDIFKMSGQVKRIAKHLETDNYQNDMDDMTDLAAIRQEIMERVTGVIIKVTDYRSTYDSYSYLWTDDRQEFMRQFLLYGHVLTSDEIEAHADDGVP---ETPPTIDQFKEQIDIFENLYVLMSSSDDTKVFERWFRVDIKPFKTSLLVIIKKWSWMFKEHLVRFVIDSLAELEEFIKEANAILLKKVPEGDYSALVAVMELLLAVRDRQMATDELFEPLKQTISLLESYGQKLPDQIYVQLEELPEKWNHTKKLAVSVKHDVAPLQISEVTLIRKRCTAFDMKQIHFRERFSLDAPFSFNAQNPYSLLDKANRALQAMEEEKLHLQQSADLFDVAVPDYKQLKKSSKEIKLLKELWDLIHTVRSSIVDWVKTPWRQINVEQMDMELRRFAKASSTDLLSLDKHTRSWDAYSGLDLSIKNLITSLRAITDLQNPAIRDRHWHQLMNATKVQFTMTEQTTLSDLLALQLHKVEDEVRNIVDKAVKEMGTEKILIEISQTWTSMEFSYEHHHRTGTPLIQTDELLFETLDNNQVQLQVIMQSKYVEYFIEQVTSWQKRLNLADSVIYIWMEVQRTWSHLESIFIGSADIRNQLPGDAKRFKGVDADFKDLMFETEKIRNVLDATNRPDLYKTLEDLQLRLSLCEKALSEYLETKRLAFPRFYFVSAADLLDILSKGTQPKQVTRHLAKLFDNIADLQFQDSGE--NEAQG--MYSKENEFVPFSVNCKCIGQVEHWLKKVEETMCETICCHITESVAAYEDKPRDQWLFDYPAQVALTSSQIWWTIDVGIAFERLEEGFETALKDYIKKQIAQLNALINMLLGELSAGDRQKIMTMCTIDVHARDVVAKLIAHKVTNAQDFAWLSQLRHRWDEKQKHCFVNICDAQFQYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGVMVYVFNCSEQMDYKSVGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRNKRERFLFLGENITLKHSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDIELICEIMLVAEGFIDARPLARKFITLYTLCKELLSKQDHYDWGLRAVKSVLVVAGSLKRGDSSRPEDQVLMRALRDFNLPKIVTDDVPIFMGLISDLFPALDVPRKRDFSFEQMVKQSTLELHLQPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKVLRTLNKTYLNRKQKPVWNDLNPKAVSTDELFGFIHPATREWKDGLLSSLMREQANLTHEGPKWIVLDGDIDPMWIESLNTVMDDNKVMTLASNERIPLTPTMRLLFEIHHLRTATPATVSRAGILYMNPQDLGWNPYVTSWIETRSNQTEKANLTILFDKYVPPCLDQFRTGFLKTVTPILENSMVQTLCSLLDCLLNTDNVPPDSARELYELYFVFACIWAFGGALQRDQLTDYRVEFSRWWTKEMKSVKFPAQGTIFDYFLDSKARRFISWAERVPSFEMDIDSTMQAVFVHTAETTCLGYFTDLLIQKSKPVMLVGNAGVGKTVFLSDRLASLPDHYMIAKVPFNYYTTSSALQRVLEKPLEKKAGRNYGPIGNKKLVYFIDDMNMPEVDKFGTVQPHTLIRQHIDYGHWYERQKMSLKEIHNCQYVACMNPTAGSFTINQRLQRHFTVFAVNFPSNDAVEVIFSKILSFHFKQHAFSPSVLKAGTSIIQATIWLSHKMVQNFLPTAIKFHYIFNIREITNIFQGILFATSECLKQPSDLIHLWFHESSRVYGDKMVESKDSDLFKRILQDTVQRYFE----VIFSQQPLIFCHFANGLDTQSYMPVKGWEVLRKTLAEALNSYNELSAAMNLVLFEDAMQHVCRISRILEMPRGYALLIGVGGSGKQSLSKLAAYIGSLEVFQITLKNGYSVQDLKVDLANLYIRTGAKNMPTVFLLTDAQVPDERFLVLINDLLASGEIPDLFTEEETDSIVSGIRSEVRGLGLNDSKENCWNFFLERVRHQLKVVLCFSPVGCTLRVRARKFPAIVNCTSIDWFHEWPQEALQSVSRRFIQDIEGIEPGVKDSISQFMAYVHTSVNDMSIKYLQYEKRYNYTTPKSFLEQITLYKNLLEKKRRELSQRMEHLMNGLQKLTTTASQVEDLKVKLASQEAELQQRNQDAEALITKIGRQTEKVSQEKATADAEEQKVASIQEEVSVKQKDCEEDLSKAEPALIAATAALDTLNKTNLTELKTFPNPPIAVTNVTAAVMVLLAPKGRVPKDRSWKAAKV-FMGKVDDFLQALIKYDKEHIHENCLKVAKEQYLNDPGFSPDLVRTKSFAAAGLCAWVINIVKYYEVYCDVEPKRKALGQANEDLKGATEKLTAIRKKLHDLDNNLKKLTHSFEKATAEKVRCQEEVNRTNTTIEMANRLVKGLEVKNIRWSESIKSFKAQEKTLCGDVLLTAAFVSYVGSFSKRYRQELMENIWIPFLTSQKVVIPVSEGLDPIAMLTDDATVAGWNNEGLPSDRMSTENATILINAERWPLMIDPQQQGIKWIKNKYGTVLKVINLGQKGYLQTIETALASGDTVLIENLAENVDPVLDPLLGRNTIKRGRYIKIGDKECEYNQHFRLILHTKLANPHYKPELQAQTTLINFTVTTDGLEDQLLADVVSIERPDLEELKSMLTKQQNDFKIELKRLEDELLIRLSAAEGSFLGDMELVEKLESTKVTAAEIEHKVVEAKENEIKINEAREHYRAAAARASLLYFIMSDLSKINPIYQFSLKAFNVVFHKAIGRAEQSEDVTERVAKLTECITYSAFLYTSQGLFEKDKLTFLSQTAFQILLKQKEIDSLELDVLLRFPIENSYKSPVDFLSVQSWSAIKMISLLDEFKGLDRDIEGSAKRWKKFVESENPENERLPQDWKNKTSLQKLILLRALRPDRMTYAIRNFIEEKLGSKYVEEARPDFAKSYEETSPATPVFFILSPGVNPLKDVEALGKKLGFTIDSGKFHNISLGQGQEKVAEEAMEKAAQQGHWVILQNVHLVAKWLGTLEKLLAQYSTGSHEDYRIFISAEPAPSPEEHIIPQGILENSIKITNEPPTGMLANLHAALDNFDQDTLEMCAREQEFKCILFSLCYFHACVAGRLKFGPQGWNRRYPFNSGDLTICVNVLYNYLEANNKVPWEDLRYLFGEIMYGGHITDDWDRKLCRTYLEEFMNP-ALEGEKPLAPGFAAPPNQDYSGYHEYIDEILPAENPVLYGLHLNAEIDFLTVTSDNLFKTILEMQPKNTLHGEGSGMSVEEKVKNILDEILEKLPEEFNMLELMHKTT--ERSPYILVCFQECERMNILTQEIRRSLKELNLGLKGELTISSDMEALQSSLFYDSVPDTWAKLAYPSSFSLGQWINDLLLRCRELDTWTQDLVLPAVVWLSGLFNPQSFLTAIMQSMARKNEWPLDKMCLTVDVTKKTKEDYGHPPREGAYICGLFMEGARWDIQTNVIAEARLKDLTPLMPVIYVRAIPVDKKELRNTYDCPLYRTKTRGPTYVWTFNLKTKEPPAKW 4481          
BLAST of DNAHb-1 vs. Ensembl Xenopus
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:NCBI gene;Acc:100494270])

HSP 1 Score: 5113.13 bits (13262), Expect = 0.000e+0
Identity = 2595/4347 (59.70%), Postives = 3295/4347 (75.80%), Query Frame = 1
Query:  421 VILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDIN--SFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPK---IHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQ--IEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRF-KKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKE-YCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            V++P+LSN KN  SWP   S D+ +H   +K++  V+ G   GKT LP+P  +  ++E ++N  S    P++ ++A E+++I+W++QI +VL + SS+ L+ GL+P P  EL +WK R  NL CIYEQL +P V+KMA++L+  +S Y P F +I   V  AL E+++I+L+L+ LRN ++ +E+ +F ++  ++ PL H +CLIWAH K Y +P R++VL QE  NL+I    +YL P+++FK E EE+LE V+ +LK+L  FK +F +HR  ++ Y+ D  +   W F S ++F + + F+ R+  ++ I    LEF KLEK+E  G KG+ L++ I ++ EEF++  K F E             + +   F        R +  T+            +F+L+ I G  L+R ++   F   YF L++M D+E++  KL+YD HV     + +   +H+NMP V G L++ +E+++RI+   +    + H + ++ E + V +K+ E++ LL ++E   Y  W + VDE C FNL +PLL+RN D   +SVNFD KL AVLREV+YL+   Q +IP+ A  I  K + L KYI +LD +V WYN L++  L VE PLI+++L  IDEQL ++     W     D+  W YI +V+ +V +L  RV  SK+NI T++ IM  W +  LF RK+ + +TL+NLDD+ +  NK+Y+ I E   ++  L  EN ELLKA    + WK YV+ ID ++ +    TI +SL + ++   +     PLFE  M L   EI+F+PSL ++  D   +LV+ ++      A    +  I S +++   D+++  +L   R EI ER      K   Y++ +D YS LWTD+R+EFM QFL YG  ++++E+EAH +  +    E PPT+DQFK QID +E  +  +   +   + ++WFR+D + FK + L  IK+WS MFK+HL+  V +SL EL EFIK  N+ L K+  EGD+  LV +M  L  V++RQ ATDE+FEPLKQTI LL++Y Q++PD++++QLEELPEKWN+TKK+AV+VK  VAPLQ  EV  IR++C  FD+KQ  FRE+F    PF+F+    Y  LD+ +  +  +E+    L +SA LF+V VP++KQLK+  KE++LLK LWD I+ V SSI  W KT W+ INVEQMD + + FAK + SLDK  RSWDAY+G++  IKN++TSLRA+ +LQNPAIRDRHW QLM ATKV+F M E TTL DLL L LH  EDEVR+IV+KAVKEM  EK+L E+  TW+ MEF +E H RTG  L++  E L ETL+ +QV+LQ +M SKY+ +F ++V SWQK L+ AD VI IW EVQRTWSHLESIFIGS DIR QLP D++RF  +D DFK L+ E E+  NV+ AT +P LY+ LE +Q  L LCEKAL+EYLETKRLAFPRFYFVS+ADLLDILS G  P+ V +HL KLFD++A L+F    E  N   G  MY+K+ E V F+ NC   GQVE WL ++ E M  T+   ++ESV++ E+K RDQW+F++PAQVAL+SSQI W  +V ++F RLEEG+E ALKD+ KKQI QLNALI +L+GELS  DRQK+MT+CTIDVH RDVV KLI  K+ N+Q F WL QLRHRW +  K C++NICDAQF+Y++EYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALG+MVYVFNCSEQMDYKS+GNIYKGLAQ+G+WGCFDEFNRISVEVLSVVAVQVK IQDAI+NKR+RF FLGE I+L  ++GIFITMNPGYAGRTELPENLKALFRPCAMVVPD ELICEIMLVAEGF+ AR LARKFITLY LCKELLSKQDHYDWGLRA+KSVLVVAG+LKR D  RPEDQVLMRALRDFN+PKIVTDD P+FMGLI DLFPALDVPRKRD  FE+ V+Q+TL+L LQ EE+F+LKVVQL+EL AVRHSVFV+GNAGTGKS V +TL KTY N K+KP+  DLNPKAV+ DELFG I+P+TREWKDGL S +MR+ ANLT +GPKWIVLDGDIDPMWIESLNTVMDDNKV+TLASNERIPLTPTMRLLFEI HL+TATPATVSRAGILY+NPQDLGW P+V SWI TR  Q+E+ANLTILFDKYVP CL+  +  F K +TPI+E S VQ LC LL+ LL  +N P D  +E YELYFVF  IWAFG  + +DQL D+RVEF++WW  E K++K PAQGT+FDY++D++ ++F  W +R+  FEMD++  +QAV V T+ETT   YF DLLI+K +PVMLVG AG GKTV L D+L S+ D+Y++A VPFN+YTTS  LQRVLEKPLEKKAGRNYGP G+KKL+YFIDDMNMPEVDK+ TVQPHTLIRQHIDY HWY+R K++LKEIHN QY+ACMNPTAGSFTI+ RLQRHF VFA++FP  ++++ I+S ILS     + FS S+LK  ++++   +   +K+   FLPTAIKFHY+FN+R+++NIFQGILFA  +C+KQPSDL+ LW HE  RVY DK+++  D + ++R+ ++        ++  V  ++PL++CHFA G+    YMPV+  E L K L EAL SYNE++AAMNLVLFEDA+ H+ RI+RILE PRGYALL+GVGGSGKQSLS+LAA+I SL+VFQITL+ GY + DLK+DLA LY++ G KN+  VFLLTDAQ+ DE+FLVL+NDLLASGEI DLF ++E ++I+S +R+EV+  G+ DS+ENCW FF+ +VR  L++VLCFSPVG TLRVRARKFPA+VNCTSIDWFHEWP++AL SVS RF+Q++E +    KDS ++FM++VH +VN +SI YLQ E+RYNYTTPKSFLEQI LY N+L+KK  EL  +M  L NGLQKL +TA QV+DLK KLA+QE EL+Q+N  A  L+ K+   T+KVS EK  AD EE+KV+ I+ EVS KQ+DCE DL+KAEPAL AA  AL+TLNK NLTE+K+F  PP AV +V+AA M L+A  G+VPKDRSWKAAK   MGK+D FL  LI Y+K++I E  LK AKE Y  DP F+P+ +++KS AAAGLC+WVINI+ YYE++CDV+PKR AL  ANE+L+ ATEKL+ I+ K+  L++ L+KL   FEKA ++K RCQ+E + T  TIE+ANRLV GL SEN+RW + ++ +K +EKTL GDVL+T AF+SYVG F+K YR  LM+  W+PFL +   +IP+++ LDP+ ML DDA +A WNNEGLPSDRMS ENATIL NAERWPL+IDPQ QGIKWIK ++G  LKV+ LGQKGYL  IE A+++GD VLIEN+ E++DPVLD LLGRNTIK+GR IK+GDKECEYN  FRLIL TKLANPHYKPE+QAQTT+INFTVT DGLEDQLLA VV+ ER DLE LK  LTKQQN FKI LK LED LL RLSAAEG+FLGD  LVE LE+ K TA EIE KV +AK  E+ INE RE YR AAARAS+LYFI++DL+KINP+YQFSLKAF VVF KAI RAE SE++  RV  L + IT+S +LYTS+GLFEKDKL F +Q +FQILL  KEI+  ELD LLRFPI  +  SP+DFLS  SW  IK +S L+EFK LDRDIEGSAKRWKKFVESE PE E+ PQ+WKNKTSLQ+L ++RALRPDRMTYA+ +F++EKLG KYVE    +F++S+EE+ PATP+FFILSPGV+PLKDVE LGKKLGF+ D+  F NISLGQGQE VAE+AM+  A++GHWV+LQN+HLV+KWL  LEK L +Y+  SHE YR+FISAEP+ SPE HIIPQGILEN+IKITNEPPTGMLANLH +L+NF+Q+T+EMCA+E EFK ILF+LCYFHA V+ R KFGPQGWNR YPFN+GDL I VNVLYNYLEAN+KVPWEDLRYLFGEIMYGGHITDDWDRKLC+TYLEE++ P +L+GE  + PGF  PPN DY GYH YIDE LPAE+P LYGLH NAEI+FLT  SD LFKT+ EMQP+++     +G+S EE++K ILD+I+EKLP++FNM+E+  K    ER+PY++V FQECERMN+LT EIRRSLKEL+LGLKGELTI++DMEAL +SL+ D +P++W+K AYPS + L  W  DLLLR +EL+ WT D  LP+V+WL GLFNPQSFLTAIMQ MARKNEWPLD+M L  DVTKK KED G PPR+GAY+ GLFMEGARWD Q+ +IAEA+LK+L P MPVI+++AIPVD+++LRN Y CP+Y+TK RGPT+VWTFNLKTKE P+KW
Sbjct:   12 VLVPILSNKKNHLSWPQFTSLDMDQHVEYMKNKMHVIQGLISGKTHLPIPTVA-TITEQNLNVTSNKYDPKAALHAFESILIKWSYQIVEVLERDSSQPLLQGLDPGPHAELKFWKERRDNLTCIYEQLQAPAVQKMASILQDTESAYYPTFTNIVCEVKKALIEAEDIDLHLSTLRNHIKLLEETDFPQIYILLPPLLHTICLIWAHSKCYNIPARVIVLLQEFCNLLIEQAKTYLSPEDLFKAEPEESLEHVQAALKVLQSFKHAFFTHRASLQTYYTDRTQFKAWDFRSEMVFAKFDRFLERLLKIEDIFVIMLEFQKLEKLEFGGKKGKALNEKIFNLNEEFQDNSKVFKE-------------ILNIPVF--------RHIVQTI-----------ILFQLLAICGLFLERSVILDIFSPNYFTLLQMYDKELDRCKLLYDAHVKQVCAILENYAVHRNMPAVAGTLKFTREIKDRIQISWSNFRFIHHLSMESPEASSVYQKYMEMMTLLDQYEDSVYEKWTSKVDEECEFNLDRPLLVRNNDDGLLSVNFDPKLIAVLREVRYLQKQSQADIPKEALAIFDKREMLHKYIASLDQLVFWYNKLKRTVLEVEYPLIKDDLKNIDEQLRESEERYTWK----DDNCWDYIVKVKSVVQDLEKRVQTSKDNIITMQQIMKVWAEQWLFSRKDNRKETLINLDDKNEIVNKKYQTIQEDSVKIQSLAMENMELLKATPGLDSWKMYVEYIDTIVTDGLYNTILHSLTFFMENTDVRLKPAPLFEAQMILASTEIIFKPSLQKEDGDGLYDLVEEMLRLWLPLAGTEPQNIICSVLQN---DMDDMTDLAAIRQEIMERVTGVIIKVTDYRSTYDSYSYLWTDDRQEFMRQFLLYGHVLTSDEIEAHADDGVP---ETPPTIDQFKEQIDIFENLYVLMSSSDDTKVFERWFRVDIKPFKTSLLVIIKKWSWMFKEHLVRFVIDSLAELEEFIKEANAILLKKVPEGDYSALVAVMELLLAVRDRQMATDELFEPLKQTISLLESYGQKLPDQIYVQLEELPEKWNHTKKLAVSVKHDVAPLQISEVTLIRKRCTAFDMKQIHFRERFSLDAPFSFNAQNPYSLLDKANRALQAMEEEKLHLQQSADLFDVAVPDYKQLKKSSKEIKLLKELWDLIHTVRSSIVDWVKTPWRQINVEQMDMELRRFAKDLLSLDKHTRSWDAYSGLDLSIKNLITSLRAITDLQNPAIRDRHWHQLMNATKVQFTMTEQTTLSDLLALQLHKVEDEVRNIVDKAVKEMGTEKILIEISQTWTSMEFSYEHHHRTGTPLIQTDELLFETLDNNQVQLQVIMQSKYVEYFIEQVTSWQKRLNLADSVIYIWMEVQRTWSHLESIFIGSADIRNQLPGDAKRFKGVDADFKDLMFETEKIRNVLDATNRPDLYKTLEDLQLRLSLCEKALSEYLETKRLAFPRFYFVSAADLLDILSKGTQPKQVTRHLAKLFDNIADLQFQDSGE--NEAQG--MYSKENEFVPFSVNCKCIGQVEHWLKKVEETMCETICCHITESVAAYEDKPRDQWLFDYPAQVALTSSQIWWTIDVGIAFERLEEGFETALKDYIKKQIAQLNALINMLLGELSAGDRQKIMTMCTIDVHARDVVAKLIAHKVTNAQDFAWLSQLRHRWDEKQKHCFVNICDAQFQYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGVMVYVFNCSEQMDYKSVGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRNKRERFLFLGENITLKHSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDIELICEIMLVAEGFIDARPLARKFITLYTLCKELLSKQDHYDWGLRAVKSVLVVAGSLKRGDSSRPEDQVLMRALRDFNLPKIVTDDVPIFMGLISDLFPALDVPRKRDFSFEQMVKQSTLELHLQPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKVLRTLNKTYLNRKQKPVWNDLNPKAVSTDELFGFIHPATREWKDGLLSSLMREQANLTHEGPKWIVLDGDIDPMWIESLNTVMDDNKVMTLASNERIPLTPTMRLLFEIHHLRTATPATVSRAGILYMNPQDLGWNPYVTSWIETRSNQTEKANLTILFDKYVPPCLDQFRTGFLKTVTPILENSMVQTLCSLLDCLLNTDNVPPDSARELYELYFVFACIWAFGGALQRDQLTDYRVEFSRWWTKEMKSVKFPAQGTIFDYFLDSKARRFISWAERVPSFEMDIDSTMQAVFVHTAETTCLGYFTDLLIQKSKPVMLVGNAGVGKTVFLSDRLASLPDHYMIAKVPFNYYTTSSALQRVLEKPLEKKAGRNYGPIGNKKLVYFIDDMNMPEVDKFGTVQPHTLIRQHIDYGHWYERQKMSLKEIHNCQYVACMNPTAGSFTINQRLQRHFTVFAVNFPSNDAVEVIFSKILSFHFKQHAFSPSVLKAGTSIIQATIWLSHKMVQNFLPTAIKFHYIFNIREITNIFQGILFATSECLKQPSDLIHLWFHESSRVYGDKMVESKDSDLFKRILQDTG------VEHQVFSQQPLIFCHFANGLDTQSYMPVKGWEVLRKTLAEALNSYNELSAAMNLVLFEDAMQHVCRISRILEMPRGYALLIGVGGSGKQSLSKLAAYIGSLEVFQITLKNGYSVQDLKVDLANLYIRTGAKNMPTVFLLTDAQVPDERFLVLINDLLASGEIPDLFTEEETDSIVSGIRSEVRGLGLNDSKENCWNFFLERVRHQLKVVLCFSPVGCTLRVRARKFPAIVNCTSIDWFHEWPQEALQSVSRRFIQDIEGIEPGVKDSISQFMAYVHTSVNDMSIKYLQYEKRYNYTTPKSFLEQITLYKNLLEKKRRELSQRMEHLMNGLQKLTTTASQVEDLKVKLASQEAELQQRNQDAEALITKIGRQTEKVSQEKATADAEEQKVASIQEEVSVKQKDCEEDLSKAEPALIAATAALDTLNKTNLTELKTFPNPPIAVTNVTAAVMVLLAPKGRVPKDRSWKAAKV-FMGKVDDFLQALIKYDKEHIHENCLKVAKEQYLNDPGFSPDLVRTKSFAAAGLCAWVINIVKYYEVYCDVEPKRKALGQANEDLKGATEKLTAIRKKLHDLDNNLKKLTHSFEKATAEKVRCQEEVNRTNTTIEMANRLVKGLESENIRWSESIKSFKAQEKTLCGDVLLTAAFVSYVGSFSKRYRQELMENIWIPFLTSQKVVIPVSEGLDPIAMLTDDATVAGWNNEGLPSDRMSTENATILINAERWPLMIDPQQQGIKWIKNKYGTVLKVINLGQKGYLQTIETALASGDTVLIENLAENVDPVLDPLLGRNTIKRGRYIKIGDKECEYNQHFRLILHTKLANPHYKPELQAQTTLINFTVTTDGLEDQLLADVVSIERPDLEELKSMLTKQQNDFKIELKRLEDELLIRLSAAEGSFLGDMELVEKLESTKVTAAEIEHKVVEAKENEIKINEAREHYRAAAARASLLYFIMSDLSKINPIYQFSLKAFNVVFHKAIGRAEQSEDVTERVAKLTECITYSAFLYTSQGLFEKDKLTFLSQTAFQILLKQKEIDSLELDVLLRFPIENSYKSPVDFLSVQSWSAIKMISLLDEFKGLDRDIEGSAKRWKKFVESENPENERLPQDWKNKTSLQKLILLRALRPDRMTYAIRNFIEEKLGSKYVEEARPDFAKSYEETSPATPVFFILSPGVNPLKDVEALGKKLGFTIDSGKFHNISLGQGQEKVAEEAMEKAAQQGHWVILQNVHLVAKWLGTLEKLLAQYSTGSHEDYRIFISAEPAPSPEEHIIPQGILENSIKITNEPPTGMLANLHAALDNFDQDTLEMCAREQEFKCILFSLCYFHACVAGRLKFGPQGWNRRYPFNSGDLTICVNVLYNYLEANNKVPWEDLRYLFGEIMYGGHITDDWDRKLCRTYLEEFMNPAVLEGEKPLAPGFAAPPNQDYSGYHEYIDEILPAENPVLYGLHLNAEIDFLTVTSDNLFKTILEMQPKNTLHGEGSGMSVEEKVKNILDEILEKLPEEFNMLELMHKT--TERSPYILVCFQECERMNILTQEIRRSLKELNLGLKGELTISSDMEALQSSLFYDSVPDTWAKLAYPSSFSLGQWINDLLLRCRELDTWTQDLVLPAVVWLSGLFNPQSFLTAIMQSMARKNEWPLDKMCLTVDVTKKTKEDYGHPPREGAYICGLFMEGARWDIQTNVIAEARLKDLTPLMPVIYVRAIPVDKKELRNTYDCPLYRTKTRGPTYVWTFNLKTKEPPAKW 4302          
BLAST of DNAHb-1 vs. Ensembl Xenopus
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:NCBI gene;Acc:100494270])

HSP 1 Score: 5105.42 bits (13242), Expect = 0.000e+0
Identity = 2594/4329 (59.92%), Postives = 3279/4329 (75.74%), Query Frame = 1
Query:  466 PSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDIN--SFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQ--IEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRF-KKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKE-YCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            P   S D+ +H   +K++  V+ G   GKT LP+P  +  ++E ++N  S    P++ ++A E+++I+W++QI +VL + SS+ L+ GL+P P  EL +WK R  NL CIYEQL +P V+KMA++L+  +S Y P F +I   V  AL E+++I+L+L+ LRN ++ +E+ +F ++  ++ PL H +CLIWAH K Y +P R++VL QE  NL+I    +YL P+++FK E EE+LE V+ +LK+L  FK +F +HR  ++ Y+ D  +   W F S ++F + + F+ R+  ++ I    LEF KLEK+E  G KG+ L++ I ++ EEF++  K F E T D  DP     LQ    F  S+                       +F+L+ I G  L+R ++   F   YF L++M D+E++  KL+YD HV    K              + W      R  H         H + ++ E + V +K+ E++ LL ++E   Y  W + VDE C FNL +PLL+RN D   +SVNFD KL AVLREV+YL+   Q +IP+ A  I  K + L KYI +LD +V WYN L++  L VE PLI+++L  IDEQL ++     W     D+  W YI +V+ +V +L  RV  SK+NI T++ IM  W +  LF RK+ + +TL+NLDD+ +  NK+Y+ I E   ++  L  EN ELLKA    + WK YV+ ID ++ +    TI +SL + ++   +     PLFE  M L   EI+F+PSL ++  D   +LV+ +++DIFK + +VKR+A  S +++   D+++  +L   R EI ER      K   Y++ +D YS LWTD+R+EFM QFL YG  ++++E+EAH +  +    E PPT+DQFK QID +E  +  +   +   + ++WFR+D + FK + L  IK+WS MFK+HL+  V +SL EL EFIK  N+ L K+  EGD+  LV +M  L  V++RQ ATDE+FEPLKQTI LL++Y Q++PD++++QLEELPEKWN+TKK+AV+VK  VAPLQ  EV  IR++C  FD+KQ  FRE+F    PF+F+    Y  LD+ +  +  +E+    L +SA LF+V VP++KQLK+  KE++LLK LWD I+ V SSI  W KT W+ INVEQMD + + FAK + SLDK  RSWDAY+G++  IKN++TSLRA+ +LQNPAIRDRHW QLM ATKV+F M E TTL DLL L LH  EDEVR+IV+KAVKEM  EK+L E+  TW+ MEF +E H RTG  L++  E L ETL+ +QV+LQ +M SKY+ +F ++V SWQK L+ AD VI IW EVQRTWSHLESIFIGS DIR QLP D++RF  +D DFK L+ E E+  NV+ AT +P LY+ LE +Q  L LCEKAL+EYLETKRLAFPRFYFVS+ADLLDILS G  P+ V +HL KLFD++A L+F    E  N   G  MY+K+ E V F+ NC   GQVE WL ++ E M  T+   ++ESV++ E+K RDQW+F++PAQVAL+SSQI W  +V ++F RLEEG+E ALKD+ KKQI QLNALI +L+GELS  DRQK+MT+CTIDVH RDVV KLI  K+ N+Q F WL QLRHRW +  K C++NICDAQF+Y++EYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALG+MVYVFNCSEQMDYKS+GNIYKGLAQ+G+WGCFDEFNRISVEVLSVVAVQVK IQDAI+NKR+RF FLGE I+L  ++GIFITMNPGYAGRTELPENLKALFRPCAMVVPD ELICEIMLVAEGF+ AR LARKFITLY LCKELLSKQDHYDWGLRA+KSVLVVAG+LKR D  RPEDQVLMRALRDFN+PKIVTDD P+FMGLI DLFPALDVPRKRD  FE+ V+Q+TL+L LQ EE+F+LKVVQL+EL AVRHSVFV+GNAGTGKS V +TL KTY N K+KP+  DLNPKAV+ DELFG I+P+TREWKDGL S +MR+ ANLT +GPKWIVLDGDIDPMWIESLNTVMDDNKV+TLASNERIPLTPTMRLLFEI HL+TATPATVSRAGILY+NPQDLGW P+V SWI TR  Q+E+ANLTILFDKYVP CL+  +  F K +TPI+E S VQ LC LL+ LL  +N P D  +E YELYFVF  IWAFG  + +DQL D+RVEF++WW  E K++K PAQGT+FDY++D++ ++F  W +R+  FEMD++  +QAV V T+ETT   YF DLLI+K +PVMLVG AG GKTV L D+L S+ D+Y++A VPFN+YTTS  LQRVLEKPLEKKAGRNYGP G+KKL+YFIDDMNMPEVDK+ TVQPHTLIRQHIDY HWY+R K++LKEIHN QY+ACMNPTAGSFTI+ RLQRHF VFA++FP  ++++ I+S ILS     + FS S+LK  ++++   +   +K+   FLPTAIKFHY+FN+R+++NIFQGILFA  +C+KQPSDL+ LW HE  RVY DK+++  D + ++R+ ++  ++ FE ++  V  ++PL++CHFA G+    YMPV+  E L K L EAL SYNE++AAMNLVLFEDA+ H+ RI+RILE PRGYALL+GVGGSGKQSLS+LAA+I SL+VFQITL+ GY + DLK+DLA LY++ G KN+  VFLLTDAQ+ DE+FLVL+NDLLASGEI DLF ++E ++I+S +R+EV+  G+ DS+ENCW FF+ +VR  L++VLCFSPVG TLRVRARKFPA+VNCTSIDWFHEWP++AL SVS RF+Q++E +    KDS ++FM++VH +VN +SI YLQ E+RYNYTTPKSFLEQI LY N+L+KK  EL  +M  L NGLQKL +TA QV+DLK KLA+QE EL+Q+N  A  L+ K+   T+KVS EK  AD EE+KVS I  EVS KQ+DCE DL+KAEPAL AA  AL+TLNK NLTE+K+F  PP AV +V+AA M L+A  G+VPKDRSWKAAK   MGK+D FL  LI Y+K++I E  LK AKE Y  DP F+P+ +++KS AAAGLC+WVINI+ YYE++CDV+PKR AL  ANE+L+ ATEKL+ I+ K+  L++ L+KL   FEKA ++K RCQ+E + T  TIE+ANRLV GL SEN+RW + ++ +K +EKTL GDVL+T AF+SYVG F+K YR  LM+  W+PFL +   +IP+++ LDP+ ML DDA +A WNNEGLPSDRMS ENATIL NAERWPL+IDPQ QGIKWIK ++G  LKV+ LGQKGYL  IE A+++GD VLIEN+ E++DPVLD LLGRNTIK+GR IK+GDKECEYN  FRLIL TKLANPHYKPE+QAQTT+INFTVT DGLEDQLLA VV+ ER DLE LK  LTKQQN FKI LK LED LL RLSAAEG+FLGD  LVE LE+ K TA EIE KV +AK  E+ INE RE YR AAARAS+LYFI++DL+KINP+YQFSLKAF VVF KAI RAE SE++  RV  L + IT+S +LYTS+GLFEKDKL F +Q +FQILL  KEI+  ELD LLRFPI  +  SP+DFLS  SW  IK +S L+EFK LDRDIEGSAKRWKKFVESE PE E+ PQ+WKNKTSLQ+L ++RALRPDRMTYA+ +F++EKLG KYVE    +F++S+EE+ PATP+FFILSPGV+PLKDVE LGKKLGF+ D+  F NISLGQGQE VAE+AM+  A++GHWV+LQN+HLV+KWL  LEK L +Y+  SHE YR+FISAEP+ SPE HIIPQGILEN+IKITNEPPTGMLANLH +L+NF+Q+T+EMCA+E EFK ILF+LCYFHA V+ R KFGPQGWNR YPFN+GDL I VNVLYNYLEAN+KVPWEDLRYLFGEIMYGGHITDDWDRKLC+TYLEE++ P +L+GE  + PGF  PPN DY GYH YIDE LPAE+P LYGLH NAEI+FLT  SD LFKT+ EMQP+++     +G+S EE++K ILD+I+EKLP++FNM+E+  K    ER+PY++V FQECERMN+LT EIRRSLKEL+LGLKGELTI++DMEAL +SL+ D +P++W+K AYPS + L  W  DLLLR +EL+ WT D  LP+V+WL GLFNPQSFLTAIMQ MARKNEWPLD+M L  DVTKK KED G PPR+GAY+ GLFMEGARWD Q+ +IAEA+LK+L P MPVI+++AIPVD+++LRN Y CP+Y+TK RGPT+VWTFNLKTKE P+KW
Sbjct:    1 PQFTSLDMDQHVEYMKNKMHVIQGLISGKTHLPIPTVA-TITEQNLNVTSNKYDPKAALHAFESILIKWSYQIVEVLERDSSQPLLQGLDPGPHAELKFWKERRDNLTCIYEQLQAPAVQKMASILQDTESAYYPTFTNIVCEVKKALIEAEDIDLHLSTLRNHIKLLEETDFPQIYILLPPLLHTICLIWAHSKCYNIPARVIVLLQEFCNLLIEQAKTYLSPEDLFKAEPEESLEHVQAALKVLQSFKHAFFTHRASLQTYYTDRTQFKAWDFRSEMVFAKFDRFLERLLKIEDIFVIMLEFQKLEKLEFGGKKGKALNEKIFNLNEEFQDNSKVFKESTLDPTDPSYFVALQ----FSYSV----------------------ILFQLLAICGLFLERSVILDIFSPNYFTLLQMYDKELDRCKLLYDAHVKQTLKT-------------ISWSNF---RFIH---------HLSMESPEASSVYQKYMEMMTLLDQYEDSVYEKWTSKVDEECEFNLDRPLLVRNNDDGLLSVNFDPKLIAVLREVRYLQKQSQADIPKEALAIFDKREMLHKYIASLDQLVFWYNKLKRTVLEVEYPLIKDDLKNIDEQLRESEERYTWK----DDNCWDYIVKVKSVVQDLEKRVQTSKDNIITMQQIMKVWAEQWLFSRKDNRKETLINLDDKNEIVNKKYQTIQEDSVKIQSLAMENMELLKATPGLDSWKMYVEYIDTIVTDGLYNTILHSLTFFMENTDVRLKPAPLFEAQMILASTEIIFKPSLQKEDGDGLYDLVEEMLSDIFKMSGQVKRIANCSVLQN---DMDDMTDLAAIRQEIMERVTGVIIKVTDYRSTYDSYSYLWTDDRQEFMRQFLLYGHVLTSDEIEAHADDGVP---ETPPTIDQFKEQIDIFENLYVLMSSSDDTKVFERWFRVDIKPFKTSLLVIIKKWSWMFKEHLVRFVIDSLAELEEFIKEANAILLKKVPEGDYSALVAVMELLLAVRDRQMATDELFEPLKQTISLLESYGQKLPDQIYVQLEELPEKWNHTKKLAVSVKHDVAPLQISEVTLIRKRCTAFDMKQIHFRERFSLDAPFSFNAQNPYSLLDKANRALQAMEEEKLHLQQSADLFDVAVPDYKQLKKSSKEIKLLKELWDLIHTVRSSIVDWVKTPWRQINVEQMDMELRRFAKDLLSLDKHTRSWDAYSGLDLSIKNLITSLRAITDLQNPAIRDRHWHQLMNATKVQFTMTEQTTLSDLLALQLHKVEDEVRNIVDKAVKEMGTEKILIEISQTWTSMEFSYEHHHRTGTPLIQTDELLFETLDNNQVQLQVIMQSKYVEYFIEQVTSWQKRLNLADSVIYIWMEVQRTWSHLESIFIGSADIRNQLPGDAKRFKGVDADFKDLMFETEKIRNVLDATNRPDLYKTLEDLQLRLSLCEKALSEYLETKRLAFPRFYFVSAADLLDILSKGTQPKQVTRHLAKLFDNIADLQFQDSGE--NEAQG--MYSKENEFVPFSVNCKCIGQVEHWLKKVEETMCETICCHITESVAAYEDKPRDQWLFDYPAQVALTSSQIWWTIDVGIAFERLEEGFETALKDYIKKQIAQLNALINMLLGELSAGDRQKIMTMCTIDVHARDVVAKLIAHKVTNAQDFAWLSQLRHRWDEKQKHCFVNICDAQFQYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGVMVYVFNCSEQMDYKSVGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRNKRERFLFLGENITLKHSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDIELICEIMLVAEGFIDARPLARKFITLYTLCKELLSKQDHYDWGLRAVKSVLVVAGSLKRGDSSRPEDQVLMRALRDFNLPKIVTDDVPIFMGLISDLFPALDVPRKRDFSFEQMVKQSTLELHLQPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKVLRTLNKTYLNRKQKPVWNDLNPKAVSTDELFGFIHPATREWKDGLLSSLMREQANLTHEGPKWIVLDGDIDPMWIESLNTVMDDNKVMTLASNERIPLTPTMRLLFEIHHLRTATPATVSRAGILYMNPQDLGWNPYVTSWIETRSNQTEKANLTILFDKYVPPCLDQFRTGFLKTVTPILENSMVQTLCSLLDCLLNTDNVPPDSARELYELYFVFACIWAFGGALQRDQLTDYRVEFSRWWTKEMKSVKFPAQGTIFDYFLDSKARRFISWAERVPSFEMDIDSTMQAVFVHTAETTCLGYFTDLLIQKSKPVMLVGNAGVGKTVFLSDRLASLPDHYMIAKVPFNYYTTSSALQRVLEKPLEKKAGRNYGPIGNKKLVYFIDDMNMPEVDKFGTVQPHTLIRQHIDYGHWYERQKMSLKEIHNCQYVACMNPTAGSFTINQRLQRHFTVFAVNFPSNDAVEVIFSKILSFHFKQHAFSPSVLKAGTSIIQATIWLSHKMVQNFLPTAIKFHYIFNIREITNIFQGILFATSECLKQPSDLIHLWFHESSRVYGDKMVESKDSDLFKRILQDTVQRYFEGVEHQVFSQQPLIFCHFANGLDTQSYMPVKGWEVLRKTLAEALNSYNELSAAMNLVLFEDAMQHVCRISRILEMPRGYALLIGVGGSGKQSLSKLAAYIGSLEVFQITLKNGYSVQDLKVDLANLYIRTGAKNMPTVFLLTDAQVPDERFLVLINDLLASGEIPDLFTEEETDSIVSGIRSEVRGLGLNDSKENCWNFFLERVRHQLKVVLCFSPVGCTLRVRARKFPAIVNCTSIDWFHEWPQEALQSVSRRFIQDIEGIEPGVKDSISQFMAYVHTSVNDMSIKYLQYEKRYNYTTPKSFLEQITLYKNLLEKKRRELSQRMEHLMNGLQKLTTTASQVEDLKVKLASQEAELQQRNQDAEALITKIGRQTEKVSQEKATADAEEQKVSLICEEVSVKQKDCEEDLSKAEPALIAATAALDTLNKTNLTELKTFPNPPIAVTNVTAAVMVLLAPKGRVPKDRSWKAAKV-FMGKVDDFLQALIKYDKEHIHENCLKVAKEQYLNDPGFSPDLVRTKSFAAAGLCAWVINIVKYYEVYCDVEPKRKALGQANEDLKGATEKLTAIRKKLHDLDNNLKKLTHSFEKATAEKVRCQEEVNRTNTTIEMANRLVKGLESENIRWSESIKSFKAQEKTLCGDVLLTAAFVSYVGSFSKRYRQELMENIWIPFLTSQKVVIPVSEGLDPIAMLTDDATVAGWNNEGLPSDRMSTENATILINAERWPLMIDPQQQGIKWIKNKYGTVLKVINLGQKGYLQTIETALASGDTVLIENLAENVDPVLDPLLGRNTIKRGRYIKIGDKECEYNQHFRLILHTKLANPHYKPELQAQTTLINFTVTTDGLEDQLLADVVSIERPDLEELKSMLTKQQNDFKIELKRLEDELLIRLSAAEGSFLGDMELVEKLESTKVTAAEIEHKVVEAKENEIKINEAREHYRAAAARASLLYFIMSDLSKINPIYQFSLKAFNVVFHKAIGRAEQSEDVTERVAKLTECITYSAFLYTSQGLFEKDKLTFLSQTAFQILLKQKEIDSLELDVLLRFPIENSYKSPVDFLSVQSWSAIKMISLLDEFKGLDRDIEGSAKRWKKFVESENPENERLPQDWKNKTSLQKLILLRALRPDRMTYAIRNFIEEKLGSKYVEEARPDFAKSYEETSPATPVFFILSPGVNPLKDVEALGKKLGFTIDSGKFHNISLGQGQEKVAEEAMEKAAQQGHWVILQNVHLVAKWLGTLEKLLAQYSTGSHEDYRIFISAEPAPSPEEHIIPQGILENSIKITNEPPTGMLANLHAALDNFDQDTLEMCAREQEFKCILFSLCYFHACVAGRLKFGPQGWNRRYPFNSGDLTICVNVLYNYLEANNKVPWEDLRYLFGEIMYGGHITDDWDRKLCRTYLEEFMNPAVLEGEKPLAPGFAAPPNQDYSGYHEYIDEILPAENPVLYGLHLNAEIDFLTVTSDNLFKTILEMQPKNTLHGEGSGMSVEEKVKNILDEILEKLPEEFNMLELMHKT--TERSPYILVCFQECERMNILTQEIRRSLKELNLGLKGELTISSDMEALQSSLFYDSVPDTWAKLAYPSSFSLGQWINDLLLRCRELDTWTQDLVLPAVVWLSGLFNPQSFLTAIMQSMARKNEWPLDKMCLTVDVTKKTKEDYGHPPREGAYICGLFMEGARWDIQTNVIAEARLKDLTPLMPVIYVRAIPVDKKELRNTYDCPLYRTKTRGPTYVWTFNLKTKEPPAKW 4260          
BLAST of DNAHb-1 vs. Ensembl Xenopus
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:NCBI gene;Acc:100494270])

HSP 1 Score: 5056.5 bits (13115), Expect = 0.000e+0
Identity = 2593/4457 (58.18%), Postives = 3309/4457 (74.24%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDIN-SFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLA-SHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQ--IEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKA-LXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRF-KKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKE-YCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            D R +F+GD + + +K K+DK++K    +  ++++ DFFE  +   L     P G  L    E     K K  +  KK   +I  +  +   L+FG+++   ++Q S+ V+EV++P+LSN KN  SWP   S D+ +H   +K++  V+ G   GKT LP+P  +  ++E ++N +   V R+ ++A E+++I+W++QI +VL + SS+ L+ GL+P P  EL +WK R  NL CIYEQL +P V+KMA++L+  +S Y P F +I   V  AL E+++I+L+L+ LRN ++ +E+ +F ++  ++ PL H +CLIWAH K Y +P R++VL QE  NL+I    +YL P+++FK E EE+LE V+ +LK+L  FK +F +HR  ++ Y+ D  +   W F S ++F + + F+ R+  ++ I    LEF KLEK+E  G KG+ L++ I ++ EEF++  K F E T D  D    +F Q+Y  FKA + D D R+A+ +S+AF D    ++ FK+   +G +L   ++   F   YF L++M D+E++  KL+YD HV    K              + W       I H L    S+   ++ ++ E + V +K+ E++ LL ++E   Y  W + VDE C FNL +PLL+RN D   +SVNFD KL AVLREV+YL+   Q +IP+ A  I  K + L KYI +LD +V WYN L++  L VE PLI+++L  IDEQL ++     W     D+  W YI +V+ +V +L  RV  SK+NI T++ IM  W +  LF RK+ + +TL+NLDD+ +  NK+Y+ I E   ++  L  EN ELLKA    + WK YV+ ID ++ +    TI +SL + ++   +     PLFE  M L   EI+F+PSL ++  D   +LV+ +++DIFK + +VKR+A     ++Y+ D+++  +L   R EI ER      K   Y++ +D YS LWTD+R+EFM QFL YG  ++++E+EAH +  +    E PPT+DQFK QID +E  +  +   +   + ++WFR+D + FK + L  IK+WS MFK+HL+  V +SL EL EFIK  N+ L K+  EGD+  LV +M  L  V++RQ ATDE+FEPLKQTI LL++Y Q++PD++++QLEELPEKWN+TKK+AV+VK  VAPLQ  EV  IR++C  FDV                  C   +  L +    I  L   +  L +SA LF+V VP++KQLK+  KE++LLK LWD I+ V                            + + SLDK  RSWDAY+G++  IKN++TSLRA+ +LQNPAIRDRHW QLM ATKV+F M E TTL DLL L LH  EDEVR+IV+KAVKEM  EK+L E+  TW+ MEF +E H RTG  L++  E L ETL+ +QV+LQ +M SKY+ +F ++V SWQK L+ AD VI IW EVQRTWSHLESIFIGS DIR QLP D++RF  +D DFK  +   + +  NV+ AT +P LY+ LE +Q  L LCEKAL+EYLETKRLAFPRFYFVS+ADLLDILS G  P+ V +HL KLFD++A L+F    E  N   G  MY+K+ E V F+ NC   GQVE WL ++ E M  T+   ++ESV++ E+K RDQW+F++PAQVAL+SSQI W  +V ++F RLEEG+E ALKD+ KKQI QLNALI +L+GELS  DRQK+MT+CTIDVH RDVV KLI  K+ N+Q F WL QLRHRW +  K C++NICDAQF+Y++EYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALG+MVYVFNCSEQMDYKS+GNIYKGLAQ+G+WGCFDEFNRISVEVLSVVAVQVK IQDAI+NKR+RF FLGE I+L  ++GIFITMNPGYAGRTELPENLKALFRPCAMVVPD ELICEIMLVAEGF+ AR LARKFITLY LCKELLSKQDHYDWGLRA+KSVLVVAG+LKR D  RPEDQVLMRALRDFN+PKIVTDD P+FMGLI DLFPALDVPRKRD  FE+ V+Q+TL+L LQ EE+F+LKVVQL+EL AVRHSVFV+GNAGTGKS V +TL KTY N K+KP+  DLNPKAV+ DELFG I+P+TREWKDGL S +MR+ ANLT +GPKWIVLDGDIDPMWIESLNTVMDDNKV+TLASNERIPLTPTMRLLFEI HL+TATPATVSRAGILY+NPQDLGW P+V SWI TR  Q+E+ANLTILFDKYVP CL+  +  F K +TPI+E S VQ LC LL+ LL  +N P D  +E YELYFVF  IWAFG  + +DQL D+RVEF++WW  E K++K PAQGT+FDY++D++ ++F  W +R+  FEMD++  +QAV V T+ETT   YF DLLI+K +PVMLVG AG GKTV L D+L S+ D+Y++A VPFN+YTTS  LQRVLEKPLEKKAGRNYGP G+KKL+YFIDDMNMPEVDK+ TVQPHTLIRQHIDY HWY+R K++LKEIHN QY+ACMNPTAGSFTI+ RLQRHF VFA++FP  ++++ I+S ILS     + FS S+LK  ++++   +   +K+   FLPTAIKFHY+FN+R+++NIFQGILFA  +C+KQPSDL+ LW HE  RVY DK+++  D + ++R+ ++  ++ FE ++  V  ++PL++CHFA G+    YMPV+  E L K L EAL SYNE++AAMNLVLFEDA+ H+ RI+RILE PRGYALL+GVGGSGKQSLS+LAA+I SL+VFQITL+ GY + DLK+DLA LY++ G KN+  VFLLTDAQ+ DE+FLVL+NDLLASGEI DLF ++E ++I+S +R+EV+  G+ DS+ENCW FF+ +VR  L++VLCFSPVG TLRVRARKFPA+VNCTSIDWFHEWP++AL SVS RF+Q++E +    KDS ++FM++VH +VN +SI YLQ E+RYNYTTPKSFLEQI LY N+L+KK  EL  +M  L NGLQKL +TA QV+DLK KLA+QE EL+Q+N  A  L+ K+   T+KVS EK  AD EE+KV+ I+ EVS KQ+DCE DL+KAEPAL AA  AL+TLNK NLTE+K+F  PP AV +V+AA M L+A  G+VPKDRSWKAAK   MGK+D FL  LI Y+K++I E  LK AKE Y  DP F+P+ +++KS AAAGLC+WVINI+ YYE++CDV+PKR AL  ANE+L+ ATEKL+ I+ K+  L++ L+KL   FEKA ++K RCQ+E + T  TIE+ANRLV GL SEN+RW + ++ +K +EKTL GDVL+T AF+SYVG F+K YR  LM+  W+PFL +   +IP+++ LDP+ ML DDA +A WNNEGLPSDRMS ENATIL NAERWPL+IDPQ QGIKWIK ++G  LKV+ LGQKGYL  IE A+++GD VLIEN+ E++DPVLD LLGRNTIK+GR IK+GDKECEYN  FRLIL TKLANPHYKPE+QAQTT+INFTVT DGLEDQLLA VV+ ER DLE LK  LTKQQN FKI LK LED LL RLSAAEG+FLGD  LVE LE+ K TA EIE KV +AK  E+ INE RE YR AAARAS+LYFI++DL+KINP+YQFSLKAF VVF KAI RAE SE++  RV  L + IT+S +LYTS+GLFEKDKL F +Q +FQILL  KEI+  ELD LLRFPI  +  SP+DFLS  SW  IK +S L+EFK LDRDIEGSAKRWKKFVESE PE E+ PQ+WKNKTSLQ+L ++RALRPDRMTYA+ +F++EKLG KYVE    +F++S+EE+                        KKLGF+ D+  F NISLGQGQE VAE+AM+  A++GHWV+LQN+HLV+KWL  LEK L +Y+  SHE YR+FISAEP+ SPE HIIPQGILEN+IKITNEPPTGMLANLH +L+NF+Q+T+EMCA+E EFK ILF+LCYFHA V+ R KFGPQGWNR YPFN+GDL I VNVLYNYLEAN+KVPWEDLRYLFGEIMYGGHITDDWDRKLC+TYLEE++ P +L+GE  + PGF  PPN DY GYH YIDE LPAE+P LYGLH NAEI+FLT  SD LFKT+ EMQP+++     +G+S EE++K ILD+I+EKLP++FNM+E+  K    ER+PY++V FQECERMN+LT EIRRSLKEL+LGLKGELTI++DMEAL +SL+ D +P++W+K AYPS + L  W  DLLLR +EL+ WT D  LP+V+WL GLFNPQSFLTAIMQ MARKNEWPLD+M L  DVTKK KED G PPR+GAY+ GLFMEGARWD Q+ +IAEA+LK+L P MPVI+++AIPVD+++LRN Y CP+Y+TK RGPT+VWTFNLKTKE P+KW
Sbjct:   16 DVRVQFMGDRIQQMMKIKTDKWIKFVEDETNEKIIRDFFELGDHVTLVFSIGPNG-ILTASKEVT---KFKTVYIRKKKPANIGMEN-YKTDLMFGELACASINQTSALVEEVLVPILSNKKNHLSWPQFTSLDMDQHVEYMKNKMHVIQGLISGKTHLPIPTVA-TITEQNLNVTKNHVQRAALHAFESILIKWSYQIVEVLERDSSQPLLQGLDPGPHAELKFWKERRDNLTCIYEQLQAPAVQKMASILQDTESAYYPTFTNIVCEVKKALIEAEDIDLHLSTLRNHIKLLEETDFPQIYILLPPLLHTICLIWAHSKCYNIPARVIVLLQEFCNLLIEQAKTYLSPEDLFKAEPEESLEHVQAALKVLQSFKHAFFTHRASLQTYYTDRTQFKAWDFRSEMVFAKFDRFLERLLKIEDIFVIMLEFQKLEKLEFGGKKGKALNEKIFNLNEEFQDNSKVFKESTLDPTDRNNKEFEQEYSDFKAKVLDCDTRIASLLSEAFNDSSGLESAFKVQ--YGTVLKPYVILDIFSPNYFTLLQMYDKELDRCKLLYDAHVKQTLKT-------------ISWSN--FRFIHHLLAFCTSNTSFRSMESPEASSVYQKYMEMMTLLDQYEDSVYEKWTSKVDEECEFNLDRPLLVRNNDDGLLSVNFDPKLIAVLREVRYLQKQSQADIPKEALAIFDKREMLHKYIASLDQLVFWYNKLKRTVLEVEYPLIKDDLKNIDEQLRESEERYTWK----DDNCWDYIVKVKSVVQDLEKRVQTSKDNIITMQQIMKVWAEQWLFSRKDNRKETLINLDDKNEIVNKKYQTIQEDSVKIQSLAMENMELLKATPGLDSWKMYVEYIDTIVTDGLYNTILHSLTFFMENTDVRLKPAPLFEAQMILASTEIIFKPSLQKEDGDGLYDLVEEMLSDIFKMSGQVKRIAKHLETDNYQNDMDDMTDLAAIRQEIMERVTGVIIKVTDYRSTYDSYSYLWTDDRQEFMRQFLLYGHVLTSDEIEAHADDGVP---ETPPTIDQFKEQIDIFENLYVLMSSSDDTKVFERWFRVDIKPFKTSLLVIIKKWSWMFKEHLVRFVIDSLAELEEFIKEANAILLKKVPEGDYSALVAVMELLLAVRDRQMATDELFEPLKQTISLLESYGQKLPDQIYVQLEELPEKWNHTKKLAVSVKHDVAPLQISEVTLIRKRCTAFDV------------------CTSLFLALTK----IWSL--LILHLQQSADLFDVAVPDYKQLKKSSKEIKLLKELWDLIHTV----------------------------RDLLSLDKHTRSWDAYSGLDLSIKNLITSLRAITDLQNPAIRDRHWHQLMNATKVQFTMTEQTTLSDLLALQLHKVEDEVRNIVDKAVKEMGTEKILIEISQTWTSMEFSYEHHHRTGTPLIQTDELLFETLDNNQVQLQVIMQSKYVEYFIEQVTSWQKRLNLADSVIYIWMEVQRTWSHLESIFIGSADIRNQLPGDAKRFKGVDADFKVNIDLNINKQMNVLDATNRPDLYKTLEDLQLRLSLCEKALSEYLETKRLAFPRFYFVSAADLLDILSKGTQPKQVTRHLAKLFDNIADLQFQDSGE--NEAQG--MYSKENEFVPFSVNCKCIGQVEHWLKKVEETMCETICCHITESVAAYEDKPRDQWLFDYPAQVALTSSQIWWTIDVGIAFERLEEGFETALKDYIKKQIAQLNALINMLLGELSAGDRQKIMTMCTIDVHARDVVAKLIAHKVTNAQDFAWLSQLRHRWDEKQKHCFVNICDAQFQYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGVMVYVFNCSEQMDYKSVGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRNKRERFLFLGENITLKHSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDIELICEIMLVAEGFIDARPLARKFITLYTLCKELLSKQDHYDWGLRAVKSVLVVAGSLKRGDSSRPEDQVLMRALRDFNLPKIVTDDVPIFMGLISDLFPALDVPRKRDFSFEQMVKQSTLELHLQPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKVLRTLNKTYLNRKQKPVWNDLNPKAVSTDELFGFIHPATREWKDGLLSSLMREQANLTHEGPKWIVLDGDIDPMWIESLNTVMDDNKVMTLASNERIPLTPTMRLLFEIHHLRTATPATVSRAGILYMNPQDLGWNPYVTSWIETRSNQTEKANLTILFDKYVPPCLDQFRTGFLKTVTPILENSMVQTLCSLLDCLLNTDNVPPDSARELYELYFVFACIWAFGGALQRDQLTDYRVEFSRWWTKEMKSVKFPAQGTIFDYFLDSKARRFISWAERVPSFEMDIDSTMQAVFVHTAETTCLGYFTDLLIQKSKPVMLVGNAGVGKTVFLSDRLASLPDHYMIAKVPFNYYTTSSALQRVLEKPLEKKAGRNYGPIGNKKLVYFIDDMNMPEVDKFGTVQPHTLIRQHIDYGHWYERQKMSLKEIHNCQYVACMNPTAGSFTINQRLQRHFTVFAVNFPSNDAVEVIFSKILSFHFKQHAFSPSVLKAGTSIIQATIWLSHKMVQNFLPTAIKFHYIFNIREITNIFQGILFATSECLKQPSDLIHLWFHESSRVYGDKMVESKDSDLFKRILQDTVQRYFEGVEHQVFSQQPLIFCHFANGLDTQSYMPVKGWEVLRKTLAEALNSYNELSAAMNLVLFEDAMQHVCRISRILEMPRGYALLIGVGGSGKQSLSKLAAYIGSLEVFQITLKNGYSVQDLKVDLANLYIRTGAKNMPTVFLLTDAQVPDERFLVLINDLLASGEIPDLFTEEETDSIVSGIRSEVRGLGLNDSKENCWNFFLERVRHQLKVVLCFSPVGCTLRVRARKFPAIVNCTSIDWFHEWPQEALQSVSRRFIQDIEGIEPGVKDSISQFMAYVHTSVNDMSIKYLQYEKRYNYTTPKSFLEQITLYKNLLEKKRRELSQRMEHLMNGLQKLTTTASQVEDLKVKLASQEAELQQRNQDAEALITKIGRQTEKVSQEKATADAEEQKVASIQEEVSVKQKDCEEDLSKAEPALIAATAALDTLNKTNLTELKTFPNPPIAVTNVTAAVMVLLAPKGRVPKDRSWKAAKV-FMGKVDDFLQALIKYDKEHIHENCLKVAKEQYLNDPGFSPDLVRTKSFAAAGLCAWVINIVKYYEVYCDVEPKRKALGQANEDLKGATEKLTAIRKKLHDLDNNLKKLTHSFEKATAEKVRCQEEVNRTNTTIEMANRLVKGLESENIRWSESIKSFKAQEKTLCGDVLLTAAFVSYVGSFSKRYRQELMENIWIPFLTSQKVVIPVSEGLDPIAMLTDDATVAGWNNEGLPSDRMSTENATILINAERWPLMIDPQQQGIKWIKNKYGTVLKVINLGQKGYLQTIETALASGDTVLIENLAENVDPVLDPLLGRNTIKRGRYIKIGDKECEYNQHFRLILHTKLANPHYKPELQAQTTLINFTVTTDGLEDQLLADVVSIERPDLEELKSMLTKQQNDFKIELKRLEDELLIRLSAAEGSFLGDMELVEKLESTKVTAAEIEHKVVEAKENEIKINEAREHYRAAAARASLLYFIMSDLSKINPIYQFSLKAFNVVFHKAIGRAEQSEDVTERVAKLTECITYSAFLYTSQGLFEKDKLTFLSQTAFQILLKQKEIDSLELDVLLRFPIENSYKSPVDFLSVQSWSAIKMISLLDEFKGLDRDIEGSAKRWKKFVESENPENERLPQDWKNKTSLQKLILLRALRPDRMTYAIRNFIEEKLGSKYVEEARPDFAKSYEET-----------------------SKKLGFTIDSGKFHNISLGQGQEKVAEEAMEKAAQQGHWVILQNVHLVAKWLGTLEKLLAQYSTGSHEDYRIFISAEPAPSPEEHIIPQGILENSIKITNEPPTGMLANLHAALDNFDQDTLEMCAREQEFKCILFSLCYFHACVAGRLKFGPQGWNRRYPFNSGDLTICVNVLYNYLEANNKVPWEDLRYLFGEIMYGGHITDDWDRKLCRTYLEEFMNPAVLEGEKPLAPGFAAPPNQDYSGYHEYIDEILPAENPVLYGLHLNAEIDFLTVTSDNLFKTILEMQPKNTLHGEGSGMSVEEKVKNILDEILEKLPEEFNMLELMHKTT--ERSPYILVCFQECERMNILTQEIRRSLKELNLGLKGELTISSDMEALQSSLFYDSVPDTWAKLAYPSSFSLGQWINDLLLRCRELDTWTQDLVLPAVVWLSGLFNPQSFLTAIMQSMARKNEWPLDKMCLTVDVTKKTKEDYGHPPREGAYICGLFMEGARWDIQTNVIAEARLKDLTPLMPVIYVRAIPVDKKELRNTYDCPLYRTKTRGPTYVWTFNLKTKEPPAKW 4360          
BLAST of DNAHb-1 vs. Ensembl Mouse
Match: Dnah17 (dynein, axonemal, heavy chain 17 [Source:MGI Symbol;Acc:MGI:1917176])

HSP 1 Score: 5595.01 bits (14513), Expect = 0.000e+0
Identity = 2822/4451 (63.40%), Postives = 3485/4451 (78.30%), Query Frame = 1
Query:  127 LKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLP--VGSEKVSEGDINSFGEVP----RSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKG---ETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHV--SGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQI--EGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLL--KTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            LK K+DK+ KL   +E   ++ +FF+K +   + VL     G +     FP +LKSK  +F K   E+I++D  +   LI+GDIS T +DQ  + V+EV+  +L+ ++N + WP V+S D+++  + LK++  V+ G+ KGKTLLP+P  +GS    +G ++S   +P     S++++IET++I+W+HQI DVLSK S++ L+ GL+P P VE ++W  R  NL+CI+EQL  PKV K+  +LE   S Y P  ++++ +V   LKE+  I LYL PLR  LEE+EQ +F+ +   I  +   +C IWA  + Y  P R++V+ +E  N II    +YL P E+ KG   E EE L  +  S+ +L    ++++     +K +FKD   PV W+F S+L F R+NSF  R++ ++ +    +EF KLEK+E+ G+ G  L   +  +++E   + K F E  YD LDP ++ F  DY  F+  I DLDRRLAT   QAF DC+C ++  KL+ + GGLL+RP++ +E   RY  +++M + E++N KL+YD  +  S + ++P IHKNM  V+G+L+W  E++ER++  +    H++H    + E  L+  K+DE++ LL+   MK Y  W+ GVD+ C FNL QPL+ R+  T  I VNF   L AVLREVKYL    Q+EIP+SA  + S+N+T RK++ NL+L+V WYN ++     VE PLI++EL  ID +L  A T L WN +       +YI+++R++++NL++R+ K+K+N++ I   M  W  +PLFERK+ K + LL+LD R    NKRY  + EAG R+  +V EN+EL +AD+ S+ WK YV+ ID ++++ F   I  SL Y++D +  + S  PLFE+ M+L  + + + PSL+      F  L++ L+ D++  A  + RLA G    +Y++DLE+  +L + R E+S     A + A+ YQ  F+ YS LW D+ +EFM  FL +G A + EEL+   +  I    + PPTL QF+ QID YEK +EE+       +   W + DCR FKQ  LNTIKRWS +FK++L +HV NSL +L  F+ IT + L K   EGD++GLVE+MGHL  VKERQ ATD MFEPLKQTI+LLK+Y +EMP+E++L+L+ELPE+W NTKK+A+ VKQ VAPLQ  EV  +RRKC  F++KQH FRE+FR+  PF+FS  E Y+ L+++   IS +E  ME L +SA+LFEVTVP++KQLK C +E+RLLK LWD I +VN+SI+ WK T WKDINVEQMD DCK FAK +RSLDKEM+ WDA+ G+++ +KNM+TSLRAV+ELQNPAIRDRHW QLM AT+VKF+M+E TTL DLL+LNLH +EDEVR+IV+KAVKE  MEKVLK L  TW+ MEFEHE H RTG  +LK+ E L+ETLE++QV+LQN+M SKY+SHF  EV SWQ+ LSTAD VI IWFEVQRTWSHLESIFIGS+DIR QLPEDS+RFD ID +FKAL+ +  +T NVV+AT KP LY +LE ++  L +CEKALAEYLETKRLAFPRFYFVSSADLLDILSNGN P  V +HL+KLFDSL KLKF  +A  +  K G+ MY+K+ E V+F   CDL GQVE WLNR+L+ MR T+R  + E+V + EEK R+QWIF++PAQVAL+ +QI W TEV L+FARLEEGYENA+KD+NKKQI+QLNALITLLIG L+  DR K+MTICTIDVH RDVV K+IT K+++SQ+FTW  QLRHRW +  K C+ NICDAQ +Y++EYLGNTPRLVITPLTDRCYITLTQSLHL M GAPAGPAGTGKTETTKDLGRALG MVYVFNCSEQMDYKS GNIYKGLAQ+G+WGCFDEFNRISVEVLSV+AVQVKC+QDAI+ K+K+F+FLGE ISL   +GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFL AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DP R EDQVLMRALRDFNIPKIVTDD PVFMGLIGDLFPALDVPRKRD  FEK ++Q+ ++LKLQAE++FVLKVVQL+EL  VRHSVFV+GNAG+GKS V K+L KTY NLK+KP+AVDL+PKAVT DELFGIINP+TREWKDGLFS IMRDLANLT +GPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPL  TMRL+FEISHL+TATPATVSRAGILYINP DLGW P V+SWI  R++QSE+ANL ILFDKY+P CL+ L++ FK+ITP+ EI+ +Q + +LLE LL  +N P D PKE YELYFVF   WAFG  MFQDQL+D+RVEF+KWW+ EFKTIKLP+QGT+FDYYID ETKKF PWT ++  FE+D + PLQA LV T+ET R RYF+DLL+EK  PVMLVG AGTGK+VL+ DKL ++  D+Y+V  VPFNFYTTS MLQ VLEKPLEKK+GRNYGP G+KKLIYFIDDMNMPEVDKY TV PHTLIRQH+D+ HWYDR KLTLK++HN QY+ACMNPT+GSFTI PRLQRHFCVFA+SFPGQE+L +IY+TIL++ L S  SA L+  +  S+LV  AL  H K+++TFLPTAIKFHY+FNLRDLSNIFQGILF+  + +K P DLVRLW+HE ERVY DK++D+ D ET  R+     KK F+++ E  +F KP ++CHF QGIG+PKY PV     L+K+LK+ L+SYNEVNA MNLVLFEDAVAHI +INRILESPRG ALLVGVGGSGKQSLSRLAA+IS+LDVFQITL+KGY I DLK+DLA  Y+K+ VKN+  VFL+TD+Q+A+E+FLVL+NDLLASGEI  LF D+++ENIISSMR +VKS G+ D+RE CW FFI KVR  L+++LCFSPVGS LRVRARKFPAVVNCT+I+WFHEWPEDAL+SVS RFL+E E +  + K S + FM++VH  VN++S  YL  ERRYNYTTPK+FLEQI LY N+L KK  EL  K+ RLENGL KL+STA QVDDLKAKLA QE EL+QKN +A++L++ V  +T+KVS EK IAD EE KV  I   V++KQ+ CE DLAKAEPAL AAQEAL+TLNKNNLTE+KSFG+PP AV++V+AA M L A  GK+PKD+SWKAAK  +MGK+D FLD+L  ++K++IPE  LKA K Y  +P F+PE I+SKS AAAGLCSW INI+ +YE++CDV PKR ALE AN EL EA EKLS I+NKI +L   L  L   FEKA ++K +CQ EAD T + I LANRLVGGLASENVRW + VE +K +  TL GDVL+  AF+SYVG FTK YR  LM+ +W+P++  L   IPIT+ LDPL +L DDA +A+WNN+GLPSDRMS ENATIL N ERWPLI+D QLQGIKWIK ++G+DL+ +RLGQK YLD+IEQA+SAGD +LIENI E++DPVLD LLGRNTIKKGR IK+GDKE EY+P FRLIL TK  NPHYKPEMQAQ T+INF VTRDGLEDQLLA VV KER DLE LK +LTK QN+FKI LKELEDSLL RLSAA GNFLGD ALVENLE  K TA EIEEKV++AKITEV INE RE YRPAA RAS+LYFILNDLNKINP+YQFSLKAF VVFEKAI +  P++E+K RV NL D IT+SVY+YT+RGLFE+DKLIF AQ++FQ+L   KE+NP ELDFLLRFP    + SP+DFL + SWGGIKALS ++EFKNLD DIEGSAKRWKK VESE PEKE FP+EWKNKT+LQ+LCM+R +RPDRMTYAV +FV+EK+G K+VEG  VEFS+S++ES P+TPIFFILSPGVDPLKDVE LGKKLGF+ DN    N+SLGQGQE+VAE A+D+ A++GHWV+LQNIHLV++WL  L+KK+E Y+  SHE YRVFISAEP+ + E+HIIPQGILENAIKITNEPPTGM ANLHK+L+ F Q+T+EMC KE EFK ILFALCYFHAVV+ERRKFG QGWNRSYPFN GDL IS+NVLYNYLEANSKVPW+DLRYLFGEIMYGGHITDDWDR+LC+TYL EY++ EML+GE+ + PGF++PPN DYKGYH YIDE LP ESPYLYGLHPNAEI FLT  S+KLF+TV EMQP+++     TG+SREE++K +LDDI+EK+P+ FNM EI AK    E+ PYVVVAFQECERMN+LT+E+RRSLKEL+LGLKGELTIT DME LS +L+ D +P++W  RAYPS+ GLA WYADLL RI+ELE WTTDF LP+ +WL G FNPQSFLTAIMQ MARKNEWPLD+M L  +VTKKN+EDM  PPR+G+YV+GLFMEGARWDTQ+G+IAEA+LK+L P MPVIFIKAIPVDR + +N+Y CPVYKT+ RGPT+VWTFNLKTKEK +KW
Sbjct:   17 LKFKADKWGKLIGAEENMALLTEFFDKID-NPVLVLTLNAAGMIIPCLGFPESLKSKGVYFIKMKPENITKDN-YKTHLIYGDISPTTVDQLIAVVEEVLYSLLNQSENMDGWPRVVSEDIVKQVHRLKNEMFVMGGKIKGKTLLPIPEHLGS---LDGTLDSMERIPSSMDNSLLHSIETIIIDWSHQIRDVLSKDSAQALLDGLHPLPRVEFEFWDARLMNLQCIHEQLNRPKVNKIVEILEKAKSCYWPALQNVYMNVTQGLKEANGIVLYLKPLRILLEEMEQADFTMLPSFIVKVLSTICFIWATSEHYNTPSRVIVILREFCNQIIEMTRTYLSPDEVLKGLQGEIEEVLGNISLSVSVLKGLFQAYDFCCANMKLFFKDRP-PVPWEFPSSLAFSRMNSFFHRVQTIEDLYKTAIEFLKLEKIELGGVWGNILGNLVTQIYDEVFELVKVFAECKYDPLDPGDSSFDDDYSDFETKIQDLDRRLATIFCQAFDDCNCMESSAKLLYMCGGLLERPLILVEVVPRYSVMLEMFNTELDNAKLMYDAQMAASADGQIPPIHKNMSPVSGQLKWSLELQERLEVSMKYLKHIEHPVMSSMEAKLIYDKYDEMMGLLQSCRMKKYQQWVEGVDQDCHFNLGQPLIQRDPFTSLIQVNFSKALVAVLREVKYLNFQQQKEIPESAEKLFSENETFRKFVGNLELIVGWYNEIKTTVKDVEFPLIKSELEAIDVKLLSAETTLFWNGE----NVMEYIQEMREMLYNLQNRIQKAKQNVEGITQAMQEWSANPLFERKDNKKEALLDLDGRVANLNKRYAAVKEAGVRIQAMVVENAELFRADTTSQSWKDYVNYIDTVVLDEFDRFIRKSLNYLMDNMTMDESIAPLFEIRMELDKDGLTYNPSLEMGDEAGFLSLIEGLINDLYNVARLIPRLAKGRL--NYKSDLEDITDLIEMREEVSSLVIGAMKVAEEYQDSFERYSYLWVDDLQEFMKNFLIFGHAPTPEELDTKTDDTIP---KTPPTLAQFQQQIDSYEKLYEEVSSCENTKVFHGWLQCDCRPFKQTLLNTIKRWSFLFKRYLNNHVINSLADLESFMNITRTALKKPLKEGDYDGLVEVMGHLMKVKERQVATDSMFEPLKQTIELLKSYGEEMPEEIYLKLQELPEQWTNTKKLAIQVKQNVAPLQANEVNILRRKCQQFELKQHEFREKFRRDAPFSFSDPEPYKSLNKQQKSISAMEGVMEALCKSASLFEVTVPDYKQLKACHREVRLLKELWDMIVMVNTSIDDWKTTKWKDINVEQMDIDCKKFAKDVRSLDKEMKPWDAFVGLDNTVKNMITSLRAVSELQNPAIRDRHWQQLMQATQVKFEMSEETTLADLLQLNLHKYEDEVRNIVDKAVKESGMEKVLKTLDITWTTMEFEHELHPRTGTMMLKSDEVLVETLEDNQVQLQNLMMSKYLSHFLKEVTSWQQKLSTADSVISIWFEVQRTWSHLESIFIGSEDIRAQLPEDSKRFDAIDQEFKALMEDAVKTPNVVEATNKPDLYNKLENLKMSLAVCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKLKFRLDASGKPLKFGLGMYSKEDEFVDFDKECDLSGQVEVWLNRVLDRMRATLRHEIPEAVVTYEEKPREQWIFDYPAQVALTCTQIWWTTEVGLAFARLEEGYENAIKDYNKKQISQLNALITLLIGNLTAGDRMKIMTICTIDVHARDVVAKMITAKVESSQAFTWQSQLRHRWDEEKKHCFANICDAQIKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDLGRALGTMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVIAVQVKCVQDAIRAKKKKFNFLGEIISLVPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLDARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPTRAEDQVLMRALRDFNIPKIVTDDLPVFMGLIGDLFPALDVPRKRDLNFEKIIKQSIVELKLQAEDSFVLKVVQLEELLQVRHSVFVIGNAGSGKSQVLKSLNKTYQNLKRKPVAVDLDPKAVTCDELFGIINPATREWKDGLFSTIMRDLANLTHEGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNRTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPVVSSWIERRKVQSEKANLIILFDKYLPTCLDKLRIGFKRITPVPEITVIQTILYLLECLLTEKNAPPDSPKELYELYFVFACFWAFGGAMFQDQLIDYRVEFSKWWINEFKTIKLPSQGTIFDYYIDPETKKFLPWTDKVPNFELDPDIPLQASLVHTTETIRIRYFIDLLMEKAWPVMLVGNAGTGKSVLMGDKLENLSTDDYLVQAVPFNFYTTSAMLQGVLEKPLEKKSGRNYGPPGTKKLIYFIDDMNMPEVDKYGTVAPHTLIRQHMDHRHWYDRQKLTLKDVHNCQYVACMNPTSGSFTIDPRLQRHFCVFAVSFPGQEALTSIYNTILAQHL-SFRSAPLVIQRLSSHLVTAALALHQKVSATFLPTAIKFHYIFNLRDLSNIFQGILFSTAEILKTPLDLVRLWLHEAERVYGDKMVDEKDQETLHRVTIASVKKFFDDLGEENLFAKPNIFCHFTQGIGDPKYFPVTDVAQLNKLLKDVLDSYNEVNAVMNLVLFEDAVAHICKINRILESPRGNALLVGVGGSGKQSLSRLAAYISALDVFQITLKKGYAIPDLKMDLATQYIKSAVKNVPSVFLMTDSQVAEEQFLVLINDLLASGEIPGLFGDEDLENIISSMRPQVKSLGIADTREACWKFFIEKVRRQLKVILCFSPVGSVLRVRARKFPAVVNCTAINWFHEWPEDALVSVSARFLEETEGIEPEVKTSISLFMAYVHTTVNEMSKIYLTIERRYNYTTPKTFLEQIKLYQNLLAKKRMELVAKIERLENGLMKLQSTASQVDDLKAKLAVQETELKQKNENADKLIQVVGVETEKVSKEKAIADEEEMKVEVINKNVTEKQKACETDLAKAEPALLAAQEALDTLNKNNLTELKSFGSPPDAVVNVTAAVMILTAPGGKIPKDKSWKAAKI-MMGKVDTFLDSLKKFDKEHIPEACLKAFKPYQGNPTFDPEFIRSKSTAAAGLCSWCINIVRFYEVYCDVAPKRQALEEANAELAEAQEKLSRIKNKIAELNANLSNLTSAFEKATAEKIKCQQEADATNRVISLANRLVGGLASENVRWAESVENFKSQGVTLCGDVLLISAFVSYVGYFTKKYRNELMEKFWIPYINKLKVPIPITEGLDPLTLLTDDADVATWNNQGLPSDRMSTENATILCNTERWPLIVDAQLQGIKWIKNKYGSDLQAIRLGQKSYLDIIEQAISAGDTLLIENIGETVDPVLDPLLGRNTIKKGRFIKIGDKEVEYHPSFRLILHTKYFNPHYKPEMQAQCTLINFLVTRDGLEDQLLAAVVAKERPDLEQLKANLTKSQNEFKIVLKELEDSLLARLSAASGNFLGDTALVENLETTKHTANEIEEKVQEAKITEVKINEARENYRPAAERASLLYFILNDLNKINPIYQFSLKAFNVVFEKAIQKTAPADEVKQRVINLTDEITYSVYMYTARGLFERDKLIFLAQVTFQVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQSWGGIKALSEMDEFKNLDSDIEGSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCMRPDRMTYAVKNFVEEKMGSKFVEGRSVEFSKSYKESSPSTPIFFILSPGVDPLKDVEALGKKLGFTIDNGKLHNVSLGQGQEVVAENALDVAAEKGHWVILQNIHLVARWLGILDKKVERYSSGSHEDYRVFISAEPAPTAETHIIPQGILENAIKITNEPPTGMYANLHKALDLFTQDTLEMCTKEIEFKCILFALCYFHAVVAERRKFGAQGWNRSYPFNNGDLTISINVLYNYLEANSKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLAEYIRVEMLEGEVLLAPGFQIPPNLDYKGYHEYIDENLPPESPYLYGLHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAGTGVSREEKVKAVLDDILEKIPETFNMAEIMAKAA--EKTPYVVVAFQECERMNILTNEMRRSLKELNLGLKGELTITTDMEDLSTALFYDTVPDTWVARAYPSMMGLAAWYADLLQRIRELESWTTDFALPTTVWLAGFFNPQSFLTAIMQSMARKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQTGVIAEARLKDLTPVMPVIFIKAIPVDRMETKNIYECPVYKTRIRGPTYVWTFNLKTKEKAAKW 4448          
BLAST of DNAHb-1 vs. Ensembl Mouse
Match: Dnah17 (dynein, axonemal, heavy chain 17 [Source:MGI Symbol;Acc:MGI:1917176])

HSP 1 Score: 5559.57 bits (14421), Expect = 0.000e+0
Identity = 2815/4458 (63.14%), Postives = 3476/4458 (77.97%), Query Frame = 1
Query:  127 LKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLP--VGSEKVSEGDINSFGEVP----RSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKG---ETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHV--SGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQI--EGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLL--KTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVL-------QNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            LK K+DK+ KL   +E   ++ +FF+K +   + VL     G +     FP +LKSK  +F K   E+I++D  +   LI+GDIS T +DQ  + V+EV+  +L+ ++N + WP V+S D+++  + LK++  V+ G+ KGKTLLP+P  +GS    +G ++S   +P     S++++IET++I+W+HQI DVLSK S++ L+ GL+P P VE ++W  R  NL+CI+EQL  PKV K+  +LE   S Y P  ++++ +V   LKE+  I LYL PLR  LEE+EQ +F+ +   I  +   +C IWA  + Y  P R++V+ +E  N II    +YL P E+ KG   E EE L  +  S+ +L    ++++     +K +FKD   PV W+F S+L F R+NSF  R++ ++ +    +EF KLEK+E+ G+ G  L   +  +++E   + K F E  YD LDP ++ F  DY  F+  I DLDRRLAT   QAF DC+C ++  KL+ + GGLL+RP++ +E   RY  +++M + E++N KL+YD  +  S + ++P IHKNM  V+G+L+W  E++ER++  +    H++H    + E  L+  K+DE++ LL+   MK Y  W+ GVD+ C FNL QPL+ R+  T  I VNF   L AVLREVKYL    Q+EIP+SA  + S+N+T RK++ NL+L+V WYN ++     VE PLI++EL  ID +L  A T L WN +       +YI+++R++++NL++R+ K+K+N++ I   M  W  +PLFERK+ K + LL+LD R    NKRY  + EAG R+  +V EN+EL +AD+ S+ WK YV+ ID ++++ F   I  SL Y++D +  + S  PLFE+ M+L  + + + PSL+      F  L++ L+ D++  A  + RLA G    +Y++DLE+  +L + R E+S     A + A+ YQ  F+ YS LW D+ +EFM  FL +G A + EEL+   +  I    + PPTL QF+ QID YEK +EE+       +   W + DCR FKQ  LNTIKRWS +FK++L +HV NSL +L  F+ IT + L K   EGD++GLVE+MGHL  VKERQ ATD MFEPLKQTI+LLK+Y +EMP+E++L+L+ELPE+W NTKK+A+ VKQ VAPLQ  EV  +RRKC  F++KQH FRE+FR+  PF+FS  E Y+ L++ ++    L   ME L +SA+LFEVTVP++KQLK C +E+RLLK LWD I +VN+SI+ WK T WKDINVEQMD DCK FAK +RSLDKEM+ WDA+ G+++ +KNM+TSLRAV+ELQNPAIRDRHW QLM AT+VKF+M+E TTL DLL+LNLH +EDEVR+IV+KAVKE  MEKVLK L  TW+ MEFEHE H RTG  +LK+ E L+ETLE++QV+LQN+M SKY+SHF  EV SWQ+ LSTAD VI IWFEVQRTWSHLESIFIGS+DIR QLPEDS+RFD ID +FKAL+ +  +T NVV+AT KP LY +LE ++  L +CEKALAEYLETKRLAFPRFYFVSSADLLDILSNGN P  V +HL+KLFDSL KLKF  +A  +  K G+ MY+K+ E V+F   CDL GQVE WLNR+L+ MR T+R  + E+V + EEK R+QWIF++PAQ       I W TEV L+FARLEEGYENA+KD+NKKQI+QLNALITLLIG L+  DR K+MTICTIDVH RDVV K+IT  +++SQ+FTW  QLRHRW +  K C+ NICDAQ +Y++EYLGNTPRLVITPLTDRCYITLTQSLHL M GAPAGPAGTGKTETTKDLGRALG MVYVFNCSEQMDYKS GNIYKGLAQ+G+WGCFDEFNRISVEVLSV+AVQVKC+QDAI+ K+K+F+FLGE ISL   +GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFL AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DP R EDQVLMRALRDFNIPKIVTDD PVFMGLIGDLFPALDVPRKRD  FEK ++Q+ ++LKLQAE++FVLKVVQL+EL  VRHSVFV+GNAG+GKS V K+L KTY NLK+KP+AVDL+PKAVT DELFGIINP+TREWKDGLFS IMRDLANLT +GPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPL  TMRL+FEISHL+TATPATVSRAGILYINP DLGW P V+SWI  R++QSE+ANL ILFDKY+P CL+ L++ FK+ITP+ EI+ +Q + +LLE LL  +N P D PKE YELYFVF   WAFG  MFQDQL+D+RVEF+KWW+ EFKTIKLP+QGT+FDYYID ETKKF PWT ++  FE+D + PLQA LV T+ET R RYF+DLL+EK  PVMLVG AGTGK+VL+ DKL ++  D+Y+V  VPFNFYTTS MLQ VLEKPLEKK+GRNYGP G+KKLIYFIDDMNMPEVDKY TV PHTLIRQH+D+ HWYDR KLTLK++HN QY+ACMNPT+GSFTI PRLQRHFCVFA+SFPGQE+L +IY+TIL++ L S  SA L+  +  S+LV  AL  H K+++TFLPTAIKFHY+FNLRDLSNIFQGILF+  + +K P DLVRLW+HE ERVY DK++D+ D ET  R+     KK F+++ E  +F KP ++CHF QGIG+PKY PV     L+K+LK+ L+SYNEVNA MNLVLFEDAVAHI +INRILESPRG ALLVGVGGSGKQSLSRLAA+IS+LDVFQITL+KGY I DLK+DLA  Y+K+ VKN+  VFL+TD+Q+A+E+FLVL+NDLLASGEI  LF D+++ENIISSMR +VKS G+ D+RE CW FFI KVR  L+++LCFSPVGS LRVRARKFPAVVNCT+I+WFHEWPEDAL+SVS RFL+E E +  + K S + FM++VH  VN++S  YL  ERRYNYTTPK+FLEQI LY N+L KK  EL  K+ RLENGL KL+STA QVDDLKAKLA QE EL+QKN +A++L++ V  +T+KVS EK IAD EE KV  I   V++KQ+ CE DLAKAEPAL AAQEAL+TLNKNNLTE+KSFG+PP AV++V+AA M L A  GK+PKD+SWKAAK  +MGK+D FLD+L  ++K++IPE  LKA K Y  +P F+PE I+SKS AAAGLCSW INI+ +YE++CDV PKR ALE AN EL EA EKLS I+NKI +L   L  L   FEKA ++K +CQ EAD T + I LANRLVGGLASENVRW + VE +K +  TL GDVL+  AF+SYVG FTK YR  LM+ +W+P++  L   IPIT+ LDPL +L DDA +A+WNN+GLPSDRMS ENATIL N ERWPLI+D QLQGIKWIK ++G+DL+ +RLGQK YLD+IEQA+SAGD +LIENI E++DPVLD LLGRNTIKKGR IK+GDKE EY+P FRLIL TK  NPHYKPEMQAQ T+INF VTRDGLEDQLLA VV KER DLE LK +LTK QN+FKI LKELEDSLL RLSAA GNFLGD ALVENLE  K TA EIEEKV++AKITEV INE RE YRPAA RAS+LYFILNDLNKINP+YQFSLKAF VVFEKAI +  P++E+K RV NL D IT+SVY+YT+RGLFE+DKLIF AQ++FQ+L   KE+NP ELDFLLRFP    + SP+DFL + SWGGIKALS ++EFKNLD DIEGSAKRWKK VESE PEKE FP+EWKNKT+LQ+LCM+R +RPDRMTYAV +FV+EK+G K+VEG  VEFS+S++ES P+TPIFFILSPGVDPLKDVE LGKKLGF+ DN    N+SLGQGQE+VAE A+D+ A++GHWV+L       QNIHLV++WL  L+KK+E Y+  SHE YRVFISAEP+ + E+HIIPQGILENAIKITNEPPTGM ANLHK+L+ F Q+T+EMC KE EFK ILFALCYFHAVV+ERRKFG QGWNRSYPFN GDL IS+NVLYNYLEANSKVPW+DLRYLFGEIMYGGHITDDWDR+LC+TYL EY++ EML+GE+ + PGF++PPN DYKGYH YIDE LP ESPYLYGLHPNAEI FLT  S+KLF+TV EMQP+++     TG+SREE++K +LDDI+EK+P+ FNM EI AK    E+ PYVVVAFQECERMN+LT+E+RRSLKEL+LGLKGELTIT DME LS +L+ D +P++W  RAYPS+ GLA WYADLL RI+ELE WTTDF LP+ +WL G FNPQSFLTAIMQ MARKNEWPLD+M L  +VTKKN+EDM  PPR+G+YV+GLFMEGARWDTQ+G+IAEA+LK+L P MPVIFIKAIPVDR + +N+Y CPVYKT+ RGPT+VWTFNLKTKEK +KW
Sbjct:   17 LKFKADKWGKLIGAEENMALLTEFFDKID-NPVLVLTLNAAGMIIPCLGFPESLKSKGVYFIKMKPENITKDN-YKTHLIYGDISPTTVDQLIAVVEEVLYSLLNQSENMDGWPRVVSEDIVKQVHRLKNEMFVMGGKIKGKTLLPIPEHLGS---LDGTLDSMERIPSSMDNSLLHSIETIIIDWSHQIRDVLSKDSAQALLDGLHPLPRVEFEFWDARLMNLQCIHEQLNRPKVNKIVEILEKAKSCYWPALQNVYMNVTQGLKEANGIVLYLKPLRILLEEMEQADFTMLPSFIVKVLSTICFIWATSEHYNTPSRVIVILREFCNQIIEMTRTYLSPDEVLKGLQGEIEEVLGNISLSVSVLKGLFQAYDFCCANMKLFFKDRP-PVPWEFPSSLAFSRMNSFFHRVQTIEDLYKTAIEFLKLEKIELGGVWGNILGNLVTQIYDEVFELVKVFAECKYDPLDPGDSSFDDDYSDFETKIQDLDRRLATIFCQAFDDCNCMESSAKLLYMCGGLLERPLILVEVVPRYSVMLEMFNTELDNAKLMYDAQMAASADGQIPPIHKNMSPVSGQLKWSLELQERLEVSMKYLKHIEHPVMSSMEAKLIYDKYDEMMGLLQSCRMKKYQQWVEGVDQDCHFNLGQPLIQRDPFTSLIQVNFSKALVAVLREVKYLNFQQQKEIPESAEKLFSENETFRKFVGNLELIVGWYNEIKTTVKDVEFPLIKSELEAIDVKLLSAETTLFWNGE----NVMEYIQEMREMLYNLQNRIQKAKQNVEGITQAMQEWSANPLFERKDNKKEALLDLDGRVANLNKRYAAVKEAGVRIQAMVVENAELFRADTTSQSWKDYVNYIDTVVLDEFDRFIRKSLNYLMDNMTMDESIAPLFEIRMELDKDGLTYNPSLEMGDEAGFLSLIEGLINDLYNVARLIPRLAKGRL--NYKSDLEDITDLIEMREEVSSLVIGAMKVAEEYQDSFERYSYLWVDDLQEFMKNFLIFGHAPTPEELDTKTDDTIP---KTPPTLAQFQQQIDSYEKLYEEVSSCENTKVFHGWLQCDCRPFKQTLLNTIKRWSFLFKRYLNNHVINSLADLESFMNITRTALKKPLKEGDYDGLVEVMGHLMKVKERQVATDSMFEPLKQTIELLKSYGEEMPEEIYLKLQELPEQWTNTKKLAIQVKQNVAPLQANEVNILRRKCQQFELKQHEFREKFRRDAPFSFSDPEPYKSLNKIYL----LYGVMEALCKSASLFEVTVPDYKQLKACHREVRLLKELWDMIVMVNTSIDDWKTTKWKDINVEQMDIDCKKFAKDVRSLDKEMKPWDAFVGLDNTVKNMITSLRAVSELQNPAIRDRHWQQLMQATQVKFEMSEETTLADLLQLNLHKYEDEVRNIVDKAVKESGMEKVLKTLDITWTTMEFEHELHPRTGTMMLKSDEVLVETLEDNQVQLQNLMMSKYLSHFLKEVTSWQQKLSTADSVISIWFEVQRTWSHLESIFIGSEDIRAQLPEDSKRFDAIDQEFKALMEDAVKTPNVVEATNKPDLYNKLENLKMSLAVCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKLKFRLDASGKPLKFGLGMYSKEDEFVDFDKECDLSGQVEVWLNRVLDRMRATLRHEIPEAVVTYEEKPREQWIFDYPAQ-------IWWTTEVGLAFARLEEGYENAIKDYNKKQISQLNALITLLIGNLTAGDRMKIMTICTIDVHARDVVAKMIT--VESSQAFTWQSQLRHRWDEEKKHCFANICDAQIKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDLGRALGTMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVIAVQVKCVQDAIRAKKKKFNFLGEIISLVPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLDARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPTRAEDQVLMRALRDFNIPKIVTDDLPVFMGLIGDLFPALDVPRKRDLNFEKIIKQSIVELKLQAEDSFVLKVVQLEELLQVRHSVFVIGNAGSGKSQVLKSLNKTYQNLKRKPVAVDLDPKAVTCDELFGIINPATREWKDGLFSTIMRDLANLTHEGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNRTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPVVSSWIERRKVQSEKANLIILFDKYLPTCLDKLRIGFKRITPVPEITVIQTILYLLECLLTEKNAPPDSPKELYELYFVFACFWAFGGAMFQDQLIDYRVEFSKWWINEFKTIKLPSQGTIFDYYIDPETKKFLPWTDKVPNFELDPDIPLQASLVHTTETIRIRYFIDLLMEKAWPVMLVGNAGTGKSVLMGDKLENLSTDDYLVQAVPFNFYTTSAMLQGVLEKPLEKKSGRNYGPPGTKKLIYFIDDMNMPEVDKYGTVAPHTLIRQHMDHRHWYDRQKLTLKDVHNCQYVACMNPTSGSFTIDPRLQRHFCVFAVSFPGQEALTSIYNTILAQHL-SFRSAPLVIQRLSSHLVTAALALHQKVSATFLPTAIKFHYIFNLRDLSNIFQGILFSTAEILKTPLDLVRLWLHEAERVYGDKMVDEKDQETLHRVTIASVKKFFDDLGEENLFAKPNIFCHFTQGIGDPKYFPVTDVAQLNKLLKDVLDSYNEVNAVMNLVLFEDAVAHICKINRILESPRGNALLVGVGGSGKQSLSRLAAYISALDVFQITLKKGYAIPDLKMDLATQYIKSAVKNVPSVFLMTDSQVAEEQFLVLINDLLASGEIPGLFGDEDLENIISSMRPQVKSLGIADTREACWKFFIEKVRRQLKVILCFSPVGSVLRVRARKFPAVVNCTAINWFHEWPEDALVSVSARFLEETEGIEPEVKTSISLFMAYVHTTVNEMSKIYLTIERRYNYTTPKTFLEQIKLYQNLLAKKRMELVAKIERLENGLMKLQSTASQVDDLKAKLAVQETELKQKNENADKLIQVVGVETEKVSKEKAIADEEEMKVEVINKNVTEKQKACETDLAKAEPALLAAQEALDTLNKNNLTELKSFGSPPDAVVNVTAAVMILTAPGGKIPKDKSWKAAKI-MMGKVDTFLDSLKKFDKEHIPEACLKAFKPYQGNPTFDPEFIRSKSTAAAGLCSWCINIVRFYEVYCDVAPKRQALEEANAELAEAQEKLSRIKNKIAELNANLSNLTSAFEKATAEKIKCQQEADATNRVISLANRLVGGLASENVRWAESVENFKSQGVTLCGDVLLISAFVSYVGYFTKKYRNELMEKFWIPYINKLKVPIPITEGLDPLTLLTDDADVATWNNQGLPSDRMSTENATILCNTERWPLIVDAQLQGIKWIKNKYGSDLQAIRLGQKSYLDIIEQAISAGDTLLIENIGETVDPVLDPLLGRNTIKKGRFIKIGDKEVEYHPSFRLILHTKYFNPHYKPEMQAQCTLINFLVTRDGLEDQLLAAVVAKERPDLEQLKANLTKSQNEFKIVLKELEDSLLARLSAASGNFLGDTALVENLETTKHTANEIEEKVQEAKITEVKINEARENYRPAAERASLLYFILNDLNKINPIYQFSLKAFNVVFEKAIQKTAPADEVKQRVINLTDEITYSVYMYTARGLFERDKLIFLAQVTFQVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQSWGGIKALSEMDEFKNLDSDIEGSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCMRPDRMTYAVKNFVEEKMGSKFVEGRSVEFSKSYKESSPSTPIFFILSPGVDPLKDVEALGKKLGFTIDNGKLHNVSLGQGQEVVAENALDVAAEKGHWVILQVRGSLPQNIHLVARWLGILDKKVERYSSGSHEDYRVFISAEPAPTAETHIIPQGILENAIKITNEPPTGMYANLHKALDLFTQDTLEMCTKEIEFKCILFALCYFHAVVAERRKFGAQGWNRSYPFNNGDLTISINVLYNYLEANSKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLAEYIRVEMLEGEVLLAPGFQIPPNLDYKGYHEYIDENLPPESPYLYGLHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAGTGVSREEKVKAVLDDILEKIPETFNMAEIMAKAA--EKTPYVVVAFQECERMNILTNEMRRSLKELNLGLKGELTITTDMEDLSTALFYDTVPDTWVARAYPSMMGLAAWYADLLQRIRELESWTTDFALPTTVWLAGFFNPQSFLTAIMQSMARKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQTGVIAEARLKDLTPVMPVIFIKAIPVDRMETKNIYECPVYKTRIRGPTYVWTFNLKTKEKAAKW 4442          
BLAST of DNAHb-1 vs. Ensembl Mouse
Match: Dnah17 (dynein, axonemal, heavy chain 17 [Source:MGI Symbol;Acc:MGI:1917176])

HSP 1 Score: 5546.86 bits (14388), Expect = 0.000e+0
Identity = 2817/4486 (62.80%), Postives = 3477/4486 (77.51%), Query Frame = 1
Query:  127 LKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLP--VGSEKVSEGDINSFGEVP----RSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKG---ETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHV--SGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQI--EGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLL--KTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVL-------QNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREER----------------------------IKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            LK K+DK+ KL   +E   ++ +FF+K +   + VL     G +     FP +LKSK  +F K   E+I++D  +   LI+GDIS T +DQ  + V+EV+  +L+ ++N + WP V+S D+++  + LK++  V+ G+ KGKTLLP+P  +GS    +G ++S   +P     S++++IET++I+W+HQI DVLSK S++ L+ GL+P P VE ++W  R  NL+CI+EQL  PKV K+  +LE   S Y P  ++++ +V   LKE+  I LYL PLR  LEE+EQ +F+ +   I  +   +C IWA  + Y  P R++V+ +E  N II    +YL P E+ KG   E EE L  +  S+ +L    ++++     +K +FKD   PV W+F S+L F R+NSF  R++ ++ +    +EF KLEK+E+ G+ G  L   +  +++E   + K F E  YD LDP ++ F  DY  F+  I DLDRRLAT   QAF DC+C ++  KL+ + GGLL+RP++ +E   RY  +++M + E++N KL+YD  +  S + ++P IHKNM  V+G+L+W  E++ER++  +    H++H    + E  L+  K+DE++ LL+   MK Y  W+ GVD+ C FNL QPL+ R+  T  I VNF   L AVLREVKYL    Q+EIP+SA  + S+N+T RK++ NL+L+V WYN ++     VE PLI++EL  ID +L  A T L WN +       +YI+++R++++NL++R+ K+K+N++ I   M  W  +PLFERK+ K + LL+LD R    NKRY  + EAG R+  +V EN+EL +AD+ S+ WK YV+ ID ++++ F   I  SL Y++D +  + S  PLFE+ M+L  + + + PSL+      F  L++ L+ D++  A  + RLA G    +Y++DLE+  +L + R E+S     A + A+ YQ  F+ YS LW D+ +EFM  FL +G A + EEL+   +  I    + PPTL QF+ QID YEK +EE+       +   W + DCR FKQ  LNTIKRWS +FK++L +HV NSL +L  F+ IT + L K   EGD++GLVE+MGHL  VKERQ ATD MFEPLKQTI+LLK+Y +EMP+E++L+L+ELPE+W NTKK+A+ VKQ VAPLQ  EV  +RRKC  F++KQH FRE+FR+  PF+FS  E Y+ L++    IS +E  ME L +SA+LFEVTVP++KQLK C +E+RLLK LWD I +VN+SI+ WK T WKDINVEQMD DCK FAK +RSLDKEM+ WDA+ G+++ +KNM+TSLRAV+ELQNPAIRDRHW QLM AT+VKF+M+E TTL DLL+LNLH +EDEVR+IV+KAVKE  MEKVLK L  TW+ MEFEHE H RTG  +LK+ E L+ETLE++QV+LQN+M SKY+SHF  EV SWQ+ LSTAD VI IWFEVQRTWSHLESIFIGS+DIR QLPEDS+RFD ID +FKAL+ +  +T NVV+AT KP LY +LE ++  L +CEKALAEYLETKRLAFPRFYFVSSADLLDILSNGN P  V +HL+KLFDSL KLKF  +A  +  K G+ MY+K+ E V+F   CDL GQVE WLNR+L+ MR T+R  + E+V + EEK R+QWIF++PAQ       I W TEV L+FARLEEGYENA+KD+NKKQI+QLNALITLLIG L+  DR K+MTICTIDVH RDVV K+IT  +++SQ+FTW  QLRHRW +  K C+ NICDAQ +Y++EYLGNTPRLVITPLTDRCYITLTQSLHL M GAPAGPAGTGKTETTKDLGRALG MVYVFNCSEQMDYKS GNIYKGLAQ+G+WGCFDEFNRISVEVLSV+AVQVKC+QDAI+ K+K+F+FLGE ISL   +GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFL AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DP R EDQVLMRALRDFNIPKIVTDD PVFMGLIGDLFPALDVPRKRD  FEK ++Q+ ++LKLQAE++FVLKVVQL+EL  VRHSVFV+GNAG+GKS V K+L KTY NLK+KP+AVDL+PKAVT DELFGIINP+TREWKDGLFS IMRDLANLT +GPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPL  TMRL+FEISHL+TATPATVSRAGILYINP DLGW P V+SWI  R++QSE+ANL ILFDKY+P CL+ L++ FK+ITP+ EI+ +Q + +LLE LL  +N P D PKE YELYFVF   WAFG  MFQDQL+D+RVEF+KWW+ EFKTIKLP+QGT+FDYYID ETKKF PWT ++  FE+D + PLQA LV T+ET R RYF+DLL+EK  PVMLVG AGTGK+VL+ DKL ++  D+Y+V  VPFNFYTTS MLQ VLEKPLEKK+GRNYGP G+KKLIYFIDDMNMPEVDKY TV PHTLIRQH+D+ HWYDR KLTLK++HN QY+ACMNPT+GSFTI PRLQRHFCVFA+SFPGQE+L +IY+TIL++ L S  SA L+  +  S+LV  AL  H K+++TFLPTAIKFHY+FNLRDLSNIFQGILF+  + +K P DLVRLW+HE ERVY DK++D+ D ET  R+     KK F+++ E  +F KP ++CHF QGIG+PKY PV     L+K+LK+ L+SYNEVNA MNLVLFEDAVAHI +INRILESPRG ALLVGVGGSGKQSLSRLAA+IS+LDVFQITL+KGY I DLK+DLA  Y+K+ VKN+  VFL+TD+Q+A+E+FLVL+NDLLASGEI  LF D+++ENIISSMR +VKS G+ D+RE CW FFI KVR  L+++LCFSPVGS LRVRARKFPAVVNCT+I+WFHEWPEDAL+SVS RFL+E E +  + K S + FM++VH  VN++S  YL  ERRYNYTTPK+FLEQI LY N+L KK  EL  K+ RLENGL KL+STA QVDDLKAKLA QE EL+QKN +A++L++ V  +T+KVS EK IAD EE KV  I   V++KQ+ CE DLAKAEPAL AAQEAL+TLNKNNLTE+KSFG+PP AV++V+AA M L A  GK+PKD+SWKAAK  +MGK+D FLD+L  ++K++IPE  LKA K Y  +P F+PE I+SKS AAAGLCSW INI+ +YE++CDV PKR ALE AN EL EA EKLS I+NKI +L   L  L   FEKA ++K +CQ EAD T + I LANRLVGGLASENVRW + VE +K +  TL GDVL+  AF+SYVG FTK YR  LM+ +W+P++  L   IPIT+ LDPL +L DDA +A+WNN+GLPSDRMS ENATIL N ERWPLI+D QLQGIKWIK ++G+DL+ +RLGQK YLD+IEQA+SAGD +LIENI E++DPVLD LLGRNTIKKGR IK+GDKE EY+P FRLIL TK  NPHYKPEMQAQ T+INF VTRDGLEDQLLA VV KER DLE LK +LTK QN+FKI LKELEDSLL RLSAA GNFLGD ALVENLE  K TA EIEEKV++AKITEV INE RE YRPAA RAS+LYFILNDLNKINP+YQFSLKAF VVFEKAI +  P++E+K RV NL D IT+SVY+YT+RGLFE+DKLIF AQ++FQ+L   KE+NP ELDFLLRFP    + SP+DFL + SWGGIKALS ++EFKNLD DIEGSAKRWKK VESE PEKE FP+EWKNKT+LQ+LCM+R +RPDRMTYAV +FV+EK+G K+VEG  VEFS+S++ES P+TPIFFILSPGVDPLKDVE LGKKLGF+ DN    N+SLGQGQE+VAE A+D+ A++GHWV+L       QNIHLV++WL  L+KK+E Y+  SHE YRVFISAEP+ + E+HIIPQGILENAIKITNEPPTGM ANLHK+L+ F Q+T+EMC KE EFK ILFALCYFHAVV+ERRKFG QGWNRSYPFN GDL IS+NVLYNYLEANSKVPW+DLRYLFGEIMYGGHITDDWDR+LC+TYL EY++ EML+GE+ + PGF++PPN DYKGYH YIDE LP ESPYLYGLHPNAEI FLT  S+KLF+TV EMQP+++     TG+SREE+                            +K +LDDI+EK+P+ FNM EI AK    E+ PYVVVAFQECERMN+LT+E+RRSLKEL+LGLKGELTIT DME LS +L+ D +P++W  RAYPS+ GLA WYADLL RI+ELE WTTDF LP+ +WL G FNPQSFLTAIMQ MARKNEWPLD+M L  +VTKKN+EDM  PPR+G+YV+GLFMEGARWDTQ+G+IAEA+LK+L P MPVIFIKAIPVDR + +N+Y CPVYKT+ RGPT+VWTFNLKTKEK +KW
Sbjct:   17 LKFKADKWGKLIGAEENMALLTEFFDKID-NPVLVLTLNAAGMIIPCLGFPESLKSKGVYFIKMKPENITKDN-YKTHLIYGDISPTTVDQLIAVVEEVLYSLLNQSENMDGWPRVVSEDIVKQVHRLKNEMFVMGGKIKGKTLLPIPEHLGS---LDGTLDSMERIPSSMDNSLLHSIETIIIDWSHQIRDVLSKDSAQALLDGLHPLPRVEFEFWDARLMNLQCIHEQLNRPKVNKIVEILEKAKSCYWPALQNVYMNVTQGLKEANGIVLYLKPLRILLEEMEQADFTMLPSFIVKVLSTICFIWATSEHYNTPSRVIVILREFCNQIIEMTRTYLSPDEVLKGLQGEIEEVLGNISLSVSVLKGLFQAYDFCCANMKLFFKDRP-PVPWEFPSSLAFSRMNSFFHRVQTIEDLYKTAIEFLKLEKIELGGVWGNILGNLVTQIYDEVFELVKVFAECKYDPLDPGDSSFDDDYSDFETKIQDLDRRLATIFCQAFDDCNCMESSAKLLYMCGGLLERPLILVEVVPRYSVMLEMFNTELDNAKLMYDAQMAASADGQIPPIHKNMSPVSGQLKWSLELQERLEVSMKYLKHIEHPVMSSMEAKLIYDKYDEMMGLLQSCRMKKYQQWVEGVDQDCHFNLGQPLIQRDPFTSLIQVNFSKALVAVLREVKYLNFQQQKEIPESAEKLFSENETFRKFVGNLELIVGWYNEIKTTVKDVEFPLIKSELEAIDVKLLSAETTLFWNGE----NVMEYIQEMREMLYNLQNRIQKAKQNVEGITQAMQEWSANPLFERKDNKKEALLDLDGRVANLNKRYAAVKEAGVRIQAMVVENAELFRADTTSQSWKDYVNYIDTVVLDEFDRFIRKSLNYLMDNMTMDESIAPLFEIRMELDKDGLTYNPSLEMGDEAGFLSLIEGLINDLYNVARLIPRLAKGRL--NYKSDLEDITDLIEMREEVSSLVIGAMKVAEEYQDSFERYSYLWVDDLQEFMKNFLIFGHAPTPEELDTKTDDTIP---KTPPTLAQFQQQIDSYEKLYEEVSSCENTKVFHGWLQCDCRPFKQTLLNTIKRWSFLFKRYLNNHVINSLADLESFMNITRTALKKPLKEGDYDGLVEVMGHLMKVKERQVATDSMFEPLKQTIELLKSYGEEMPEEIYLKLQELPEQWTNTKKLAIQVKQNVAPLQANEVNILRRKCQQFELKQHEFREKFRRDAPFSFSDPEPYKSLNK----ISAMEGVMEALCKSASLFEVTVPDYKQLKACHREVRLLKELWDMIVMVNTSIDDWKTTKWKDINVEQMDIDCKKFAKDVRSLDKEMKPWDAFVGLDNTVKNMITSLRAVSELQNPAIRDRHWQQLMQATQVKFEMSEETTLADLLQLNLHKYEDEVRNIVDKAVKESGMEKVLKTLDITWTTMEFEHELHPRTGTMMLKSDEVLVETLEDNQVQLQNLMMSKYLSHFLKEVTSWQQKLSTADSVISIWFEVQRTWSHLESIFIGSEDIRAQLPEDSKRFDAIDQEFKALMEDAVKTPNVVEATNKPDLYNKLENLKMSLAVCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKLKFRLDASGKPLKFGLGMYSKEDEFVDFDKECDLSGQVEVWLNRVLDRMRATLRHEIPEAVVTYEEKPREQWIFDYPAQ-------IWWTTEVGLAFARLEEGYENAIKDYNKKQISQLNALITLLIGNLTAGDRMKIMTICTIDVHARDVVAKMIT--VESSQAFTWQSQLRHRWDEEKKHCFANICDAQIKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDLGRALGTMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVIAVQVKCVQDAIRAKKKKFNFLGEIISLVPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLDARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPTRAEDQVLMRALRDFNIPKIVTDDLPVFMGLIGDLFPALDVPRKRDLNFEKIIKQSIVELKLQAEDSFVLKVVQLEELLQVRHSVFVIGNAGSGKSQVLKSLNKTYQNLKRKPVAVDLDPKAVTCDELFGIINPATREWKDGLFSTIMRDLANLTHEGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNRTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPVVSSWIERRKVQSEKANLIILFDKYLPTCLDKLRIGFKRITPVPEITVIQTILYLLECLLTEKNAPPDSPKELYELYFVFACFWAFGGAMFQDQLIDYRVEFSKWWINEFKTIKLPSQGTIFDYYIDPETKKFLPWTDKVPNFELDPDIPLQASLVHTTETIRIRYFIDLLMEKAWPVMLVGNAGTGKSVLMGDKLENLSTDDYLVQAVPFNFYTTSAMLQGVLEKPLEKKSGRNYGPPGTKKLIYFIDDMNMPEVDKYGTVAPHTLIRQHMDHRHWYDRQKLTLKDVHNCQYVACMNPTSGSFTIDPRLQRHFCVFAVSFPGQEALTSIYNTILAQHL-SFRSAPLVIQRLSSHLVTAALALHQKVSATFLPTAIKFHYIFNLRDLSNIFQGILFSTAEILKTPLDLVRLWLHEAERVYGDKMVDEKDQETLHRVTIASVKKFFDDLGEENLFAKPNIFCHFTQGIGDPKYFPVTDVAQLNKLLKDVLDSYNEVNAVMNLVLFEDAVAHICKINRILESPRGNALLVGVGGSGKQSLSRLAAYISALDVFQITLKKGYAIPDLKMDLATQYIKSAVKNVPSVFLMTDSQVAEEQFLVLINDLLASGEIPGLFGDEDLENIISSMRPQVKSLGIADTREACWKFFIEKVRRQLKVILCFSPVGSVLRVRARKFPAVVNCTAINWFHEWPEDALVSVSARFLEETEGIEPEVKTSISLFMAYVHTTVNEMSKIYLTIERRYNYTTPKTFLEQIKLYQNLLAKKRMELVAKIERLENGLMKLQSTASQVDDLKAKLAVQETELKQKNENADKLIQVVGVETEKVSKEKAIADEEEMKVEVINKNVTEKQKACETDLAKAEPALLAAQEALDTLNKNNLTELKSFGSPPDAVVNVTAAVMILTAPGGKIPKDKSWKAAKI-MMGKVDTFLDSLKKFDKEHIPEACLKAFKPYQGNPTFDPEFIRSKSTAAAGLCSWCINIVRFYEVYCDVAPKRQALEEANAELAEAQEKLSRIKNKIAELNANLSNLTSAFEKATAEKIKCQQEADATNRVISLANRLVGGLASENVRWAESVENFKSQGVTLCGDVLLISAFVSYVGYFTKKYRNELMEKFWIPYINKLKVPIPITEGLDPLTLLTDDADVATWNNQGLPSDRMSTENATILCNTERWPLIVDAQLQGIKWIKNKYGSDLQAIRLGQKSYLDIIEQAISAGDTLLIENIGETVDPVLDPLLGRNTIKKGRFIKIGDKEVEYHPSFRLILHTKYFNPHYKPEMQAQCTLINFLVTRDGLEDQLLAAVVAKERPDLEQLKANLTKSQNEFKIVLKELEDSLLARLSAASGNFLGDTALVENLETTKHTANEIEEKVQEAKITEVKINEARENYRPAAERASLLYFILNDLNKINPIYQFSLKAFNVVFEKAIQKTAPADEVKQRVINLTDEITYSVYMYTARGLFERDKLIFLAQVTFQVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQSWGGIKALSEMDEFKNLDSDIEGSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCMRPDRMTYAVKNFVEEKMGSKFVEGRSVEFSKSYKESSPSTPIFFILSPGVDPLKDVEALGKKLGFTIDNGKLHNVSLGQGQEVVAENALDVAAEKGHWVILQVRGSLPQNIHLVARWLGILDKKVERYSSGSHEDYRVFISAEPAPTAETHIIPQGILENAIKITNEPPTGMYANLHKALDLFTQDTLEMCTKEIEFKCILFALCYFHAVVAERRKFGAQGWNRSYPFNNGDLTISINVLYNYLEANSKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLAEYIRVEMLEGEVLLAPGFQIPPNLDYKGYHEYIDENLPPESPYLYGLHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAGTGVSREEKVGAVPVPEGSLGSEGSLGTIGLPGTGFQVKAVLDDILEKIPETFNMAEIMAKAA--EKTPYVVVAFQECERMNILTNEMRRSLKELNLGLKGELTITTDMEDLSTALFYDTVPDTWVARAYPSMMGLAAWYADLLQRIRELESWTTDFALPTTVWLAGFFNPQSFLTAIMQSMARKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQTGVIAEARLKDLTPVMPVIFIKAIPVDRMETKNIYECPVYKTRIRGPTYVWTFNLKTKEKAAKW 4470          
BLAST of DNAHb-1 vs. Ensembl Mouse
Match: Dnah9 (dynein, axonemal, heavy chain 9 [Source:MGI Symbol;Acc:MGI:1289279])

HSP 1 Score: 5540.7 bits (14372), Expect = 0.000e+0
Identity = 2783/4470 (62.26%), Postives = 3487/4470 (78.01%), Query Frame = 1
Query:   76 ELNDKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMM---LDFFEKPEIQHLFVLQAPGGG-----ALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINS---FGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVS--GNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSKD--PLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLG-SNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPL-LYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            E  D R   +G +V +SL+  +  + +   T E  +++   LD     + + L V+Q+  GG      L+   E P+  ++K  FF +   E     +    VL  GD+   PL+  +  + EVI+PVL+N KN   WP ++  D+  H ++LK    V+    KG+TLLPLPVGSEK+   D +S      + +S +YA+E+ VI+W+HQ+  VL ++SS+ L+ G NPTP VEL++WK+R  +LE IY QL + KVK MA LL+ + S+Y P FK +F+ V AAL E+Q+I+++L PL+  L+ +E VEF +++  + PL HV+CLIWA CK YR P R+ VL QEI NL+I    +YL P+++ + E EE+ +K++     L+ FK++F+  RE +  YFK+ +E   W F ++L+F RL+ F+ R+ +V+ +L   L+ N LEK+E SG++G +LSQ +  M EEF+ ++K F + +YDCLDP  T+F  D  +F   ++DLDRRL T + QAF D    +  FKL+DI G L+ RP++  +  ++Y  L++M   E++  +++Y  H+          +HKNMP + G + W +E+R+R+K P     ++ H   ++ E   +++K+++LL LL+++E + Y +W   V E   +NLS PLL R+ +T  +SVNF+ +L +VL+E+ YL+  + + IP++A  + S  +  R+ + NL+LM  WYN + K  L VE PL+E EL  ID +L  A   L W ++    G W Y  Q+ + +H+L  R+ K+K+N++ I+ IM  W  SP+F+RK+GK +  L+LDD++D   K Y  I E+G ++H LV+EN  L  AD  S  WK YV+ ID M+++ F   I  SL+Y+++  E      P+FE  ++L   E+VF PSLD        ++V SLVT IF   S V RL+  S    Y+ DLE+  +L   R+ + ER +        Y+    +YS L+ ++R+E + QFL YG  ++ EE+EAH E  I    E PP L  FK QID YEK +EE+  +    + D W R+D R FK + LNTIK+WSLMFKQHL+D VTNSL +L  FI+ T SGL K   +GDF+GLVE+MGHL  +KERQ +TD+MFEPLKQTI+LLK+Y QE+P+ V  QLEELPEKW N KK+A+TV+Q VAPLQ  EVA +R++C+ FD +Q  F+E+FRK  PF F  +  ++ LD  H+EI  +E  M  +++SA LFEV VP++KQL+QCRKE   LK LWD I +V SSI  W+ T W++I+VE MD +CK FA+ IR+LDKE RSWDA+TG+E  + N +TSLRAV ELQNPAIRDRHW QLM AT V F MN+ TTL  LL+L LH+FEDEVR IV++AVKEMSMEK LKEL +TW+ MEF++E H+RT + LL++ E+LIE LE++QV+LQN+M SKY++ F +EV SWQK LSTAD VI IWFEVQRTWSHLESIFIGS+DIR QLP+DS+RF+ ID+DF+ L  + ++T NVV+AT K  LYE+LE +QS L LCEKALAEYL+TKRL+FPRFYF+SS+DLLDILSNG +P+ V +HL+KLFD++AK++F  +A +  TK  + MY+K+ E V F+  CD  GQVE WLNR+L  M+ T+R  ++E V++ EEK RDQW+F++PAQVAL+ +QI W TEV ++FARLEEGYE+A+KD+ KKQ+ QL  LIT+LIG LSK DRQK+MTICTIDVH RDVV K+I QK+DN+Q+F WL QLRHRW D  K C+ NICDAQF Y++EYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKS GNIYKGLAQ+G+WGCFDEFNRISVEVLSVVAVQVK IQDAI++K++RF FLGEEISLD ++GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELI EIMLVAEGF++AR+LARKFITLY+LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DPDRPEDQVLMR+LRDFNIPKIVTDD PVFMGLIGDLFPALDVPRKRD +FE  VR+A +DLKLQAE+NFVLKVVQL+EL AVRHSVFV+G AGTGKS V ++L KTY  ++++P+  DLNPKAVTNDELFGIINP+TREWKDGLFS IMR+LA ++ DGPKWI+LDGDIDPMWIESLNTVMDDNKVLTLASNERIPL PTMRLLFEISHL+TATPATVSRAGILYINP DLGW P V+SWI  RE+Q+E+ANLTILFDKY+P CL+ L+ RFKKI P+ E S +QMLC+LLE LL  E+ PADCPKE YELYFVF AIWAFGS + QDQLVD+R EF+KWW+TEFKT+K P+QGTVFDYYID ETKKFEPW K + +FE D E PLQA LV TSET R  YF++ L++ RRPVMLVG AG+GK+VL+  KL+S+  + Y+V NVPFN+YTTS MLQ VLEKPLEKKAGRNYGP G++KLIYFIDDMNMPEVD Y TVQPHT+IRQH+DY HWYDR KL+LKEI N QY++CMNPTAGSFTI+PRLQRHF VFAL FPG ++L +IYSTIL+  L   NF  +L K++  L++LA+ FH KI +TFLPTAIKFHY+FNLRD +NIFQGILF+  +C+K   DLV+L++HE  RVY DK++++ D   + ++Q E  KK F++ +E++   + L +YCHFA GIGEPKYMPV+  + L++ L EALES+NEVNA M+LVLFEDA+ HI  INRILESPRG ALLVGVGGSGKQSL++LAAFISS+DVFQITLRKGY I D K+DLA+L +KAGVKN+  VFL+TDA +ADE+FLVL+NDLLASGEI DL+ D+E ENII+++RNEVKS G++DSRENCW FFI +V+  L++ LCFSPVG+ LR+R+RKFPA+VNCT+I+WFHEWP++AL SVS RFLQ  + +    K S +KFM+FVH +VNK S SYL NE+RYNYTTPKSFLE I LY ++L++   ELQ K+ RLENGL KL ST+ QVDDLKAKLA QEVEL  KN   ++L++ V  +T KVS EK IAD EE+KV+ I  EV +KQ+DCE DLAKAEPAL AAQ ALNTLNK NLTE+KSFG+PP AV +VSAA M LMA  GKVPKDRSWKAAK   M K+D+FLD+LI+++K+NI E  LKA + Y +DP FNPE + +KS AAAGLCSWVINI+ +YE+FCDV+PKR AL  A  +L  A EKL+ I+ KI  L + L KL  +FEKA ++K +CQ EA+LT  TI LANRLVGGLASEN+RW + V+ ++ +E+TL GD+L+T AF+SY+G FTK YR +LMD  W P+L+ L   IP T  LDPL+ML DDA +A+W NEGLP+DRMS+ENATIL N ERWPL++DPQLQGIKWIK ++G +L+V ++GQKG L  IE+A+ AGDVVLIEN+EES+DPVL  LLGR  IKKGR IK+GDKECE+NP+FRLIL TKLANPHY+PE+QAQ T+INFTVTRDGLEDQLLA VV+ ER DLE LK DLTKQQN FKITLK LED+LL RLS+A GNFLG+ ALVENLE  K+TA ++EEKV++AK+TEV INE RE YRPAAARAS+LYFI+NDL+KI+PMYQFSLKAF +VF+KA+++A PSE +  RV NLIDSITFSVY YT+RGLFE DKL + AQ++FQILL  +E+N  ELDFLLR P+     SP++FLS+ +WGGIKALS++EEF NLDRDIEGSAK WKKFVESE PEKEKFPQEWKNKT+LQRLCMMRA+RPDRMTYA+ DFV+EKLG KYV G  ++F  SFEESGPATP+FFILSPGVDPLKDVE  GKKLG++ +N+NF N+SLGQGQE+VAE A+DL AK+GHWV+LQNIHLV+KWLS LEKKLEE +EESH  +RVFISAEP+ SPE HIIPQGILEN+IKITNEPPTGM ANLHK+L+NF Q+T+EMC++E EFKTILFALCYFHAVV+ERRKFGPQGWNRSYPFNTGDL ISVNVLYN+LEAN+KVP++DLRYLFGEIMYGGHITDDWDR+LC+TYLEE+++PEML+GEL++ PGF +P N DY GYH YID  LP ESPYLYGLHPNAEI FLT  S+KLF+TV EMQPRDS      GI+REE++K  L++I++++ D+FN+ E+ AKV  EER PY+VVA QECERMN+LT EI+RSL+EL LGL+GELT+T++ME L N+LY+DV+PESW++RAYPS  GLA W+ DLL RIKELE WT DF +PS +WL G FNPQSFLTAIMQ MARKNEWPLD+MALQCDVTKKN+E+   PPR+GAY++GLFMEGA WDTQ+G+IAEAKLK+L P MPV+F+KAIP D+QD R+VYACPVYKT +RGPT+VWTFNLKTKE PSKW
Sbjct:   17 EPGDPRLRLLGTFVARSLRPAAGTWERCAGTAEAGRLLQAFLDHNAASDPRPLLVVQSGPGGLVVTPGLDAGPE-PSRARAKGLFFLRTKSEPPGNHSLRGTVLC-GDLPAVPLEHLAPLLSEVIIPVLANEKNHLEWPHMVCQDIRHHAHTLKSDLLVIFEHMKGRTLLPLPVGSEKLEFVDGHSEPVSDAIDKSTLYAVESAVIKWSHQVQVVLKRESSQALIQGQNPTPKVELEFWKSRCEDLEHIYNQLMTIKVKGMAELLDKLQSSYLPAFKAMFRDVEAALTEAQDIHVHLLPLQQHLDILENVEFPKVKGRLRPLLHVVCLIWATCKWYRSPGRLTVLLQEICNLLIQQASNYLSPEDLLRSEVEESQKKLQVVSDTLSFFKQAFQDRREHLHTYFKEDSEVRVWDFQASLVFVRLDGFLGRVHMVEDLLKTALDLNNLEKLEFSGLRGNSLSQKVQRMHEEFEEMYKVFLDCSYDCLDPKGTEFENDVCEFNKRVEDLDRRLGTILIQAFDDAPDVEHAFKLLDITGTLIKRPLVAQDVSQKYLALIRMFSTELDAVRVIYSQHIQKEAEHGFSPVHKNMPTMAGGICWAQELRQRVKGPFGNFKNIPHLYLQSAEGKRMIQKYEDLLSLLEEYERRLYEDWCQTVSEKSQYNLSLPLLHRDPNTKQLSVNFNPQLISVLKEMNYLQPSEVKTIPETAAAMFSSREFYRQLVANLELMANWYNKVIKILLEVEFPLVEEELQNIDLRLRAAEETLSWKTE----GIWDYAMQITNSIHDLEQRIQKTKDNVEEIQNIMKTW-VSPIFKRKDGKKEWPLSLDDQQDHMEKYYSLIQESGLKIHALVQENLVLFAADPASSIWKSYVNYIDSMLLDGFFLAIECSLKYLLENTECKPGLTPVFEAQLNLVTPELVFHPSLDSGVKGGLYDIVQSLVTRIFAMPSLVPRLSPHSGSPHYQGDLEDMADLAGLRSVLMERVQNMMTLCCGYRNTLSQYSYLYVEDRKEILGQFLLYGHVLTPEEIEAHAEDGIP---ENPPLLHHFKDQIDSYEKLYEEVVSLEPTKVFDGWMRVDVRPFKASLLNTIKKWSLMFKQHLVDFVTNSLSDLDSFIRSTESGLLKRVEKGDFQGLVEIMGHLVTLKERQSSTDDMFEPLKQTIELLKSYEQELPETVFKQLEELPEKWKNMKKMAITVRQQVAPLQANEVALLRQRCSAFDDEQQQFQERFRKEAPFRFDSINPHQMLDAWHVEIQHMESTMATISKSADLFEVNVPDYKQLRQCRKEACQLKELWDTIGMVTSSIRAWEATSWRNISVEAMDSECKQFARHIRNLDKEFRSWDAFTGLESTVLNTLTSLRAVAELQNPAIRDRHWRQLMQATGVNFTMNQDTTLAHLLQLQLHHFEDEVRGIVDRAVKEMSMEKTLKELQTTWASMEFQYESHARTRVPLLQSDEDLIEVLEDNQVQLQNLMMSKYVAFFLEEVSSWQKKLSTADSVISIWFEVQRTWSHLESIFIGSEDIRAQLPQDSKRFEGIDSDFRELAYDAQKTPNVVEATNKSGLYEKLEDIQSRLCLCEKALAEYLDTKRLSFPRFYFLSSSDLLDILSNGTAPQQVQRHLSKLFDNMAKMQFQLDASQNPTKTSLGMYSKEEEYVAFSEACDCSGQVEIWLNRVLRHMKATVRHEMTEGVTAYEEKPRDQWLFDYPAQVALTCTQIWWTTEVGIAFARLEEGYESAMKDYYKKQVAQLKTLITMLIGPLSKGDRQKIMTICTIDVHARDVVAKMIAQKVDNAQAFLWLSQLRHRWDDEAKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKQRFSFLGEEISLDPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELISEIMLVAEGFIEARLLARKFITLYRLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPDRPEDQVLMRSLRDFNIPKIVTDDMPVFMGLIGDLFPALDVPRKRDLDFEAVVRKAIVDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGGAGTGKSQVLRSLHKTYQIMRRRPVWTDLNPKAVTNDELFGIINPATREWKDGLFSSIMRELAIISHDGPKWILLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLLFEISHLRTATPATVSRAGILYINPADLGWNPPVSSWIDQREVQTERANLTILFDKYLPTCLDTLRTRFKKIIPVPEQSMIQMLCYLLECLLTKEDIPADCPKEIYELYFVFAAIWAFGSAVIQDQLVDYRAEFSKWWLTEFKTVKFPSQGTVFDYYIDPETKKFEPWAKLIPQFEFDPEMPLQACLVHTSETIRVCYFMERLMQWRRPVMLVGPAGSGKSVLVGAKLSSLNPEEYMVKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGNRKLIYFIDDMNMPEVDAYGTVQPHTVIRQHLDYGHWYDRNKLSLKEIMNVQYISCMNPTAGSFTINPRLQRHFSVFALCFPGADALSSIYSTILTHHLKFGNFPTTLQKSIPPLINLAVTFHQKIATTFLPTAIKFHYIFNLRDFANIFQGILFSSVECVKSTQDLVKLYLHESSRVYRDKMVEEKDFNLFDKIQTEFLKKNFDDSEEVLKQTQNLNMYCHFANGIGEPKYMPVQSWDLLNQTLVEALESHNEVNAVMDLVLFEDAIRHICHINRILESPRGNALLVGVGGSGKQSLTKLAAFISSMDVFQITLRKGYQIPDFKVDLASLCLKAGVKNLSTVFLMTDAHVADERFLVLINDLLASGEIPDLYSDEEEENIINNVRNEVKSQGLMDSRENCWKFFIERVQRQLKVTLCFSPVGNKLRIRSRKFPAIVNCTAINWFHEWPQEALESVSLRFLQNTKNIEPAVKQSISKFMAFVHISVNKTSQSYLTNEQRYNYTTPKSFLEFIRLYQSLLERNGKELQAKVERLENGLLKLHSTSAQVDDLKAKLATQEVELRHKNEDTDKLIQVVGVETSKVSREKAIADEEEQKVALIMLEVQQKQKDCEEDLAKAEPALTAAQAALNTLNKTNLTELKSFGSPPLAVSNVSAAVMVLMAPGGKVPKDRSWKAAKI-TMAKVDSFLDSLIHFDKENIHENCLKAIRPYLQDPAFNPEFVATKSYAAAGLCSWVINIVRFYEVFCDVEPKRQALNKATSDLTTAQEKLAAIKAKITHLNENLAKLTTKFEKATAEKLKCQQEAELTAGTISLANRLVGGLASENIRWAEAVQNFRQQERTLCGDILLTTAFISYLGFFTKKYRKSLMDGTWRPYLSQLKVPIPTTPTLDPLRMLTDDAEVAAWQNEGLPADRMSMENATILINCERWPLMVDPQLQGIKWIKNKYGEELRVTQIGQKGCLQTIERALEAGDVVLIENLEESIDPVLGPLLGREVIKKGRFIKIGDKECEFNPKFRLILHTKLANPHYQPELQAQATLINFTVTRDGLEDQLLAAVVSMERPDLEQLKSDLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGETALVENLEVTKQTAADVEEKVQEAKLTEVKINEAREHYRPAAARASLLYFIMNDLSKIHPMYQFSLKAFSIVFQKAVEKAAPSESVTERVTNLIDSITFSVYQYTTRGLFECDKLTYLAQLTFQILLVNQEVNAAELDFLLRAPVQTGTPSPMEFLSHQAWGGIKALSSMEEFCNLDRDIEGSAKSWKKFVESECPEKEKFPQEWKNKTALQRLCMMRAMRPDRMTYAMRDFVEEKLGSKYVMGRALDFVTSFEESGPATPMFFILSPGVDPLKDVENQGKKLGYTFNNRNFHNVSLGQGQEVVAEAALDLAAKKGHWVILQNIHLVAKWLSTLEKKLEELSEESHPDFRVFISAEPAPSPEGHIIPQGILENSIKITNEPPTGMHANLHKALDNFTQDTLEMCSRETEFKTILFALCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNFLEANTKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIRPEMLEGELSLAPGFPLPGNMDYSGYHQYIDAELPPESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDSQAGDGAGITREEKVKTFLEEILDRMTDEFNIAELMAKV--EERTPYIVVALQECERMNILTREIQRSLRELHLGLQGELTMTSEMENLQNALYLDVVPESWARRAYPSTAGLAAWFLDLLNRIKELESWTGDFLMPSTVWLTGFFNPQSFLTAIMQSMARKNEWPLDQMALQCDVTKKNREEFRSPPREGAYIYGLFMEGACWDTQTGIIAEAKLKDLTPPMPVMFLKAIPADKQDCRSVYACPVYKTCQRGPTYVWTFNLKTKENPSKW 4473          
BLAST of DNAHb-1 vs. Ensembl Mouse
Match: Dnah11 (dynein, axonemal, heavy chain 11 [Source:MGI Symbol;Acc:MGI:1100864])

HSP 1 Score: 5053.42 bits (13107), Expect = 0.000e+0
Identity = 2541/4458 (57.00%), Postives = 3295/4458 (73.91%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGEVP----RSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKI-HKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGS--KDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKE-YCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            D R  F+G  + ++L+   + + +   +D+ +Q++ DF E      L V      G L+   E P ++K K  +F KK  E++  ++ F++ ++FG+I  + L   ++F+DE+++PVLSN  N  SW   IS DV  HT  +K++  +  G+   +T LP+P  +E + + D +     P    R I++AIE++VI+W+HQI +++ K S+  L++GL+PTP  ELD+W  R  NL+CIY QL +P V KM  +L    S+Y P  K IF +V  AL E+Q++ L+L PLR  +  +++ EF +   +I PL H +CLIW+H K Y  P R++VL QE  NL I+   +YL P+++ KGE E+ALEKV+ ++ +L  F+ SF  +R+ +  YF    E   W F S+L+FGR N F+ R+  ++ +    LEF KLE++E  G KG  L+  I    EEF    K F + TYD  D  + +F  DY KFK+   D DRRL T + +  ++C   ++ FKL+ IFG  L++P++   F   Y  L+ M + E++  K +YD H+   E   +I +KNMP  +G ++W + + ER++   +  + L +    + +   V +K+ E+  LL + E   Y+ W   VDETC FNL+QPL+  +     +SVNFD KL AVLREVKYL +L + +IP SA  I  K + + KYI NL+L+V+ YN L++  L VE PLIE+EL  IDEQL  A T L W  D      W Y+E+V+     L  RV +++ N+ TI+  M  W + PL  R+E + +  L LDD+ D   K+YK I E G ++H LV+EN +L +AD   + WK YV+ IDD++VE F + I + L + +   E      P F+  M L   EIVF+P L+++  D F +LV+ ++   F+ ++++ R+A    + DY+ D++    L + R EI  R      K   +++  + YS LW D+R E + QFL YG A+ +EE++A   +DI     +PPTL+QFK QID YE  + ++ K + F + + WF++D R FK + LN IK+WS MF++HL+  V +SL EL  FIK TN+GL ++  EGD +GLV++MGHL  V+ RQ+ATDE+FEPLK+TI LL++Y Q+MP++V+ QLEELPE+W  TKK+A  V+  V+PLQN EV  IR+KC  FD KQ  FRE+FR   P  F     Y  LD+ + E+  LE+ ME++  SA LFEV +PE+KQ+KQCR+E+RLLK LWD I  V  SI+ W +T W+ INVEQMD + + FAK I SLDK +R WDAY+G+E  +K+M TSLRA+ ELQNPA+RDRHW QLM A  V+F +N+STTL DLL + LH  ED+VR IV++AVKE+  EKV+ ++  TW  +EF +E H RTG  LLK+ E+L ETLE +QV+LQ+++ SKY+ +F ++V SWQ  L+ AD VI  W +VQRTWSHLESIF+ S+DIR QL ED+ RFD++D +FK L+ E  +  NV++AT +P LYE+L+  Q  L LCEKALAEYLETKR+ FPRFYF+SSADLLDILS G  P+ V  HL KLFDS++ L+F    +    K  V M++K+ E V F   C+  G VE+WL +L + M+ T+R  ++E++++ EEK R+ WIF+FPAQVAL+ SQI W T+V ++F+RLEEGYE ALKDF+KKQI+QLN LITLL+GELS  DRQKVMTICTIDVH RDVV KLI+QK+ +  +FTWL QLRH W D+ K C +NICDA F+Y +EYLGN+PRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALG+MVYVFNCSEQMDY+SIGNIYKGL Q+G+WGCFDEFNRI+VEVLSVVAVQVK I DAI+N RKRF FLGE I L  ++GIFIT+NPGYAGRTELPENLKALFRPCAMV PD ELICEIMLVAEGF+ AR LARKFI+LY LC+ELLSKQDHYDWGLRAIKSVLVVAG+LKR D +RPEDQVLMRALRDFN+PKIVTDD PVF+GL+ DLFPALDVPR+R P FE+ V+Q+TL+L+LQ EE+F+LKVVQL+EL AVRHSVFV+GNAGTGKS + +TL +TY N+K+KP+  DLNPKAVT DELFG I+ +TREWKDGLFS I+R+ ANLT DGP WIVLDGDIDP+WIESLNTVMDDNKVLTLASNER+ L P+MRLLFE  HL+TATPATVSRAGILY+NPQDLGW P+V SWI  R  QSE+ANLTILFDKY+PVCLE L+  FK IT + E S VQ +C LLE LL PEN P D PKE YE+YF F  +W FG  + +DQL D++ +F++WW  E K +K P+QGT+FDYY+D +TKKF PWT ++ +F MD + PL+ VLV T ETTR RYF +LL+ K +P+MLVG AG GKTV L + L S+ +NY+V+ VPFN+YTTS  LQR+LEKPLEKKAGRNYGP G+KKL+YFIDD+NMPEVD Y T+QPH L+RQHIDY HWYDR K+ LKEI N QY+ACMNP  GSFT++PRLQRHF VFA +FP  ++L  IY  I S  L    F  S+L+   +L+   + FH  +  +F+PTAIKFHY FNLRDLSNIFQGILFA P+C+K   DL RLW+HE  RVY D+LID ND + +QR   E   K F+ +D   + ++PL+YCHFA G  +P YMPV+  E L  +L E +++YNE+++AM+LVLFEDA+ H+ RI+RIL  P+G+ALL+GVGGSGKQSLSRLAA+I SL+VFQITL +GYG  +L++DLA LY++ G KN+  VFLLTDA + DE FLVL+NDLLASG+I DLF D++M+ IIS +RNEV+  G++DSRENCWAFF+ +VR  L++V CFSPVG TLRVRARKFPA+VNCT+IDWFHEWP++AL+SVS RF++E+E +   +KDS + FM+ VH +V +VS  Y QNERRYNYTTP+SFLEQI+L+ ++LKKK  E++ K   L NG+QKL++TA QV +LK++LA+QE EL+ +N  A  L+ K+   T+KVS EK IAD EE KV+ I+ E S+KQ++CE DL KAEPAL AA++ALNTLN+ NLTE+K+F  PP AV +V+AA M L+A  G+VPKDRSWKAAK   MGK+D FL  LINY+K++IPE  LK   E Y KDP FNP  I++KS AAAGLC+WVINII +YE++CDV+PKR AL   N +L  ATEKL  ++ K+  L+  L +L   FEKA ++K RCQ+E + T KTI+LAN+LV  L SE +RWG+ ++ ++ +EKTL GDVL+T AF+SY+G FT+ YR  L+D  W+PFL      IPI + LD + ML DDA IA+WNNEGLPSDRMS ENATILT+ ERWPL+IDPQ QGIKWIK ++G DLKV  LGQKG+L+ IE A++ GDV+LIEN++E++DPVL  LLGRNT KKG+ I++GDKECE+N  FRLIL TKLANPHYKPE+QAQTT++NFTVT DGLE QLLA VV+ ER DLE LKL LTKQQN FKI L++LED LL RLSAAEG+FL D  LVE LE  K TA EIE KV +A+  E  INETRE YRP AARAS+LYF+++DL +INP+YQFSLKAF  +F +AI++A+  E+ + R+  LI+SIT + +LY S+ LFE+DKL F +QM+FQILL   EI+P ELDFLLRF +    +SP+DFL+  SW  +KA++ +EEF+ LDRD+EGSAK+W+K+VESE PEKEK PQEWK K+ +Q+L ++RA+RPDRMTYA+ +FV+EKLG KYVE   ++  ++FEES P+TP+FFILSPGVD LKD+E LGK+LGF+ D+  F N+SLGQGQE+VAE AM+  A  GHWV+LQN+HLV+KWL  LEK LE++++ SH  YRVF+SAE   S    IIPQG+LEN+IKITNEPPTGMLANLH +L NF+Q+T+EMC+K+ EFK+ILF+LCYFHA V+ R +FGPQGW+RSYPF+ GDL I  N+LYNYLEAN  VPWEDLRYLFGEIMYGGHITD WDRKLC+ YLEE++ P +++ E+ + PGF  PP +DY GYH YI++ LP ESP LYGLHPNAEIE LT  S+ LF+T+ EMQPR++      G S E+++K ILDDI+E+LP++FNM EI  K P   R+PYV+V FQECERMN+L  EIR SL+ LDLGLKGELT++ D+E   ++L  D +P++W+K AYPS YGLA W+ DLLLR +EL+ WT D  LP+V+WL G FNPQSFLTAIMQ MARKNEWPLDRM L  DVTKK KED G PPR+GAY+HGL +EGARWD QSG + +A+LKEL   MPVIF KA+PVDRQ++++ Y CPVYKTK RGPT+VWTF L++K++ +KW
Sbjct:   37 DPRVRFLGGRLRQALRFPEETWGQYLESDDHRQVLGDFLESTGPASL-VFSVATAGRLSASPEIPRDVKHKLVYFAKKMTENMG-ESDFSQTILFGEIPRSLLTHVTAFLDEILVPVLSNKNNHTSWSCFISQDVEHHTEVMKNKMHIFRGKMSRRTHLPIPTIAENI-DLDQHYLVTRPQSDERRILHAIESLVIKWSHQIQEIIEKDSAHPLLSGLHPTPETELDFWTMRHDNLKCIYSQLQAPIVLKMVKILRTRQSSYLPALKGIFTTVENALLEAQDVELHLRPLRRHIHSLQEAEFPQTRILIAPLLHTICLIWSHSKFYNTPARVIVLLQEFCNLFIDQARAYLSPEDLLKGEIEDALEKVQVAISVLKTFQNSFFKYRKGLTSYFTRNTEQRSWDFQSHLVFGRFNKFLDRLVKIEDMFVTILEFEKLERLEFGGSKGAVLNAQIHSTSEEFIECCKVFQQSTYDPSDCDDMEFESDYFKFKSRTLDFDRRLGTLLCEGLSNCSGLESAFKLLTIFGNFLEKPVVMEMFSPHYSTLLNMFNAELDVCKQLYDEHMKQIEHGHEILNKNMPFTSGNIKWARMLLERLQMFWSNFTSLHYLFPDSPDEAAVCQKYAEMTTLLDQFESHIYSEWRRNVDETCEFNLNQPLVKFSPINGLLSVNFDPKLVAVLREVKYLLMLKKSDIPDSALGIFQKRNIILKYIGNLELLVQGYNKLKQTLLEVEYPLIEDELGAIDEQLRVAATWLTWQDDF-----WVYMERVQVATAELECRVSQTQSNMLTIQQTMQAWAEWPLLPRRETRREAALTLDDKGDLFAKKYKLIREDGCKIHNLVEENRKLFRADPSLDSWKIYVEFIDDIVVEGFFQAILHDLDFFLRNTEKQLKPTPFFQAQMLLMPPEIVFKPPLEKEAGDGFYDLVEEMLCGSFRVSAQMGRVAAHLDIADYQNDMDNMLGLAEVRQEIMNRVADVINKVLEFRSSLETYSYLWVDDRVEILRQFLLYGHAVPSEEMDAPASEDIL----QPPTLEQFKEQIDIYEALYIQMSKFDDFRVFNSWFKVDMRPFKLSLLNVIKKWSWMFQEHLLRFVVDSLSELQGFIKQTNAGLQRQLCEGDHDGLVDIMGHLLAVRSRQRATDELFEPLKETIMLLESYGQKMPEQVYAQLEELPERWETTKKIAAMVRHEVSPLQNAEVTLIRKKCILFDEKQAEFRERFRSYAPLGFKAENPYAVLDKANQELEALEEEMEQMQNSARLFEVALPEYKQMKQCRQEIRLLKGLWDVIIYVRRSIDNWTETQWRQINVEQMDLELRRFAKEIWSLDKAVRVWDAYSGLEGTVKDMTTSLRAIAELQNPALRDRHWQQLMKAIGVRFSINDSTTLSDLLAVQLHRVEDDVRDIVDQAVKELGTEKVITDVSHTWEALEFSYEAHHRTGTPLLKSDEQLFETLEHNQVQLQSLLQSKYVEYFIEQVLSWQNKLNVADAVIFTWMQVQRTWSHLESIFVCSEDIRVQLVEDARRFDKVDAEFKELMFETAKVKNVLEATCRPHLYEKLKDFQHRLSLCEKALAEYLETKRVTFPRFYFISSADLLDILSKGAQPKQVTHHLVKLFDSISDLQFEDNLDVSTHK-AVGMFSKEKEYVPFQAGCECIGHVESWLLQLEQTMKDTVRLAITEAITAYEEKPRELWIFDFPAQVALTGSQIWWTTDVGIAFSRLEEGYETALKDFHKKQISQLNTLITLLLGELSPGDRQKVMTICTIDVHARDVVAKLISQKVVSPHAFTWLSQLRHEWEDSRKHCVVNICDAHFQYFYEYLGNSPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYRSIGNIYKGLVQTGAWGCFDEFNRIAVEVLSVVAVQVKMIHDAIRNGRKRFVFLGETIPLKPSVGIFITLNPGYAGRTELPENLKALFRPCAMVAPDTELICEIMLVAEGFVDARSLARKFISLYTLCEELLSKQDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVLMRALRDFNMPKIVTDDVPVFLGLVSDLFPALDVPRQRKPHFEQMVKQSTLELRLQPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKILRTLNRTYVNMKQKPVWSDLNPKAVTTDELFGFIHHATREWKDGLFSSILREQANLTHDGPTWIVLDGDIDPLWIESLNTVMDDNKVLTLASNERVALKPSMRLLFETHHLRTATPATVSRAGILYVNPQDLGWNPYVASWIDRRRHQSEKANLTILFDKYIPVCLEKLRTSFKAITSVPESSLVQTICTLLECLLTPENIPPDSPKETYEVYFAFACVWTFGGTLLRDQLSDYQADFSRWWHKEMKAVKFPSQGTIFDYYLDHKTKKFLPWTDKVPQFSMDADAPLKTVLVHTPETTRLRYFTELLLCKGKPIMLVGNAGVGKTVFLSNTLASLSENYIVSCVPFNYYTTSAALQRILEKPLEKKAGRNYGPKGNKKLVYFIDDLNMPEVDLYGTIQPHALLRQHIDYGHWYDRHKIMLKEIRNCQYVACMNPMVGSFTVNPRLQRHFTVFAFNFPSLDALTTIYGQIFSFYLQQQAFCPSVLRAGPSLIQATIAFHQMMAESFVPTAIKFHYNFNLRDLSNIFQGILFASPECLKSLEDLARLWLHETSRVYGDRLIDTNDFDLFQRKMLETAHKYFKGVDANALLRQPLVYCHFASGGEDPCYMPVKDWEGLKAVLMEMVDNYNELHSAMHLVLFEDAMQHVCRISRILRIPQGHALLIGVGGSGKQSLSRLAAYICSLEVFQITLTEGYGAQELRVDLANLYVRTGAKNMPTVFLLTDAHVLDESFLVLINDLLASGDIPDLFSDEDMDKIISGIRNEVRGLGLVDSRENCWAFFLARVRQQLKMVFCFSPVGHTLRVRARKFPAIVNCTAIDWFHEWPQEALVSVSRRFIEEIEGIEPQHKDSISLFMAHVHTSVKEVSAWYYQNERRYNYTTPRSFLEQISLFKSLLKKKREEVKQKQEHLGNGIQKLQTTASQVGNLKSRLASQEAELQLRNLDAEALITKIGLQTEKVSREKAIADAEERKVAAIQTEASQKQRECEADLLKAEPALVAAKDALNTLNRVNLTELKTFPNPPNAVTNVTAAVMVLLAPRGRVPKDRSWKAAKI-FMGKVDDFLQALINYDKEHIPENCLKVVNEQYLKDPEFNPNLIRTKSFAAAGLCAWVINIIRFYEVYCDVEPKRQALAQTNLDLAAATEKLEAVRRKLVDLDHNLSRLTASFEKATAEKVRCQEEVNQTNKTIDLANKLVSELESEKIRWGQSIKSFETQEKTLCGDVLLTAAFVSYIGSFTRQYRQELVDCKWIPFLQQKVS-IPIAEGLDLIAMLTDDATIATWNNEGLPSDRMSTENATILTHCERWPLMIDPQQQGIKWIKNKYGPDLKVTHLGQKGFLNTIETALAFGDVILIENLKETVDPVLGPLLGRNTTKKGKFIRIGDKECEFNKNFRLILHTKLANPHYKPELQAQTTLLNFTVTEDGLEGQLLAEVVSIERPDLERLKLVLTKQQNDFKIELRQLEDDLLLRLSAAEGSFLDDTDLVERLETTKATAAEIEHKVTEARENERKINETRECYRPVAARASLLYFVISDLRRINPVYQFSLKAFNTLFHRAIEQADKVEDTQERICALIESITHATFLYASQALFERDKLTFLSQMAFQILLRRNEIHPLELDFLLRFTVEHTYSSPVDFLTAQSWSAVKAVALMEEFRGLDRDVEGSAKQWRKWVESECPEKEKLPQEWKKKSLIQKLIILRAVRPDRMTYALRNFVEEKLGAKYVERTRLDLGKAFEESSPSTPVFFILSPGVDALKDLEVLGKRLGFTIDSGKFHNVSLGQGQELVAEMAMEKAAAGGHWVILQNVHLVAKWLGTLEKLLEKFSQGSHRDYRVFLSAETVPSQHEPIIPQGLLENSIKITNEPPTGMLANLHAALYNFDQDTLEMCSKDQEFKSILFSLCYFHACVAGRLRFGPQGWSRSYPFSPGDLTICTNILYNYLEANPNVPWEDLRYLFGEIMYGGHITDAWDRKLCRVYLEEFMNPSLIEDEVMLAPGFAAPPYSDYSGYHQYIEDTLPPESPALYGLHPNAEIELLTVTSNTLFRTLLEMQPRNAVSQEELGQSTEDKVKNILDDILERLPEEFNMAEIMQKNP--NRSPYVLVCFQECERMNVLIREIRVSLQHLDLGLKGELTLSPDVETQLSALSYDRVPDTWNKLAYPSTYGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGFFNPQSFLTAIMQTMARKNEWPLDRMCLTIDVTKKTKEDYGHPPREGAYLHGLHLEGARWDIQSGALVDARLKELTSMMPVIFAKAVPVDRQEIKHAYECPVYKTKARGPTYVWTFRLRSKDRIAKW 4477          
BLAST of DNAHb-1 vs. UniProt
Match: sp|P23098|DYHC_TRIGR (Dynein beta chain, ciliary OS=Tripneustes gratilla OX=7673 PE=1 SV=1)

HSP 1 Score: 6047.23 bits (15687), Expect = 0.000e+0
Identity = 3014/4465 (67.50%), Postives = 3646/4465 (81.66%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLK-SKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKV-----SEGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIH--VSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDH-----QAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIE--GSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGS-NFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            D R EFI +Y+LKS K K DK+ K  N +E K +ML+F EK +   L V      G +    EFP+ LK +KA +F KK +E + +D      L++GD+SYTPL+Q S+ VDE+++P+L+N +N E WP V+S DV+RH ++LK    VV GQ KGKTLLPLPVGSEKV     SE   +S+    RS+++AIE+V+I+W HQI DVL + S++ L+ GLNP P VE+++WK +  NL+CI++QL  PKV+KM  LLE   S+Y P F +I + V AAL E+Q+IN YL PL  Q+E ++++EF +M P + P+ H +CLIW++   Y    RI+VL QEI NL+I+ C ++LDP EIFK E EE+LEKV  +L +L  +++ ++ HR K+K+YFKDG E   W+FAS L+F R+++F SRIE ++ +    +EF+KLEK E+  +KGR LSQ +  + EEF+   K FTE+ YD LDP   +FL DY +F+  + DLDRRL + + Q F DC   +AVFK++D +G LLDRP+++ +F+ +Y  ++ + D E++  K +YD H  V  N+    ++KNMP V G+L+W  ++R+RI  P+    H++H     +  ++ +  +V +K++E++ LL K+E K + NW  GVDE C  NL Q L+ R+  T  I +NFD KL AVLREVKYL+I  +E IP+SA  I+ K++TLRKY+ NLDL   WYN +R   L VE PLIE +L  +D +L++A + L W SD++    W+YI++ RD VH+L  RV ++K+N+D I+ IM+ W K PLFERKE K ++LL LDDR+DR  KRY EI+ AGE++H L+KEN  L KAD+ S+ WK YVD +DDM+++ F   I+ +L Y+++  +      PLFE  ++LQ  +++F PSLD   AD F +LV+ L++D +K AS V RLA  +  E Y+ DLE  ++L   RN++ +R +    KA+ Y+  FD Y+ L+ D+R+EFM QFL Y   ++ EE+EAH E  +    E PPTLDQFK Q+D YEK + E +++    + D WFR+D + FK A LN IK+WS MFKQHLIDHVTNSL EL EFIK+ NSGL K   EGD+ GLVE MGHL  VKERQ ATDEMFEP+KQTI+LLKTY+QEM +EVH QL+ELPE+WNNTKK+A+TVKQ VAPLQ  EVA IRRKC +FDV+QH FRE+FRK  PF F+    Y+ LDR H EI  +E+ M  L ESA LFEV +P++KQLK CR+E+RLLK LWD I +V +SIE WK T W +INVEQM+ DCK FAK IRSLDKEMR+WDAY G++  +KNM+TSLRAV+ELQNPAIR+RHW QLMAATKVKF M++ TTL DLL LNLHNFEDEVR+IV+KAVKEM MEKVLKEL +TWS M+FE+E HSRTGI+LLK++EELIETLE++QV+LQN+MTSK+I+HF +EV  WQK LST D VI IWFEVQRTWSHLESIFIGS+DIR QLPEDS+RFD IDTDFK L +E+E+T NVV+AT + RLY+RLE +Q  LV+CEKALAEYLETKRLAFPRFYFVSSADLLDILS GN+P  V +HL+KLFD++AKLKF ++ E  +TK+ + MY+K+GE V+F   C+  GQVE WLNR+++ MR+T+R+  +++V S EEK R+QW++++PAQVAL+++Q+ W TEV +SFARLEEG+EN++KD+NKKQI QLN LI LLIG+L+K DRQK+MTICTIDVH RDVV  ++ +K+DN+Q+F WL QLRHRWAD DK CY NICDAQF+Y++EYLGNTPRLVITPLTDRCYITLTQSLHL MSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKS GNIYKGL+Q+G+WGCFDEFNRISVEVLSVVAVQVKC+QDAI++K++RF+F+GEEISL  ++GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFL AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DP RPEDQVLMRALRDFN+PKIV+DDTPVFMGLIGDLFPALDVPR+RD +FEK V+Q+TLDLKLQAE++FVLKVVQL+EL AVRHSVFV+GNAGTGKS V K L KTYSN+K+KP+ VDLNPKAVTNDELFGIINP+TREWKDGLFSVIMRD++N+T DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTP+MRLLFEISHLKTATPATVSRAGILYINP DLGW P V SWI TRE+QSE+ANLTILFDKY+P  L+ L++RFKKI PI E S VQMLC+LLE LL PENTPADCPKE YELYFVF +IWAFG  MFQDQLVD+RVEF+KWW+TEFKTIK P QGTVFDY+ID E+KKF PW++++  FE+D E P+QAVLV T+ETTR R+F+DLL+E+ RPVMLVG AG GK+VL+ DKL+++G++ +VANVPFN+YTTSEMLQRVLEKPLEKKAGRNYGP G+KKL+YFIDDMNMPEVD Y TVQPHTLIRQH+DY HWYDR KLTLKEIH  QY++CMNPTAGSFTI+ RLQRHFCVFALSFPGQ++L  IY++ILS+ L + + S +L K    +V   L+ H K+  +FLPTAIKFHYVFNLRDLSN+FQG+L++GPD +K P D  RLWMHE +RVY DK+I+D DIE +++L  E  KK FE++DE  +  KP ++CHFA GIG+PKYM V    +L+KIL EAL++YNE+NA MNLVLFEDA+ H+ RINRILESPRG ALLVGVGGSGKQSL+RLA++ISSL+VFQITLRKGYGI DLKLDLA + MKAG+KNIG VFL+TDAQ++DEKFLVL+NDLLASGEI DLF DDE+ENII  +RNEVK  G+ D+RENCW FFI+++R  L+ VLCFSPVG+TLRVR+RKFPAVVNCTSIDWFHEWP++AL+SVS RFL EVELL  D K S A+FM++VH +VN+ S  YL NERRYNYTTPKSFLEQI LY ++L  K  EL  KM RLENGL KL+STAQQVDDLKAKLA+QEVEL QKN  A++L++ V  +T+KVS EK IAD EE+KV+ I  EVSKK +DC  DLAKAEPAL AAQEALNTLNKNNLTE+KSFG+PP AV+ V+AA M L+A NGK+PKDRSWKAAK  +M K+DAFLD+LINY+K+NI E  LK+ KEY  DP F PE IK KSLAA GLCSWV+NI+ +Y ++CDV+PKR AL+ AN+EL+ A +KL+ I+ KI +L+  L +L  +FEKA SDK +CQ EA+ T +TI LANRLVGGLASENVRWG+ V  +KI+EKTLPGDVL+  AF+SY+GCFTK YR+ L +  WLPFL +    IPIT+ LD L ML DDA IA WNNEGLPSDRMS ENATIL+N +RWPL+IDPQLQGIKWIK ++G DL+V+R+GQ+GYLD IE A+S+GD VLIEN+EES+DPVLD +LGRNTIKKGR IK+GDKE EYNP+FRLILQTKLANPHYKPEMQAQTT+INFTVTRDGLEDQLLA VV +ER DLE LK DLTKQQN FKI LKELED+LL RLS+AEGNFLGD ALVENLE  KRTA EI  KVE+AK+TEV INE RELYRPAAARAS+LYFILNDLNKINP+YQFSLKAF  VF   I RAEP E++K RV NLID IT+SV++YT+RGLFE DKLIFT Q++FQ+LL  KEI   ELDFLLRFPI   LTSP+DFL+N++WG IK+LSA+E+F+NLDRDIEGSAKRWKKFVESE PEKEKFPQEWKNK++LQ+LCMMRALR DRM+YAV +F++EKLG KYVEG  VEF++S+EE+ PATP+FFILSPGVDPLKDVE LGKKLGF+ DN NF N+SLGQGQEIVAE+ MDL AKEGHWV+LQNIHLV+KWLS LEKKLE+Y+  SH+SYRV++SAEP+GSPE+HIIPQGILE++IKITNEPPTGM ANLHK+L NFNQ+T+EMCA+E EFK ILFALCYFHAVV ER+KFGPQGWNRSYPFNTGDL ISVNVLYNYLEANSKVPW+DLRYLFGEIMYGGHITDDWDR+LC+TYLEEY+ PEMLDGEL + PGF VPPN+DYKGYH YIDE LP ESPYLYGLHPNAEI FLT+ SD LFK V E+QPRD+ G G  G SREE+IK +LD+I+EKLP++FNM+EI AKV  E+R PYVVVAFQECERMNMLTSEIRRSLKELDLGLKGELTIT DME LSN+L++D IP +W KRAYPSL+GL  WYADLL RIKELE WT DF LP+V+WLGG FNPQSFLTAIMQ MARKNEWPLD+M LQCDVTKKNKED    PR+G+YVHGLFMEGARWDTQ+ MIA+A+LKEL P+MPVIFIKAIPVD+QD RN+Y CPVYKTK+RGPTFVWTFNLK+KEK +KW
Sbjct:    6 DPRLEFISEYILKSYKLKPDKWAKCINVEENKILMLEFLEKADNPQL-VFTVNAAGLITPSYEFPSALKNTKAIYFIKKGREPVGKDN-IKTTLVYGDLSYTPLEQLSALVDEILVPLLANPRNHEQWPVVVSQDVLRHVHNLKSSVYVVAGQVKGKTLLPLPVGSEKVETAAESEEKDDSYD---RSLVHAIESVIIDWTHQIRDVLKRDSAQPLLEGLNPGPMVEINFWKAKCENLDCIFQQLRDPKVRKMKELLERTQSSYLPSFNNIERDVEAALTEAQDINCYLKPLIYQVESLDELEFPDMTPRLAPILHTVCLIWSNSDYYNTAPRIIVLLQEICNLLIDLCRTFLDPSEIFKLEPEESLEKVRGALAVLKAWRDLYDEHRAKLKDYFKDGREVKGWEFASPLVFTRMDNFTSRIETIQSLFETNVEFSKLEKTEMGSMKGRMLSQQVEKIHEEFQECAKVFTERPYDGLDPQCQEFLDDYEEFEKKVFDLDRRLGSILCQGFDDCCGLEAVFKMLDCYGPLLDRPVIRNDFECKYPVVLMLYDLELDQAKEIYDEHMRVEENDGNAPLNKNMPDVAGQLKWSAQLRDRISKPMGSLKHMEHPTGVRRILESEDAKVVFQKYEEMINLLNKYEQKVFENWTKGVDEVCKTNLDQSLITRDESTKLIKINFDPKLVAVLREVKYLQIRGEESIPESAASIYEKHETLRKYVANLDLTQAWYNKVRNTVLEVEFPLIEGQLADLDTRLKQAESELNWTSDSV----WEYIQETRDQVHDLEKRVQQTKDNVDRIKKIMAEWTKQPLFERKELKKESLLALDDRQDRLKKRYAEISTAGEKIHSLIKENLGLFKADASSDIWKAYVDYVDDMVIDGFFNCIHCTLSYLLENTDPRHCAAPLFEARLELQVPDMIFNPSLDYGVADGFYDLVEMLISDTYKMASLVSRLAEHNGQEHYQADLEGMDDLSDVRNDLMDRVQTIMTKAQEYRNSFDNYAYLYVDDRKEFMRQFLLYNHVLTTEEIEAHAEDGVP---ECPPTLDQFKEQVDTYEKIYSEADEIEPEQVFDAWFRVDSKPFKAALLNIIKKWSFMFKQHLIDHVTNSLSELQEFIKVGNSGLTKTVEEGDYNGLVECMGHLMAVKERQAATDEMFEPIKQTIELLKTYDQEMSEEVHTQLQELPEQWNNTKKIAITVKQQVAPLQANEVAIIRRKCTSFDVRQHEFRERFRKEAPFIFTFEGPYQCLDRCHSEIYEMEEHMANLQESAGLFEVNMPDYKQLKACRREVRLLKALWDLIMIVRTSIEDWKTTPWLEINVEQMEMDCKKFAKDIRSLDKEMRAWDAYNGLDATVKNMLTSLRAVSELQNPAIRERHWQQLMAATKVKFTMDKETTLSDLLALNLHNFEDEVRNIVDKAVKEMGMEKVLKELNTTWSSMDFEYEPHSRTGISLLKSNEELIETLEDNQVQLQNLMTSKHIAHFLEEVSGWQKKLSTTDSVITIWFEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDTDFKELASEMEKTPNVVEATNRARLYDRLEAIQGSLVVCEKALAEYLETKRLAFPRFYFVSSADLLDILSQGNNPSQVQRHLSKLFDNMAKLKFKQDDEGNDTKLALGMYSKEGEYVDFDKECECTGQVEVWLNRVMDAMRSTVRSQFADAVVSYEEKPREQWLYDYPAQVALATTQVWWTTEVNISFARLEEGHENSMKDYNKKQIQQLNTLIGLLIGKLTKGDRQKIMTICTIDVHARDVVAMMVLKKVDNAQAFQWLSQLRHRWADDDKHCYANICDAQFKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLVMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLSQTGAWGCFDEFNRISVEVLSVVAVQVKCVQDAIRDKKERFNFMGEEISLIPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLDARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPQRPEDQVLMRALRDFNVPKIVSDDTPVFMGLIGDLFPALDVPRRRDMDFEKVVKQSTLDLKLQAEDSFVLKVVQLEELLAVRHSVFVIGNAGTGKSQVLKVLNKTYSNMKRKPVLVDLNPKAVTNDELFGIINPATREWKDGLFSVIMRDMSNITHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPSMRLLFEISHLKTATPATVSRAGILYINPSDLGWNPIVTSWIDTREVQSERANLTILFDKYLPTLLDTLRVRFKKIIPIPEQSMVQMLCYLLECLLTPENTPADCPKELYELYFVFASIWAFGGSMFQDQLVDYRVEFSKWWITEFKTIKFPNQGTVFDYFIDQESKKFLPWSEKVPVFELDPEIPMQAVLVHTNETTRVRFFMDLLMERGRPVMLVGNAGLGKSVLVGDKLSNLGEDSMVANVPFNYYTTSEMLQRVLEKPLEKKAGRNYGPPGTKKLVYFIDDMNMPEVDTYGTVQPHTLIRQHMDYKHWYDRQKLTLKEIHKCQYVSCMNPTAGSFTINSRLQRHFCVFALSFPGQDALSTIYNSILSQHLANISVSNALQKLSPTVVSATLDLHKKVAQSFLPTAIKFHYVFNLRDLSNVFQGLLYSGPDLLKAPIDFARLWMHECQRVYGDKMINDQDIEAFEKLVLEYAKKFFEDVDEEALKAKPNIHCHFATGIGDPKYMQVPNWPELNKILVEALDTYNEINAVMNLVLFEDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLASYISSLEVFQITLRKGYGIPDLKLDLATVCMKAGLKNIGTVFLMTDAQVSDEKFLVLINDLLASGEIPDLFADDEVENIIGGVRNEVKGMGLQDTRENCWKFFIDRLRRQLKTVLCFSPVGTTLRVRSRKFPAVVNCTSIDWFHEWPQEALVSVSMRFLDEVELLKGDIKKSIAEFMAYVHVSVNESSKLYLTNERRYNYTTPKSFLEQIKLYESLLSMKSKELTAKMERLENGLTKLQSTAQQVDDLKAKLASQEVELAQKNEDADKLIQVVGVETEKVSKEKAIADDEEKKVAIINEEVSKKAKDCSEDLAKAEPALLAAQEALNTLNKNNLTELKSFGSPPSAVLKVAAAVMVLLAPNGKIPKDRSWKAAKV-VMNKVDAFLDSLINYDKENIHENCLKSIKEYLNDPEFEPEYIKGKSLAAGGLCSWVVNIVKFYNVYCDVEPKRIALQKANDELKAAQDKLALIKAKIAELDANLAELTAQFEKATSDKLKCQQEAEATSRTITLANRLVGGLASENVRWGEAVANFKIQEKTLPGDVLLITAFVSYIGCFTKTYRVDLQERMWLPFLKSQKDPIPITEGLDVLSMLTDDADIAVWNNEGLPSDRMSTENATILSNCQRWPLMIDPQLQGIKWIKQKYGDDLRVIRIGQRGYLDTIENAISSGDTVLIENMEESIDPVLDPVLGRNTIKKGRYIKIGDKEVEYNPDFRLILQTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLANVVAQERPDLEKLKSDLTKQQNDFKIILKELEDNLLSRLSSAEGNFLGDTALVENLETTKRTAAEISVKVEEAKVTEVKINEARELYRPAAARASLLYFILNDLNKINPIYQFSLKAFNTVFSLPIARAEPCEDVKERVVNLIDCITYSVFIYTTRGLFEADKLIFTTQVAFQVLLMKKEIAQNELDFLLRFPIQVGLTSPVDFLTNSAWGAIKSLSAMEDFRNLDRDIEGSAKRWKKFVESECPEKEKFPQEWKNKSALQKLCMMRALRADRMSYAVRNFIEEKLGSKYVEGRQVEFAKSYEETDPATPVFFILSPGVDPLKDVEALGKKLGFTFDNNNFHNVSLGQGQEIVAEQCMDLAAKEGHWVILQNIHLVAKWLSTLEKKLEQYSVGSHDSYRVYMSAEPAGSPEAHIIPQGILESSIKITNEPPTGMFANLHKALYNFNQDTLEMCAREAEFKVILFALCYFHAVVCERQKFGPQGWNRSYPFNTGDLTISVNVLYNYLEANSKVPWQDLRYLFGEIMYGGHITDDWDRRLCRTYLEEYMAPEMLDGELYLAPGFPVPPNSDYKGYHQYIDEILPPESPYLYGLHPNAEIGFLTTESDNLFKIVLELQPRDAGGGGGGGSSREEKIKSLLDEIVEKLPEEFNMMEIMAKV--EDRTPYVVVAFQECERMNMLTSEIRRSLKELDLGLKGELTITPDMEDLSNALFLDQIPATWVKRAYPSLFGLTSWYADLLQRIKELEQWTADFALPNVVWLGGFFNPQSFLTAIMQSMARKNEWPLDKMCLQCDVTKKNKEDFSSAPREGSYVHGLFMEGARWDTQTNMIADARLKELAPNMPVIFIKAIPVDKQDTRNIYECPVYKTKQRGPTFVWTFNLKSKEKAAKW 4455          
BLAST of DNAHb-1 vs. UniProt
Match: sp|P39057|DYHC_HELCR (Dynein beta chain, ciliary OS=Heliocidaris crassispina OX=1043166 PE=1 SV=1)

HSP 1 Score: 6037.22 bits (15661), Expect = 0.000e+0
Identity = 3003/4463 (67.29%), Postives = 3645/4463 (81.67%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLK-SKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKV--SEGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHV---SGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDH-----QAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIE--GSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGS-NFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            D R +FI +Y+LKS K K DK+ K  N +E K +ML+F EK +   L     P G  +    EFP+ LK +KA +F KK +E + +D      L++GD+SYTPL+Q S+ VDEV++P+L+N +N E WP V+S DV+RH ++LK    VV GQ KGKTLLPLPVGSEKV  + G         RS+++AIE+V+I+W HQI DVL + S++ L+ GLNP P VE+++WK +  NL+CI++QL  PKV+KM  LLE   S+Y P F +I + V AAL E+Q+IN++L PL  Q+E ++++EFS++ P + P+ H +CLIW++   Y    R++VL QEI NL+I+ C ++LDP EIFK E EE+LEKV  +L +L  ++E ++ HR K+K+YFKDG E  EW+FAS L+F R+++F+ RIE ++ +    +EF+KLEK E+  +KGR LSQ +  + EEF+   K FTE+ YD LDP   +FL+DY +F+  + DLDRRL + + Q F DC   +A FK++D +G LLDRP+++ +F+ +Y  ++ + D+E++  K +YD H+     N   P ++KNMP V G+L+W  ++R+RI  P+    H++H     +  ++ +  ++ +K++E+L LL K+E K + NW  GVDE C  NL Q L+ R+  +  I VNFD KL +VLREVKYL+I  +E IP+SA  I+ K++TLRKY+ NLDL V WYN +RK  L VE PLIE +L  +D +L +A  +L W SD++    W+YI++ RD V +L  RV ++K+N+D I+ IM+ W K PLFERKE K ++LL LDDR+DR  KRY EIT AGE++H L+KEN +L KA++ S+ WK YVD +DDM+++ F   I+ +L Y+++  +      PLFE  ++LQ  +++F PSLD   AD F +LV+ L++D +K AS V RLA  +  E Y+ DLE  ++L   RN++ +R +    KA+ Y+  FD Y+ L+ D+R+EFM QFL Y   ++ EE+EAH E  +    E PPTLDQFK Q+D YEK + E +++    + D WFR+D + FK A LN IK+WS MFKQHLIDHVTNSL EL EFIK+ NSGL K   +GD+ GLV+ MGHL  VKERQ ATDEMFEP+KQTI+LLKTY+QEM +EVH QL+ELPE+WNNTKK+A+T+KQ VAPLQ  EVA IRRKC +FDV+QH FRE+FRK  PF F     Y+ LD+ H EI  +E+ M +L ESA LFEV +P++KQLK CR+E+RLLK LWD I VV +SIE WK T W +INVEQM+ DCK FAK IRSLDKEMR+WDAY G++  +KNM+TSLRAV+ELQNPAIR+RHW QLMAATKVKF M++ TTL DLL LNLHNFEDEVR+IV+KAVKEM MEKVLKEL +TWS M+F++E HSRTGI+LLK++EELIETLE++QV+LQN+MTSK+I+HF +EV  WQK LST D VI IWFEVQRTWSHLESIFIGS+DIR QLPEDS+RFD IDTDFK L  E+E+T NVV+AT K RL++RLE +Q  LV+CEKALAEYLETKRLAFPRFYFVSSADLLDILS GN+P  V +HL+KLFD++AKLKF ++ E  +TK+ + MY+K+GE V+F   C+  GQVE WLNR+++ MR+T+R+  +++V S EEK R+QW++++PAQVAL+++Q+ W TEV +SFARLEEG+EN++KD+NKKQI QLN LI LLIG+L+K DRQK+MTICTIDVH RDVV  ++ +K+D++Q+F WL QLRHRWAD DK CY NICDAQF+Y++EYLGNTPRLVITPLTDRCYITLTQSLHL MSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKS GNIYKGLAQ+G+WGCFDEFNRISVEVLSVVAVQVKC+QDAI++K++RF+F+GEEISL  ++GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFL+AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DP RPEDQVLMRALRDFN+PKIV+DDTPVFMGLIGDLFPALDVPR+RD +FEK V+Q+TLDLKLQAE++FVLKVVQL+EL AVRHSVFV+GNAGTGKS V K L KTYSN+K+KP+ +DLNPKAVTNDELFGIINP+TREWKDGLFSVIMRD++N+T DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTP+MRLLFEISHLKTATPATVSRAGILYINP DLGW P V SWI TRE+QSE+ANLTILFDKY+P  L+ L++RFKKI PI E S VQMLC+LLE LL PENTPADCPKE YELYFVF +IWAFG  MFQDQLVD+RVEF+KWW+TEFKTIK P QGTVFDYYID E+KKF PW++++  FE+D E P+QAVLV T+ETTR R+F+DLL+E+ RPVMLVG AG GK+VL+ DKL+++G++ +VANVPFN+YTTSEMLQRVLEKPLEKKAGRNYGP G+KKL+YFIDDMNMPEVD Y TVQPHTLIRQH+DY HWYDRAKLTLKEIH  QY++CMNPT+GSFTI+ RLQRHFCVFALSFPGQ++L  IY++ILS+ L +   S +L K    +V   L+ H K+  +FLPTAIKFHYVFNLRDLSN+FQG+L++G D +K P D  RLWMHE +RVY DK+I+D DIE +++L  E  KK FE++DE  +  KP ++CHFA GIG+PKYMP     +L+KIL EAL++YNE+NA MNLVLFEDA+ H+ RINRILESPRG ALLVGVGGSGKQSL+RLA++ISSL+VFQITLRKGYGI DLKLDLA + MKAG+KNIG VFL+TDAQ++DEKFLVL+NDLLASGEI DLF DDE+ENII  +RNEVK  G+ D+RENCW FFI+++R  L+ VLCFSPVG+TLRVR+RKFPAVVNCTSIDWFHEWP++AL+SVS RFL EVELL  D K+S A+FM++VH +VN+ S  YL NERRYNYTTPKSFLEQI LY ++L  K  EL  KM RLENGL KL+STAQQVDDLKAKLA+QEVEL QKN  A++L++ V  +T+KVS EK   D EE+KV+ I  EVSKK +DC  DLAKAEPAL AAQEALNTLNKNNLTE+KSFG+PP AV+ V+AA M L+A NGK+PKDRSWKAAK  +M K+DAFLD+LINY+++NI E   KA KEY  DP F PE IK KSLAA GLCSWV+NI+ +Y ++CDV+PKR AL+ AN+EL+ A +KL+ I+ KI +L+  L +L  +FEKA SDK +CQ EA+ T +TI LANRLVGGLASENVRWG+ V  +KI+EKTLPGDVL+  AF+SY+GCFTK YR+ L D  WLPFL +    IPIT+ LD L ML DDA IA WNNEGLPSDRMS ENATIL+N +RWPL+IDPQLQGIKWIK ++G +L+V+R+GQ+GYLD IE A+S+GD VLIEN+EES+DPVLD +LGRNTIKKGR IK+GDKE EYNPEFRLILQTKLANPHYKPEMQAQTT+INFTVTRDGLEDQLLA VV +ER DLE LK DLTKQQN FKI LKELED+LL RLS+AEGNFLGD ALVENLE  KRTA EI  KVE+AK+TEV INE RELYRPAAARAS+LYFILNDLNKINP+YQFSLKAF  VF  +I RAEP E++K RV NLID IT+SV++YT+RGLFE DKLIFT Q++FQ+LL  KEI   ELDFLLRFPI   LTSP+DFL+N++WG IK+LSA+E+F+NLDRDIEGSAKRWKKFVESE PEKEKFPQEWKNK++LQ+LCMMRALR DRM+YAV +F++EKLG KYVEG  VEF++S+EE+ PATP+FFILSPGVDPLKDVE LGKKLGF+ DN NF N+SLGQGQEIVAE+ MDL AKEGHWV+LQNIHLV+KWLS LEKKLE+Y+  SHESYRV++SAEP+GSPESHIIPQGILE++IKITNEPPTGM ANLHK+L NFNQ+T+EMCA+E EFK ILFALCYFHAVV ER+KFGPQGWNRSYPFNTGDL ISVNVLYNYLEANSKVPW+DLRYLFGEIMYGGHITDDWDR+LC+TYLEEY+ PEMLDG+L + PGF VPPN+DYKGYH YIDE LP ESPYLYGLHPNAEI FLT+ SD LFK V E+QPRD+ G G  G SREE+IK +LD+I+EKLP++FNM+EI  KV  E+R PYVVVAFQECERMN LTSEIRRSLKELDLGLKGELTIT DME LSN+L++D IP SW KRAYPSL+GL+ WYADLL RIKELE WT DF LP+V+WLGG FNPQSFLTAIMQ MARKNEWPLD+M LQCDVTKKNKED    PR+G+YVHGLFMEGARWDTQ+ MIA+A+LKEL P+MPVIFIKAIPVD+QD RN+Y CPVYKTK+RGPTFVWTFNLK+KEK +KW
Sbjct:    6 DARLDFISEYILKSYKLKPDKWTKCINVEENKILMLEFLEKADNPQLVFTVNPAG-LITPSYEFPSALKNTKAIYFIKKGREPVGKDN-IKTNLVYGDLSYTPLEQLSALVDEVLVPLLANPRNHEQWPVVVSQDVLRHVHNLKSSVYVVAGQVKGKTLLPLPVGSEKVETAAGSEEKDDSYDRSLVHAIESVIIDWTHQIRDVLKRDSAQPLLEGLNPGPMVEINFWKAKCENLDCIFQQLRDPKVRKMKELLERTQSSYLPSFNNIERDVEAALTEAQDINIHLKPLVYQIESMDELEFSDLTPRLAPILHTVCLIWSNSDYYNTAPRVIVLLQEICNLLIDLCRTFLDPSEIFKLEPEESLEKVRGALTVLKNWRELYDEHRAKLKDYFKDGKEVKEWEFASPLVFTRMDNFIRRIETIQSLFETNVEFSKLEKTEMGSMKGRMLSQQVEKIHEEFQECAKVFTERPYDGLDPTCQEFLEDYEEFEKKVFDLDRRLGSILCQGFDDCCGLEAAFKMLDCYGPLLDRPVIRNDFECKYPIVLMLYDQELDQSKEIYDEHMRVEEANGNAP-LNKNMPDVAGQLKWSAQLRDRISKPMGSLKHMEHPTGVRRILESEDAKVIFQKYEEMLNLLNKYEQKVFENWTKGVDEVCKTNLDQSLITRDDASKLIMVNFDPKLVSVLREVKYLQIRGEETIPESAASIYEKHETLRKYVANLDLTVAWYNKVRKTVLEVEFPLIEGQLADLDTRLRQAEADLNWTSDSV----WEYIQETRDQVRDLEKRVQQTKDNVDRIKKIMAEWTKQPLFERKELKKESLLALDDRQDRLKKRYAEITTAGEKIHSLMKENLDLFKAEASSDIWKAYVDYVDDMVIDGFFNCIHCTLTYLLENTDPRHCAAPLFEARLELQVPDMIFNPSLDYGIADGFYDLVEMLISDTYKMASLVNRLAEHNGQEHYQADLEGMDDLSDVRNDLMDRVQTIMTKAQEYRNSFDNYAYLYVDDRKEFMRQFLLYNHVLTTEEIEAHAEDGVP---ECPPTLDQFKEQVDTYEKIYSEADEIEPEQVFDAWFRVDSKPFKAALLNIIKKWSFMFKQHLIDHVTNSLSELQEFIKVGNSGLTKTVEDGDYNGLVDCMGHLMAVKERQAATDEMFEPIKQTIELLKTYDQEMSEEVHTQLQELPEQWNNTKKIAITIKQQVAPLQANEVAIIRRKCTSFDVRQHEFRERFRKEAPFIFLFDGPYQCLDKCHSEIYEMEEHMAKLQESAGLFEVNMPDYKQLKACRREVRLLKGLWDLIMVVRTSIEDWKTTPWLEINVEQMEMDCKKFAKDIRSLDKEMRAWDAYNGLDATVKNMLTSLRAVSELQNPAIRERHWQQLMAATKVKFTMDKETTLSDLLALNLHNFEDEVRNIVDKAVKEMGMEKVLKELNTTWSSMDFDYEPHSRTGISLLKSNEELIETLEDNQVQLQNLMTSKHIAHFLEEVSGWQKKLSTTDSVITIWFEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDTDFKELAAEMEKTPNVVEATNKARLFDRLEAIQGSLVVCEKALAEYLETKRLAFPRFYFVSSADLLDILSQGNNPTQVQRHLSKLFDNMAKLKFKQDDEGNDTKLALGMYSKEGEYVDFDKECECTGQVEVWLNRVMDTMRSTVRSQFADAVVSYEEKPREQWLYDYPAQVALATTQVWWTTEVNISFARLEEGHENSMKDYNKKQILQLNTLIGLLIGKLTKGDRQKIMTICTIDVHARDVVAMMVLKKVDSAQAFQWLSQLRHRWADDDKHCYANICDAQFKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLVMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCVQDAIRDKKERFNFMGEEISLIPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPQRPEDQVLMRALRDFNVPKIVSDDTPVFMGLIGDLFPALDVPRRRDLDFEKVVKQSTLDLKLQAEDSFVLKVVQLEELLAVRHSVFVIGNAGTGKSQVLKVLNKTYSNMKRKPVFIDLNPKAVTNDELFGIINPATREWKDGLFSVIMRDMSNITHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPSMRLLFEISHLKTATPATVSRAGILYINPSDLGWNPIVTSWIDTREVQSERANLTILFDKYLPTLLDTLRIRFKKIIPIPEQSMVQMLCYLLECLLTPENTPADCPKELYELYFVFASIWAFGGSMFQDQLVDYRVEFSKWWITEFKTIKFPNQGTVFDYYIDQESKKFLPWSEKVPTFELDPEIPMQAVLVHTNETTRVRFFMDLLMERGRPVMLVGNAGLGKSVLVGDKLSNLGEDSMVANVPFNYYTTSEMLQRVLEKPLEKKAGRNYGPPGTKKLVYFIDDMNMPEVDTYGTVQPHTLIRQHMDYKHWYDRAKLTLKEIHKCQYVSCMNPTSGSFTINSRLQRHFCVFALSFPGQDALSTIYNSILSQHLANIAVSNALQKLSPTVVSATLDLHKKVAQSFLPTAIKFHYVFNLRDLSNVFQGLLYSGSDLLKSPIDFARLWMHECQRVYGDKMINDQDIEAFEKLVFEYAKKFFEDVDEEALKAKPNIHCHFATGIGDPKYMPCATWPELNKILVEALDTYNEINAVMNLVLFEDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLASYISSLEVFQITLRKGYGIPDLKLDLATVCMKAGLKNIGTVFLMTDAQVSDEKFLVLINDLLASGEIPDLFADDEVENIIGGVRNEVKGMGLQDTRENCWKFFIDRLRRQLKTVLCFSPVGTTLRVRSRKFPAVVNCTSIDWFHEWPQEALVSVSKRFLDEVELLKGDIKNSIAEFMAYVHVSVNESSKQYLTNERRYNYTTPKSFLEQIKLYESLLAMKSKELTAKMERLENGLTKLQSTAQQVDDLKAKLASQEVELAQKNEDADKLIQVVGVETEKVSKEKATVDDEEKKVAIINEEVSKKAKDCSEDLAKAEPALLAAQEALNTLNKNNLTELKSFGSPPSAVLKVAAAVMVLLAPNGKIPKDRSWKAAKV-VMNKVDAFLDSLINYDEENIHENCQKAIKEYLNDPEFEPEYIKGKSLAAGGLCSWVVNIVKFYNVYCDVEPKRIALQKANDELKAAQDKLALIKAKIAELDANLAELTAQFEKATSDKLKCQQEAEATSRTITLANRLVGGLASENVRWGEAVANFKIQEKTLPGDVLLITAFVSYIGCFTKNYRVDLQDRMWLPFLKSQKDPIPITEGLDVLSMLTDDADIAVWNNEGLPSDRMSTENATILSNCQRWPLMIDPQLQGIKWIKQKYGDELRVIRIGQRGYLDTIENAISSGDTVLIENMEESIDPVLDPVLGRNTIKKGRYIKIGDKEVEYNPEFRLILQTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLANVVAQERPDLEKLKSDLTKQQNDFKIILKELEDNLLSRLSSAEGNFLGDTALVENLETTKRTAAEISVKVEEAKVTEVKINEARELYRPAAARASLLYFILNDLNKINPIYQFSLKAFNTVFSLSIARAEPCEDVKERVVNLIDCITYSVFIYTTRGLFEADKLIFTTQVAFQVLLMKKEIAQNELDFLLRFPIQVGLTSPVDFLTNSAWGAIKSLSAMEDFRNLDRDIEGSAKRWKKFVESECPEKEKFPQEWKNKSALQKLCMMRALRADRMSYAVRNFIEEKLGSKYVEGRQVEFAKSYEETDPATPVFFILSPGVDPLKDVEALGKKLGFTFDNNNFHNVSLGQGQEIVAEQCMDLAAKEGHWVILQNIHLVAKWLSTLEKKLEQYSIGSHESYRVYMSAEPAGSPESHIIPQGILESSIKITNEPPTGMFANLHKALYNFNQDTLEMCAREAEFKVILFALCYFHAVVCERQKFGPQGWNRSYPFNTGDLTISVNVLYNYLEANSKVPWQDLRYLFGEIMYGGHITDDWDRRLCRTYLEEYMAPEMLDGDLYLAPGFPVPPNSDYKGYHQYIDEILPPESPYLYGLHPNAEIGFLTTESDNLFKVVLELQPRDAGGGGGGGSSREEKIKSLLDEIVEKLPEEFNMMEIMGKV--EDRTPYVVVAFQECERMNTLTSEIRRSLKELDLGLKGELTITPDMEDLSNALFLDQIPASWVKRAYPSLFGLSAWYADLLQRIKELEQWTADFALPNVVWLGGFFNPQSFLTAIMQSMARKNEWPLDKMCLQCDVTKKNKEDFSSAPREGSYVHGLFMEGARWDTQTNMIADARLKELAPNMPVIFIKAIPVDKQDTRNIYECPVYKTKQRGPTFVWTFNLKSKEKAAKW 4455          
BLAST of DNAHb-1 vs. UniProt
Match: sp|Q9UFH2|DYH17_HUMAN (Dynein heavy chain 17, axonemal OS=Homo sapiens OX=9606 GN=DNAH17 PE=1 SV=3)

HSP 1 Score: 5630.06 bits (14604), Expect = 0.000e+0
Identity = 2830/4464 (63.40%), Postives = 3491/4464 (78.20%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLP--VGSEKVSEGDINSFGEVPRSI----IYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKG---ETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEK--VPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQ--IEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLG-SNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            D R E++ +     LK K DK+ KL   +E   +  +FFEKP++Q + VL     G +     FP +LKSK  +F K   E+I++D  +   L++GDIS TP+DQ  + V+EV+  +L+ ++N   WP V+S D+++  + LK++  V+ G+ KGKTLLP+P  +GS    +G + S   +P S+    ++AIET +I+W+HQI DVLSK S++ L+ GL+P P VE ++W TR  NL+CI+EQL  PKV K+  +LE   S Y P  ++++ +V   LKE+ +I LYL PLR  LEE+EQ +F+ +   I  +   +C IWA  + Y  P RI+V+ QE  N II    ++L P+E+ KG   E EE L  +  ++ +L +  ++++     +K +FKD  EPV W+F S+L F R+NSF  RI+ ++ +    +EF KLEK+E+ G++G  L   +  +++E   + K F +  YD LDP +++F +DY  F+  I DLDRRLAT   Q F DC C  +  KL+ + GGL++RP++  E   RY  ++++ D E++N K++YD  ++ +E+  +P IHKNMP V G+L+W  E++ER++  +    H++H      E  L  +K+DE++ELL+ H  K Y  W+ GVD+ C FNL QPL++R+  +  I VNF   L AVLREVKYL    Q+EIP SA  + S+N+T RK++ NL+L+V WYN ++     VE  LI++EL  ID +L  A T L WN +    G +QYI++VR+++HNL++R+ K+K+NI+ I   M +W  +PLFERK+ K + LL+LD R    NKRY  + +AG ++  +V EN+EL +AD++S  WK YV  IDDM+++ F + I  SL +++D   I+ S  PLFE+ M+L  + + F P+L+      F  L++ LV DI+  A  + RLA      +Y+ DLE+N +L + R E+S     A ++A+ YQ  F+ YS LWTDN +EFM  FL YG A++AE+L+   +  I    + PPTL QF+ QID YEK +EE+ K     +   W + DCR FKQA L+TI+RW  MFK+HL +HVTNSL +L  F+K+   GL K   EGD++GLVE+MGHL  VKERQ ATD MFEPLKQTI+LLKTY +EMP+E+HL+L+ELPE W NTKK+A+ VK TVAPLQ  EV+ +RRKC  F++KQH FRE+FR+  PF+FS    Y+ L+++   IS +E  ME L++S  LFEV VP++KQLK C +E+RLLK LWD + VVN+SIE WK T WKDINVEQMD DCK FAK +RSLDKEM++WDA+ G+++ +KN++TSLRAV+ELQNPAIR+RHW QLM AT+VKF M+E TTL DLL+LNLH++EDEVR+IV+KAVKE  MEKVLK L STWS MEF+HE H RTG  +LK+SE L+ETLE++QV+LQN+M SKY++HF  EV SWQ+ LSTAD VI IWFEVQRTWSHLESIFIGS+DIR QLP DS+RFD I+ +FKAL+ +  +T NVV+AT KP LY +LE ++  L +CEKALAEYLETKRLAFPRFYFVSSADLLDILSNGN P  V +HL+KLFDSL KLKF  +A ++  KVG+ MY+K+ E + F   CDL GQVE WLNR+L+ M +T+R  + E+V + EEK R+QWI ++PAQVAL+ +QI W TEV L+FARLEEGYENA++D+NKKQI+QLN LITLL+G L+  DR K+MTICTIDVH RDVV K+I  K+++SQ+FTW  QLRHRW +  + C+ NICDAQ +Y++EYLGNTPRLVITPLTDRCYITLTQSLHL M GAPAGPAGTGKTETTKDLGRALG MVYVFNCSEQMDYKS GNIYKGLAQ+G+WGCFDEFNRISVEVLSV+AVQVKC+QDAI+ K+K F+FLGE I L   +GIFITMNPGYAGR ELPENLKALFRPCAMVVPDFELICEIML+AEGFL+AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DP R EDQVLMRALRDFNIPKIVTDD PVFMGLIGDLFPALDVPRKRD  FEK ++Q+ ++LKLQAE++FVLKVVQL+EL  VRHSVF++GNAG+GKS V K+L KTY NLK+KP+AVDL+PKAVT DELFGIINP TREWKDGLFS IMRDLAN+T DGPKWI+LDGDIDPMWIESLNTVMDDNKVLTLASNERIPL  TMRL+FEISHL+TATPATVSRAGILYINP DLGW P V+SWI  R++QSE+ANL ILFDKY+P CL+ L+  FKKITP+ EI+ +Q + +LLE LL  +  P D P+E YELYFVF   WAFG  MFQDQLVD+RVEF+KWW+ EFKTIK P+QGT+FDYYID +TKKF PWT ++  FE+D + PLQA LV T+ET R RYF+DLL+EK  PVMLVG AGTGK+VL+ DKL S+  DNY+V  VPFNFYTTS MLQ VLEKPLEKK+GRNYGP G+KKL+YFIDDMNMPEVDKY TV PHTLIRQH+D+ HWYDR KLTLK+IHN QY+ACMNPT+GSFTI  RLQRHFCVFA+SFPGQE+L  IY+TIL++ L   + S ++ +  S LV  AL  H KI +TFLPTAIKFHYVFNLRDLSNIFQG+LF+  + +K P DLVRLW+HE ERVY DK++D+ D ET  R+    TKK F+++ + ++F KP ++CHFAQGIG+PKY+PV     L+K+L + L+SYNEVNA MNLVLFEDAVAHI RINRILESPRG ALLVGVGGSGKQSLSRLAA+IS LDVFQITL+KGYGI DLK+DLAA Y+KA VKN+  VFL+TD+Q+A+E+FLVL+NDLLASGEI  LF +DE+ENIISSMR +VKS GM D+RE CW FFI KVR  L+++LCFSPVGS LRVRARKFPAVVNCT+IDWFHEWPEDAL+SVS RFL+E E +P + K S + FMS+VH  VN++S  YL  ERRYNYTTPK+FLEQI LY N+L KK TEL  K+ RLENGL KL+STA QVDDLKAKLA QE EL+QKN SA++L++ V  + +KVS EK IAD EE KV  I   V++KQ+ CE DLAKAEPAL AAQEAL+TLNKNNLTE+KSFG+PP AV++V+AA M L A  GK+PKD+SWKAAK  +MGK+D FLD+L  ++K++IPE  LKA K Y  +P F+PE I+SKS AAAGLCSW INI+ +YE++CDV PKR ALE AN EL EA EKLS I+NKI +L   L  L   FEKA ++K +CQ EAD T + I LANRLVGGLASEN+RW + VE ++ +  TL GDVL+  AF+SYVG FTK YR  LM+ +W+P++ NL   IPIT  LDPL +L DDA +A+WNN+GLPSDRMS ENATIL N ERWPLI+D QLQGIKWIK ++ ++LK +RLGQK YLDVIEQA+S GD +LIENI E++DPVLD LLGRNTIKKG+ IK+GDKE EY+P+FRLIL TK  NPHYKPEMQAQ T+INF VTRDGLEDQLLA VV KER DLE LK +LTK QN+FKI LKELEDSLL RLSAA GNFLGD ALVENLE  K TA EIEEKV +AKITEV INE RE YRPAA RAS+LYFILNDLNKINP+YQFSLKAF VVFEKAI R  P+ E+K RV NL D IT+SVY+YT+RGLFE+DKLIF AQ++FQ+L   KE+NP ELDFLLRFP    + SP+DFL +  WGGIKALS ++EFKNLD DIEGSAKRWKK VESE PEKE FP+EWKNKT+LQ+LCM+R LRPDRMTYA+ +FV+EK+G K+VEG  VEFS+S+EES P+T IFFILSPGVDPLKDVE LGKKLGF+ DN    N+SLGQGQE+VAE A+D+ A++GHWV+LQNIHLV++WL  L+KKLE Y+  SHE YRVFISAEP+ SPE+HIIPQGILENAIKITNEPPTGM ANLHK+L+ F Q+T+EMC KE EFK +LFALCYFHAVV+ERRKFG QGWNRSYPFN GDL IS+NVLYNYLEAN KVPW+DLRYLFGEIMYGGHITDDWDR+LC+TYL EY++ EML+G++ + PGF++PPN DYKGYH YIDE LP ESPYLYGLHPNAEI FLT  S+KLF+TV EMQP+++     TG+SREE++K +LDDI+EK+P+ FNM EI AK    E+ PYVVVAFQECERMN+LT+E+RRSLKEL+LGLKGELTIT D+E LS +L+ D +P++W  RAYPS+ GLA WYADLLLRI+ELE WTTDF LP+ +WL G FNPQSFLTAIMQ MARKNEWPLD+M L  +VTKKN+EDM  PPR+G+YV+GLFMEGARWDTQ+G+IAEA+LKEL P+MPVIFIKAIPVDR + +N+Y CPVYKT+ RGPT+VWTFNLKTKEK +KW
Sbjct:    6 DVRLEYLEEVASIVLKFKPDKWSKLIGAEENVALFTEFFEKPDVQ-VLVLTLNAAGMIIPCLGFPQSLKSKGVYFIKTKSENINKDN-YRARLLYGDISPTPVDQLIAVVEEVLSSLLNQSENMAGWPQVVSEDIVKQVHRLKNEMFVMSGKIKGKTLLPIPEHLGS---LDGTLESMERIPSSLDNLLLHAIETTIIDWSHQIRDVLSKDSAQALLDGLHPLPQVEFEFWDTRLLNLKCIHEQLNRPKVNKIVEILEKAKSCYWPALQNVYTNVTEGLKEANDIVLYLKPLRILLEEMEQADFTMLPTFIAKVLDTICFIWATSEYYNTPARIIVILQEFCNQIIEMTRTFLSPEEVLKGLQGEIEEVLSGISLAVNVLKELYQTYDFCCVNMKLFFKD-KEPVPWEFPSSLAFSRINSFFQRIQTIEELYKTAIEFLKLEKIELGGVRGNLLGSLVTRIYDEVFELVKVFADCKYDPLDPGDSNFDRDYADFEIKIQDLDRRLATIFCQGFDDCSCIKSSAKLLYMCGGLMERPLILAEVAPRYSVMLELFDAELDNAKILYDAQMAASEEGNIPLIHKNMPPVAGQLKWSLELQERLEVSMKHLKHVEHPVMSGAEAKLTYQKYDEMMELLRCHREKIYQQWVAGVDQDCHFNLGQPLILRDAASNLIHVNFSKALVAVLREVKYLNFQQQKEIPDSAESLFSENETFRKFVGNLELIVGWYNEIKTIVKAVEFLLIKSELEAIDVKLLSAETTLFWNGE----GVFQYIQEVREILHNLQNRMQKAKQNIEGISQAMKDWSANPLFERKDNKKEALLDLDGRIANLNKRYAAVRDAGVKIQAMVAENAELFRADTLSLPWKDYVIYIDDMVLDEFDQFIRKSLSFLMDNMVIDESIAPLFEIRMELDEDGLTFNPTLEVGSDRGFLALIEGLVNDIYNVARLIPRLA--KDRMNYKMDLEDNTDLIEMREEVSSLVINAMKEAEEYQDSFERYSYLWTDNLQEFMKNFLIYGCAVTAEDLDTWTDDTIP---KTPPTLAQFQEQIDSYEKLYEEVSKCENTKVFHGWLQCDCRPFKQALLSTIRRWGFMFKRHLSNHVTNSLADLEAFMKVARMGLTKPLKEGDYDGLVEVMGHLMKVKERQAATDNMFEPLKQTIELLKTYGEEMPEEIHLKLQELPEHWANTKKLAIQVKLTVAPLQANEVSILRRKCQQFELKQHEFRERFRREAPFSFSDPNPYKSLNKQQKSISAMEGIMEALSKSGGLFEVPVPDYKQLKACHREVRLLKELWDMVVVVNTSIEDWKTTKWKDINVEQMDIDCKKFAKDMRSLDKEMKTWDAFVGLDNTVKNVITSLRAVSELQNPAIRERHWQQLMQATQVKFKMSEETTLADLLQLNLHSYEDEVRNIVDKAVKESGMEKVLKALDSTWSMMEFQHEPHPRTGTMMLKSSEVLVETLEDNQVQLQNLMMSKYLAHFLKEVTSWQQKLSTADSVISIWFEVQRTWSHLESIFIGSEDIRTQLPGDSQRFDDINQEFKALMEDAVKTPNVVEATSKPGLYNKLEALKKSLAICEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKLKFRLDASDKPLKVGLGMYSKEDEYMVFDQECDLSGQVEVWLNRVLDRMCSTLRHEIPEAVVTYEEKPREQWILDYPAQVALTCTQIWWTTEVGLAFARLEEGYENAIRDYNKKQISQLNVLITLLMGNLNAGDRMKIMTICTIDVHARDVVAKMIVAKVESSQAFTWQAQLRHRWDEEKRHCFANICDAQIQYSYEYLGNTPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDLGRALGTMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVIAVQVKCVQDAIRAKKKAFNFLGEIIGLIPTVGIFITMNPGYAGRAELPENLKALFRPCAMVVPDFELICEIMLMAEGFLEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPSRAEDQVLMRALRDFNIPKIVTDDLPVFMGLIGDLFPALDVPRKRDLNFEKIIKQSIVELKLQAEDSFVLKVVQLEELLQVRHSVFIVGNAGSGKSQVLKSLNKTYQNLKRKPVAVDLDPKAVTCDELFGIINPVTREWKDGLFSTIMRDLANITHDGPKWIILDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNRTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPVVSSWIERRKVQSEKANLMILFDKYLPTCLDKLRFGFKKITPVPEITVIQTILYLLECLLTEKTVPPDSPRELYELYFVFTCFWAFGGAMFQDQLVDYRVEFSKWWINEFKTIKFPSQGTIFDYYIDPDTKKFLPWTDKVPSFELDPDVPLQASLVHTTETIRIRYFMDLLMEKSWPVMLVGNAGTGKSVLMGDKLESLNTDNYLVQAVPFNFYTTSAMLQGVLEKPLEKKSGRNYGPPGTKKLVYFIDDMNMPEVDKYGTVAPHTLIRQHMDHRHWYDRHKLTLKDIHNCQYVACMNPTSGSFTIDSRLQRHFCVFAVSFPGQEALTTIYNTILTQHLAFRSVSMAIQRISSQLVAAALALHQKITATFLPTAIKFHYVFNLRDLSNIFQGLLFSTAEVLKTPLDLVRLWLHETERVYGDKMVDEKDQETLHRVTMASTKKFFDDLGDELLFAKPNIFCHFAQGIGDPKYVPVTDMAPLNKLLVDVLDSYNEVNAVMNLVLFEDAVAHICRINRILESPRGNALLVGVGGSGKQSLSRLAAYISGLDVFQITLKKGYGIPDLKIDLAAQYIKAAVKNVPSVFLMTDSQVAEEQFLVLINDLLASGEIPGLFMEDEVENIISSMRPQVKSLGMNDTRETCWKFFIEKVRRQLKVILCFSPVGSVLRVRARKFPAVVNCTAIDWFHEWPEDALVSVSARFLEETEGIPWEVKASISFFMSYVHTTVNEMSRVYLATERRYNYTTPKTFLEQIKLYQNLLAKKRTELVAKIERLENGLMKLQSTASQVDDLKAKLAIQEAELKQKNESADQLIQVVGIEAEKVSKEKAIADQEEVKVEVINKNVTEKQKACETDLAKAEPALLAAQEALDTLNKNNLTELKSFGSPPDAVVNVTAAVMILTAPGGKIPKDKSWKAAKI-MMGKVDTFLDSLKKFDKEHIPEACLKAFKPYQGNPTFDPEFIRSKSTAAAGLCSWCINIVRFYEVYCDVAPKRQALEEANAELAEAQEKLSRIKNKIAELNANLSNLTSAFEKATAEKIKCQQEADATNRVILLANRLVGGLASENIRWAESVENFRSQGVTLCGDVLLISAFVSYVGYFTKKYRNELMEKFWIPYIHNLKVPIPITNGLDPLSLLTDDADVATWNNQGLPSDRMSTENATILGNTERWPLIVDAQLQGIKWIKNKYRSELKAIRLGQKSYLDVIEQAISEGDTLLIENIGETVDPVLDPLLGRNTIKKGKYIKIGDKEVEYHPKFRLILHTKYFNPHYKPEMQAQCTLINFLVTRDGLEDQLLAAVVAKERPDLEQLKANLTKSQNEFKIVLKELEDSLLARLSAASGNFLGDTALVENLETTKHTASEIEEKVVEAKITEVKINEARENYRPAAERASLLYFILNDLNKINPVYQFSLKAFNVVFEKAIQRTTPANEVKQRVINLTDEITYSVYMYTARGLFERDKLIFLAQVTFQVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQGWGGIKALSEMDEFKNLDSDIEGSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCLRPDRMTYAIKNFVEEKMGSKFVEGRSVEFSKSYEESSPSTSIFFILSPGVDPLKDVEALGKKLGFTIDNGKLHNVSLGQGQEVVAENALDVAAEKGHWVILQNIHLVARWLGTLDKKLEHYSTGSHEDYRVFISAEPAPSPETHIIPQGILENAIKITNEPPTGMHANLHKALDLFTQDTLEMCTKEMEFKCMLFALCYFHAVVAERRKFGAQGWNRSYPFNNGDLTISINVLYNYLEANPKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLAEYIRTEMLEGDVLLAPGFQIPPNLDYKGYHEYIDENLPPESPYLYGLHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAGTGVSREEKVKAVLDDILEKIPETFNMAEIMAKAA--EKTPYVVVAFQECERMNILTNEMRRSLKELNLGLKGELTITTDVEDLSTALFYDTVPDTWVARAYPSMMGLAAWYADLLLRIRELEAWTTDFALPTTVWLAGFFNPQSFLTAIMQSMARKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQTGVIAEARLKELTPAMPVIFIKAIPVDRMETKNIYECPVYKTRIRGPTYVWTFNLKTKEKAAKW 4451          
BLAST of DNAHb-1 vs. UniProt
Match: sp|Q69Z23|DYH17_MOUSE (Dynein heavy chain 17, axonemal OS=Mus musculus OX=10090 GN=Dnah17 PE=1 SV=2)

HSP 1 Score: 5542.24 bits (14376), Expect = 0.000e+0
Identity = 2815/4486 (62.75%), Postives = 3476/4486 (77.49%), Query Frame = 1
Query:  127 LKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLP--VGSEKVSEGDINSFGEVP----RSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKG---ETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHV--SGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQI--EGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLL--KTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVL-------QNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREER----------------------------IKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            LK K+DK+ KL   +E   ++ +FF+K +   + VL     G +     FP +LKSK  +F K   E+I++D  +   LI+GDIS T +DQ  + V+EV+  +L+ ++N + WP V+S D+++  + LK++  V+ G+ KGKTLLP+P  +GS    +G ++S   +P     S++++IET++I+W+HQI DVLSK S++ L+ GL+P P VE ++W  R  NL+CI+EQL  PKV K+  +LE   S Y P  ++++ +V   LKE+  I LYL PLR  LEE+EQ +F+ +   I  +   +C IWA  + Y  P R++V+ +E  N II    +YL P E+ KG   E EE L  +  S+ +L    ++++     +K +FKD   PV W+F S+L F R+NSF  R++ ++ +    +EF KLEK+E+ G+ G  L   +  +++E   + K F E  YD LDP ++ F  DY  F+  I DLDRRLAT   QAF DC+C ++  KL+ + GGLL+RP++ +E   RY  +++M + E++N KL+YD  +  S + ++P IHKNM  V+G+L+W  E++ER++  +    H++H    + E  L+  K+DE++ LL+   MK Y  W+ GVD+ C FNL QPL+ R+  T  I VNF   L AVLREVKYL    Q+EIP+SA  + S+N+T RK++ NL+L+V WYN ++     VE PLI++EL  ID +L  A T L WN +       +YI+++R++++NL++R+ K+K+N++ I   M  W  +PLFERK+ K + LL+LD R    NKRY  + EAG R+  +V EN+EL +AD+ S+ WK YV+ ID ++++ F   I  SL Y++D +  + S  PLFE+ M+L  + + + PSL+      F  L++ L+ D++  A  + RLA G    +Y++DLE+  +L + R E+S     A + A+ YQ  F+ YS LW D+ +EFM  FL +G A + EEL+   +  I    + PPTL QF+ QID YEK +EE+       +   W + DCR FKQ  LNTIKRWS +FK++L +HV NSL +L  F+ IT + L K   EGD++GLVE+MGHL  VKERQ ATD MFEPLKQTI+LLK+Y +EMP+E++L+L+ELPE+W NTKK+A+ VKQ VAPLQ  EV  +RRKC  F++KQH FRE+FR+  PF+FS  E Y+ L++ ++    L   ME L +SA+LFEVTVP++KQLK C +E+RLLK LWD I +VN+SI+ WK T WKDINVEQMD DCK FAK +RSLDKEM+ WDA+ G+++ +KNM+TSLRAV+ELQNPAIRDRHW QLM AT+VKF+M+E TTL DLL+LNLH +EDEVR+IV+KAVKE  MEKVLK L  TW+ MEFEHE H RTG  +LK+ E L+ETLE++QV+LQN+M SKY+SHF  EV SWQ+ LSTAD VI IWFEVQRTWSHLESIFIGS+DIR QLPEDS+RFD ID +FKAL+ +  +T NVV+AT KP LY +LE ++  L +CEKALAEYLETKRLAFPRFYFVSSADLLDILSNGN P  V +HL+KLFDSL KLKF  +A  +  K G+ MY+K+ E V+F   CDL GQVE WLNR+L+ MR T+R  + E+V + EEK R+QWIF++PAQ       I W TEV L+FARLEEGYENA+KD+NKKQI+QLNALITLLIG L+  DR K+MTICTIDVH RDVV K+IT  +++SQ+FTW  QLRHRW +  K C+ NICDAQ +Y++EYLGNTPRLVITPLTDRCYITLTQSLHL M GAPAGPAGTGKTETTKDLGRALG MVYVFNCSEQMDYKS GNIYKGLAQ+G+WGCFDEFNRISVEVLSV+AVQVKC+QDAI+ K+K+F+FLGE ISL   +GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFL AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DP R EDQVLMRALRDFNIPKIVTDD PVFMGLIGDLFPALDVPRKRD  FEK ++Q+ ++LKLQAE++FVLKVVQL+EL  VRHSVFV+GNAG+GKS V K+L KTY NLK+KP+AVDL+PKAVT DELFGIINP+TREWKDGLFS IMRDLANLT +GPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPL  TMRL+FEISHL+TATPATVSRAGILYINP DLGW P V+SWI  R++QSE+ANL ILFDKY+P CL+ L++ FK+ITP+ EI+ +Q + +LLE LL  +N P D PKE YELYFVF   WAFG  MFQDQL+D+RVEF+KWW+ EFKTIKLP+QGT+FDYYID ETKKF PWT ++  FE+D + PLQA LV T+ET R RYF+DLL+EK  PVMLVG AGTGK+VL+ DKL ++  D+Y+V  VPFNFYTTS MLQ VLEKPLEKK+GRNYGP G+KKLIYFIDDMNMPEVDKY TV PHTLIRQH+D+ HWYDR KLTLK++HN QY+ACMNPT+GSFTI PRLQRHFCVFA+SFPGQE+L +IY+TIL++ L S  SA L+  +  S+LV  AL  H K+++TFLPTAIKFHY+FNLRDLSNIFQGILF+  + +K P DLVRLW+HE ERVY DK++D+ D ET  R+     KK F+++ E  +F KP ++CHF QGIG+PKY PV     L+K+LK+ L+SYNEVNA MNLVLFEDAVAHI +INRILESPRG ALLVGVGGSGKQSLSRLAA+IS+LDVFQITL+KGY I DLK+DLA  Y+K+ VKN+  VFL+TD+Q+A+E+FLVL+NDLLASGEI  LF D+++ENIISSMR +VKS G+ D+RE CW FFI KVR  L+++LCFSPVGS LRVRARKFPAVVNCT+I+WFHEWPEDAL+SVS RFL+E E +  + K S + FM++VH  VN++S  YL  ERRYNYTTPK+FLEQI LY N+L KK  EL  K+ RLENGL KL+STA QVDDLKAKLA QE EL+QKN +A++L++ V  +T+KVS EK IAD EE KV  I   V++KQ+ CE DLAKAEPAL AAQEAL+TLNKNNLTE+KSFG+PP AV++V+AA M L A  GK+PKD+SWKAAK  +MGK+D FLD+L  ++K++IPE  LKA K Y  +P F+PE I+SKS AAAGLCSW INI+ +YE++CDV PKR ALE AN EL EA EKLS I+NKI +L   L  L   FEKA ++K +CQ EAD T + I LANRLVGGLASENVRW + VE +K +  TL GDVL+  AF+SYVG FTK YR  LM+ +W+P++  L   IPIT+ LDPL +L DDA +A+WNN+GLPSDRMS ENATIL N ERWPLI+D QLQGIKWIK ++G+DL+ +RLGQK YLD+IEQA+SAGD +LIENI E++DPVLD LLGRNTIKKGR IK+GDKE EY+P FRLIL TK  NPHYKPEMQAQ T+INF VTRDGLEDQLLA VV KER DLE LK +LTK QN+FKI LKELEDSLL RLSAA GNFLGD ALVENLE  K TA EIEEKV++AKITEV INE RE YRPAA RAS+LYFILNDLNKINP+YQFSLKAF VVFEKAI +  P++E+K RV NL D IT+SVY+YT+RGLFE+DKLIF AQ++FQ+L   KE+NP ELDFLLRFP    + SP+DFL + SWGGIKALS ++EFKNLD DIEGSAKRWKK VESE PEKE FP+EWKNKT+LQ+LCM+R +RPDRMTYAV +FV+EK+G K+VEG  VEFS+S++ES P+TPIFFILSPGVDPLKDVE LGKKLGF+ DN    N+SLGQGQE+VAE A+D+ A++GHWV+L       QNIHLV++WL  L+KK+E Y+  SHE YRVFISAEP+ + E+HIIPQGILENAIKITNEPPTGM ANLHK+L+ F Q+T+EMC KE EFK ILFALCYFHAVV+ERRKFG QGWNRSYPFN GDL IS+NVLYNYLEANSKVPW+DLRYLFGEIMYGGHITDDWDR+LC+TYL EY++ EML+GE+ + PGF++PPN DYKGYH YIDE LP ESPYLYGLHPNAEI FLT  S+KLF+TV EMQP+++     TG+SREE+                            +K +LDDI+EK+P+ FNM EI AK    E+ PYVVVAFQECERMN+LT+E+RRSLKEL+LGLKGELTIT DME LS +L+ D +P++W  RAYPS+ GLA WYADLL RI+ELE WTTDF LP+ +WL G FNPQSFLTAIMQ MARKNEWPLD+M L  +VTKKN+EDM  PPR+G+YV+GLFMEGARWDTQ+G+IAEA+LK+L P MPVIFIKAIPVDR + +N+Y CPVYKT+ RGPT+VWTFNLKTKEK +KW
Sbjct:   17 LKFKADKWGKLIGAEENMALLTEFFDKID-NPVLVLTLNAAGMIIPCLGFPESLKSKGVYFIKMKPENITKDN-YKTHLIYGDISPTTVDQLIAVVEEVLYSLLNQSENMDGWPRVVSEDIVKQVHRLKNEMFVMGGKIKGKTLLPIPEHLGS---LDGTLDSMERIPSSMDNSLLHSIETIIIDWSHQIRDVLSKDSAQALLDGLHPLPRVEFEFWDARLMNLQCIHEQLNRPKVNKIVEILEKAKSCYWPALQNVYMNVTQGLKEANGIVLYLKPLRILLEEMEQADFTMLPSFIVKVLSTICFIWATSEHYNTPSRVIVILREFCNQIIEMTRTYLSPDEVLKGLQGEIEEVLGNISLSVSVLKGLFQAYDFCCANMKLFFKDRP-PVPWEFPSSLAFSRMNSFFHRVQTIEDLYKTAIEFLKLEKIELGGVWGNILGNLVTQIYDEVFELVKVFAECKYDPLDPGDSSFDDDYSDFETKIQDLDRRLATIFCQAFDDCNCMESSAKLLYMCGGLLERPLILVEVVPRYSVMLEMFNTELDNAKLMYDAQMAASADGQIPPIHKNMSPVSGQLKWSLELQERLEVSMKYLKHIEHPVMSSMEAKLIYDKYDEMMGLLQSCRMKKYQQWVEGVDQDCHFNLGQPLIQRDPFTSLIQVNFSKALVAVLREVKYLNFQQQKEIPESAEKLFSENETFRKFVGNLELIVGWYNEIKTTVKDVEFPLIKSELEAIDVKLLSAETTLFWNGE----NVMEYIQEMREMLYNLQNRIQKAKQNVEGITQAMQEWSANPLFERKDNKKEALLDLDGRVANLNKRYAAVKEAGVRIQAMVVENAELFRADTTSQSWKDYVNYIDTVVLDEFDRFIRKSLNYLMDNMTMDESIAPLFEIRMELDKDGLTYNPSLEMGDEAGFLSLIEGLINDLYNVARLIPRLAKGRL--NYKSDLEDITDLIEMREEVSSLVIGAMKVAEEYQDSFERYSYLWVDDLQEFMKNFLIFGHAPTPEELDTKTDDTIP---KTPPTLAQFQQQIDSYEKLYEEVSSCENTKVFHGWLQCDCRPFKQTLLNTIKRWSFLFKRYLNNHVINSLADLESFMNITRTALKKPLKEGDYDGLVEVMGHLMKVKERQVATDSMFEPLKQTIELLKSYGEEMPEEIYLKLQELPEQWTNTKKLAIQVKQNVAPLQANEVNILRRKCQQFELKQHEFREKFRRDAPFSFSDPEPYKSLNKIYL----LYGVMEALCKSASLFEVTVPDYKQLKACHREVRLLKELWDMIVMVNTSIDDWKTTKWKDINVEQMDIDCKKFAKDVRSLDKEMKPWDAFVGLDNTVKNMITSLRAVSELQNPAIRDRHWQQLMQATQVKFEMSEETTLADLLQLNLHKYEDEVRNIVDKAVKESGMEKVLKTLDITWTTMEFEHELHPRTGTMMLKSDEVLVETLEDNQVQLQNLMMSKYLSHFLKEVTSWQQKLSTADSVISIWFEVQRTWSHLESIFIGSEDIRAQLPEDSKRFDAIDQEFKALMEDAVKTPNVVEATNKPDLYNKLENLKMSLAVCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKLKFRLDASGKPLKFGLGMYSKEDEFVDFDKECDLSGQVEVWLNRVLDRMRATLRHEIPEAVVTYEEKPREQWIFDYPAQ-------IWWTTEVGLAFARLEEGYENAIKDYNKKQISQLNALITLLIGNLTAGDRMKIMTICTIDVHARDVVAKMIT--VESSQAFTWQSQLRHRWDEEKKHCFANICDAQIKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDLGRALGTMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVIAVQVKCVQDAIRAKKKKFNFLGEIISLVPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLDARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPTRAEDQVLMRALRDFNIPKIVTDDLPVFMGLIGDLFPALDVPRKRDLNFEKIIKQSIVELKLQAEDSFVLKVVQLEELLQVRHSVFVIGNAGSGKSQVLKSLNKTYQNLKRKPVAVDLDPKAVTCDELFGIINPATREWKDGLFSTIMRDLANLTHEGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNRTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPVVSSWIERRKVQSEKANLIILFDKYLPTCLDKLRIGFKRITPVPEITVIQTILYLLECLLTEKNAPPDSPKELYELYFVFACFWAFGGAMFQDQLIDYRVEFSKWWINEFKTIKLPSQGTIFDYYIDPETKKFLPWTDKVPNFELDPDIPLQASLVHTTETIRIRYFIDLLMEKAWPVMLVGNAGTGKSVLMGDKLENLSTDDYLVQAVPFNFYTTSAMLQGVLEKPLEKKSGRNYGPPGTKKLIYFIDDMNMPEVDKYGTVAPHTLIRQHMDHRHWYDRQKLTLKDVHNCQYVACMNPTSGSFTIDPRLQRHFCVFAVSFPGQEALTSIYNTILAQHL-SFRSAPLVIQRLSSHLVTAALALHQKVSATFLPTAIKFHYIFNLRDLSNIFQGILFSTAEILKTPLDLVRLWLHEAERVYGDKMVDEKDQETLHRVTIASVKKFFDDLGEENLFAKPNIFCHFTQGIGDPKYFPVTDVAQLNKLLKDVLDSYNEVNAVMNLVLFEDAVAHICKINRILESPRGNALLVGVGGSGKQSLSRLAAYISALDVFQITLKKGYAIPDLKMDLATQYIKSAVKNVPSVFLMTDSQVAEEQFLVLINDLLASGEIPGLFGDEDLENIISSMRPQVKSLGIADTREACWKFFIEKVRRQLKVILCFSPVGSVLRVRARKFPAVVNCTAINWFHEWPEDALVSVSARFLEETEGIEPEVKTSISLFMAYVHTTVNEMSKIYLTIERRYNYTTPKTFLEQIKLYQNLLAKKRMELVAKIERLENGLMKLQSTASQVDDLKAKLAVQETELKQKNENADKLIQVVGVETEKVSKEKAIADEEEMKVEVINKNVTEKQKACETDLAKAEPALLAAQEALDTLNKNNLTELKSFGSPPDAVVNVTAAVMILTAPGGKIPKDKSWKAAKI-MMGKVDTFLDSLKKFDKEHIPEACLKAFKPYQGNPTFDPEFIRSKSTAAAGLCSWCINIVRFYEVYCDVAPKRQALEEANAELAEAQEKLSRIKNKIAELNANLSNLTSAFEKATAEKIKCQQEADATNRVISLANRLVGGLASENVRWAESVENFKSQGVTLCGDVLLISAFVSYVGYFTKKYRNELMEKFWIPYINKLKVPIPITEGLDPLTLLTDDADVATWNNQGLPSDRMSTENATILCNTERWPLIVDAQLQGIKWIKNKYGSDLQAIRLGQKSYLDIIEQAISAGDTLLIENIGETVDPVLDPLLGRNTIKKGRFIKIGDKEVEYHPSFRLILHTKYFNPHYKPEMQAQCTLINFLVTRDGLEDQLLAAVVAKERPDLEQLKANLTKSQNEFKIVLKELEDSLLARLSAASGNFLGDTALVENLETTKHTANEIEEKVQEAKITEVKINEARENYRPAAERASLLYFILNDLNKINPIYQFSLKAFNVVFEKAIQKTAPADEVKQRVINLTDEITYSVYMYTARGLFERDKLIFLAQVTFQVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQSWGGIKALSEMDEFKNLDSDIEGSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCMRPDRMTYAVKNFVEEKMGSKFVEGRSVEFSKSYKESSPSTPIFFILSPGVDPLKDVEALGKKLGFTIDNGKLHNVSLGQGQEVVAENALDVAAEKGHWVILQVRGSLPQNIHLVARWLGILDKKVERYSSGSHEDYRVFISAEPAPTAETHIIPQGILENAIKITNEPPTGMYANLHKALDLFTQDTLEMCTKEIEFKCILFALCYFHAVVAERRKFGAQGWNRSYPFNNGDLTISINVLYNYLEANSKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLAEYIRVEMLEGEVLLAPGFQIPPNLDYKGYHEYIDENLPPESPYLYGLHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAGTGVSREEKVGAVPVPEGSLGSEGSLGTIGLPGTGFQVKAVLDDILEKIPETFNMAEIMAKAA--EKTPYVVVAFQECERMNILTNEMRRSLKELNLGLKGELTITTDMEDLSTALFYDTVPDTWVARAYPSMMGLAAWYADLLQRIRELESWTTDFALPTTVWLAGFFNPQSFLTAIMQSMARKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQTGVIAEARLKDLTPVMPVIFIKAIPVDRMETKNIYECPVYKTRIRGPTYVWTFNLKTKEKAAKW 4470          
BLAST of DNAHb-1 vs. UniProt
Match: sp|Q9NYC9|DYH9_HUMAN (Dynein heavy chain 9, axonemal OS=Homo sapiens OX=9606 GN=DNAH9 PE=1 SV=3)

HSP 1 Score: 5528.76 bits (14341), Expect = 0.000e+0
Identity = 2774/4467 (62.10%), Postives = 3472/4467 (77.73%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFF--EKPEIQHLFVLQAPGGGALNLQNEFPTNLKS-----KACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINS---FGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKV--PKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIE--GSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSE--KLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMV-MFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            D+R   +G YV  SL+  +  + +   + E +Q++  F   +  E     ++  PG   L ++       +S     KA FF +   E    D+ F   ++ GD+   PL+  ++   EV+LPVL+N KN+ +WP +I  DV RH +SL+    V+L Q KGKTLLPLP GSEK+   D  S      + +S+IYAIE+ VI+W++Q+  VL ++SS+ L+ G NPTP VEL++WK+R  +L+ IY QL +  V+ MA LL+ + S+Y P FK +++ VVAAL E+Q+I+++L PL+  LE +E  EF E++P + PL HV+CLIWA CK YR P R+ VL QEI NL+I    +YL P+++ + E EE+  K++     L+ FK+ F+  RE +  YFK+  E  EW F S+L+F RL+ F+ ++ +V+ +L   L+F+KL KVE SG++G  LSQ +  M EEF+ +++  +  + DCL    TDF  D  +F   ++DLDRRL T   QAF D    +  FKL+DI G LL+RP++  +   +Y  L++M +++++  +++Y  HV    ++    +HKNMP V G L W +E+R+RI+ P +    + H   ++ E   + +K++++L LL+K+E + Y +W   V E   +NLSQPLL R+ +T  I++NF+ +L +VL+E+ YL+  + + +P++A  + S  D  R+ + NL+LM  WYN + K  L VE PL+E EL  ID +L  A   L W ++    G   Y+ ++   +H+L  R+ K+K+N++ I+ IM  W  +P+F+ K+GK ++LL+LDDR DR  K Y  I E+G ++H LV+EN  L  AD  S  WK YV++ID++++  F   I  SL+Y+++  E      P+FE  + L   E+VF PSL+      F ++V+ L+T IF+  S V RL+  +    Y+ DL+   +L   R  + ER +        YQ+ F +YS L+ ++R+E + QFL YG  ++ EE+E H E  I    E PP L QFK QID YE  +EE+ ++    + D W +ID R FK + LN IKRWSL+FKQHL+DHVT+SL  L  FIK + SGL K+  +GDF+GLVE+MGHL  VKERQ  TDEMFEPLKQTI+LLKTY QE+P+ V  QLEELPEKWNN KKVA+TVKQ VAPLQ  EV  +R++C  FD +Q  F EQF K  PF F  +  ++ LD +HIEI  +E  M  ++ESA+LFEV VP++KQL+QCRKE+  LK LWD I +V SSI  W+ T W++INVE M+ +CK FA+ IR+LDKE+R+WDA+TG+E  + N ++SLRAV ELQNPAIR+RHW QLM AT V F M++ TTL  LL+L LH++EDEVR IV+KA KEM MEK LKEL +TW+ MEF++E H RT + LL + E+LIE LE++QV+LQN++ SKY++ F +EV  WQK LST D VI IWFEVQRTW+HLESIF GS+DIR QLP+DS+RF+ ID DFK L  + ++  NVV+ T KP LYE+LE +Q  L LCEKALAEYL+TKRLAFPRFYF+SS+DLLDILSNG +P+ V +HL+KLFD++AK++F  +A  E TK  + MY+K+ E V F+  CD  GQVE WLN +L  M+ T+R  ++E V++ EEK R+QW+F+ PAQVAL+ +QI W TEV ++FARLEEGYE+A+KD+ KKQ+ QL  LIT+LIG+LSK DRQK+MTICTIDVH RDVV K+I QK+DN+Q+F WL QLRHRW D  K C+ NICDAQF Y++EYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGI+VYVFNCSEQMDYKS GNIYKGLAQ+G+WGCFDEFNRISVEVLSVVAVQVK IQDAI++K++ F FLGEEISL+ ++GIFITMNPGYAGRTELPENLK+LFRPCAMVVPDFELICEIMLVAEGF++A+ LARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DPDRPEDQVLMR+LRDFNIPKIVTDD P+FMGLIGDLFPALDVPR+RDP FE  VR+A +DLKLQAE+NFVLKVVQL+EL AVRHSVFV+G AGTGKS V ++L KTY  +K++P+  DLNPKAVTNDELFGIINP+T EWKDGLFS IMR+LAN+T DGPKWI+LDGDIDPMWIESLNTVMDDNKVLTLASNERIPL PTM+LLFEISHL+TATPATVSRAGILYINP DLGW P V+SWI  REIQ+E+ANLTILFDKY+P CL+ L+ RFKKI PI E S VQM+CHLLE LL  E+ PADCPKE YE YFVF AIWAFG  M QDQLVD+R EF+KWW+TEFKT+K P+QGT+FDYYID ETKKFEPW+K + +FE D E PLQA LV TSET R  YF++ L+ ++RPVMLVG AGTGK+VL+  KL S+  + Y+V NVPFN+YTTS MLQ VLEKPLEKKAGRNYGP G+KKLIYFIDDMNMPEVD Y TVQPHT+IRQH+DY HWYDR+KL+LKEI N QY++CMNPTAGSFTI+PRLQRHF VF LSFPG ++L +IYS IL++  KLG NF ASL K++  L+DLAL FH KI +TFLPT IKFHY+FNLRD +NIFQGILF+  +C+K   DL+RL++HE  RVY DK++++ D + + ++Q E+ KK F+++++ V   + P LYCHFA GIGEPKYMPV+  E L++ L EALE++NEVN  M+LVLFEDA+ H+  INRILESPRG ALLVGVGGSGKQSL+RLAAFISS+DVFQITLRKGY I D K+DLA+L +KAGVKN+  VFL+TDAQ+ADE+FLVL+NDLLASGEI DL+ DDE+ENIIS++RNEVKS G++D+RENCW FFI+++R  L++ LCFSPVG+ LRVR+RKFPA+VNCT+I WFHEWP+ AL SVS RFLQ  E +    K S +KFM+FVH +VN+ S SYL NE+RYNYTTPKSFLE I LY ++L +   EL+ K  RLENGL KL ST+ QVDDLKAKLAAQEVEL+QKN  A++L++ V  +T KVS EK +AD EE+KV+ I  EV +KQ+DCE DLAKAEPAL AAQ ALNTLNK NLTE+KSFG+PP AV +VSAA M LMA  G+VPKDRSWKAAK   M K+D FLD+LIN+NK+NI E  LKA + Y +DP FNPE + +KS AAAGLCSWVINI+ +YE+FCDV+PKR AL  A  +L  A EKL+ I+ KI  L + L KL   FEKA +DK +CQ EA++T  TI LANRLVGGLASENVRW   V+ +K +E+TL GD+L+  AF+SY+G FTK YR +L+D  W P+L+ L   IP+T  LDPL+ML+DDA +A+W NEGLP+DRMS+ENATIL N ERWPL++DPQLQGIKWIK ++G DL+V ++GQKGYL +IEQA+ AG VVLIEN+EES+DPVL  LLGR  IKKGR IK+GDKECEYNP+FRLIL TKLANPHY+PE+QAQ T+INFTVTRDGLEDQLLA VV+ ER DLE LK DLTKQQN FKITLK LEDSLL RLS+A GNFLG+  LVENLE  K+TA E+E+KV++AK+TEV INE RE YRPAAARAS+LYFI+NDL+KI+PMYQFSLKAF +VF+KA++RA P E L+ RV NLIDSITFSVY YT RGLFE DKL + AQ++FQILL  +E+N  ELDFLLR P+     SP++FLS+ +WG +K LS++EEF NLDRDIEGSAK WKKFVESE PEKEK PQEWKNKT+LQRLCM+RA+RPDRMTYA+ DFV+EKLG KYV G  ++F+ SFEESGPATP+FFILSPGVDPLKDVE+ G+KLG++ +N+NF N+SLGQGQE+VAE A+DL AK+GHWV+LQNIHLV+KWLS LEKKLEE++E SH  +RVF+SAEP+ SPE HIIPQGILEN+IKITNEPPTGM ANLHK+L+NF Q+T+EMC++E EFK+ILFALCYFHAVV+ERRKFGPQGWNRSYPFNTGDL ISVNVLYN+LEAN+KVP++DLRYLFGEIMYGGHITDDWDR+LC+TYL E+++PEML+GEL++ PGF +P N DY GYH YID  LP ESPYLYGLHPNAEI FLT  S+KLF+TV E+QPRDS      G +REE++K +L++I+E++ D+FN+ E+ AKV  EER PY+VVAFQEC RMN+LT EI+RSL+EL+LGLKGELT+T+ ME L N+LY D++PESW++RAYPS  GLA W+ DLL RIKELE WT DF +PS +WL G FNPQSFLTAIMQ  ARKNEWPLD+MALQCD+TKKN+E+   PPR+GAY+HGLFMEGA WDTQ+G+I EAKLK+L P MPV+FIKAIP D+QD R+VY+CPVYKT +RGPT+VWTFNLKTKE PSKW
Sbjct:   22 DRRLRLLGTYVAMSLRPAAGAWERCAGSAEAEQLLQAFLGRDAAEGPRPLLVVRPGPRGLAIRPGLEVGPESGLAGAKALFFLRTGPEPPGPDS-FRGAVVCGDLPAAPLEHLAALFSEVVLPVLANEKNRLNWPHMICEDVRRHAHSLQCDLSVILEQVKGKTLLPLPAGSEKMEFADSKSETVLDSIDKSVIYAIESAVIKWSYQVQVVLKRESSQPLLQGENPTPKVELEFWKSRYEDLKYIYNQLRTITVRGMAKLLDKLQSSYFPAFKAMYRDVVAALAEAQDIHVHLIPLQRHLEALENAEFPEVKPQLRPLLHVVCLIWATCKSYRSPGRLTVLLQEICNLLIQQASNYLSPEDLLRSEVEESQRKLQVVSDTLSFFKQEFQDRRENLHTYFKENQEVKEWDFQSSLVFVRLDGFLGQLHVVEGLLKTALDFHKLGKVEFSGVRGNALSQQVQQMHEEFQEMYRLLSGSSSDCLYLQSTDFENDVSEFNQKVEDLDRRLGTIFIQAFDDAPGLEHAFKLLDIAGNLLERPLVARDTSDKYLVLIQMFNKDLDAVRMIYSQHVQEEAELGFSPVHKNMPTVAGGLRWAQELRQRIQGPFSNFGRITHPCMESAEGKRMQQKYEDMLSLLEKYETRLYEDWCRTVSEKSQYNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLLEVEFPLVEEELQNIDLRLRAAEETLNWKTE----GICDYVTEITSSIHDLEQRIQKTKDNVEEIQNIMKTW-VTPIFKTKDGKRESLLSLDDRHDRMEKYYNLIKESGLKIHALVQENLGLFSADPTSNIWKTYVNSIDNLLLNGFFLAIECSLKYLLENTECKAGLTPIFEAQLSLAIPELVFYPSLESGVKGGFCDIVEGLITSIFRIPSLVPRLSPQNGSPHYQVDLDGIPDLANMRRTLMERVQRMMGLCCGYQSTFSQYSYLYVEDRKEVLGQFLLYGHILTPEEIEDHVEDGIP---ENPPLLSQFKVQIDSYETLYEEVCRLEPIKVFDGWMKIDIRPFKASLLNIIKRWSLLFKQHLVDHVTHSLANLDAFIKKSESGLLKKVEKGDFQGLVEIMGHLMAVKERQSNTDEMFEPLKQTIELLKTYEQELPETVFKQLEELPEKWNNIKKVAITVKQQVAPLQANEVTLLRQRCTAFDAEQQQFWEQFHKEAPFRFDSIHPHQMLDARHIEIQQMESTMASISESASLFEVNVPDYKQLRQCRKEVCQLKELWDTIGMVTSSIHAWETTPWRNINVEAMELECKQFARHIRNLDKEVRAWDAFTGLESTVWNTLSSLRAVAELQNPAIRERHWRQLMQATGVSFTMDQDTTLAHLLQLQLHHYEDEVRGIVDKAAKEMGMEKTLKELQTTWAGMEFQYEPHPRTNVPLLCSDEDLIEVLEDNQVQLQNLVMSKYVAFFLEEVSGWQKKLSTVDAVISIWFEVQRTWTHLESIFTGSEDIRAQLPQDSKRFEGIDIDFKELAYDAQKIPNVVQTTNKPGLYEKLEDIQGRLCLCEKALAEYLDTKRLAFPRFYFLSSSDLLDILSNGTAPQQVQRHLSKLFDNMAKMRFQLDASGEPTKTSLGMYSKEEEYVAFSEPCDCSGQVEIWLNHVLGHMKATVRHEMTEGVTAYEEKPREQWLFDHPAQVALTCTQIWWTTEVGMAFARLEEGYESAMKDYYKKQVAQLKTLITMLIGQLSKGDRQKIMTICTIDVHARDVVAKMIAQKVDNAQAFLWLSQLRHRWDDEVKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGILVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKQWFSFLGEEISLNPSVGIFITMNPGYAGRTELPENLKSLFRPCAMVVPDFELICEIMLVAEGFIEAQSLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPDRPEDQVLMRSLRDFNIPKIVTDDMPIFMGLIGDLFPALDVPRRRDPNFEALVRKAIVDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGGAGTGKSQVLRSLHKTYQIMKRRPVWTDLNPKAVTNDELFGIINPATGEWKDGLFSSIMRELANITHDGPKWILLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMKLLFEISHLRTATPATVSRAGILYINPADLGWNPPVSSWIEKREIQTERANLTILFDKYLPTCLDTLRTRFKKIIPIPEQSMVQMVCHLLECLLTTEDIPADCPKEIYEHYFVFAAIWAFGGAMVQDQLVDYRAEFSKWWLTEFKTVKFPSQGTIFDYYIDPETKKFEPWSKLVPQFEFDPEMPLQACLVHTSETIRVCYFMERLMARQRPVMLVGTAGTGKSVLVGAKLASLDPEAYLVKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGNKKLIYFIDDMNMPEVDAYGTVQPHTIIRQHLDYGHWYDRSKLSLKEITNVQYVSCMNPTAGSFTINPRLQRHFSVFVLSFPGADALSSIYSIILTQHLKLG-NFPASLQKSIPPLIDLALAFHQKIATTFLPTGIKFHYIFNLRDFANIFQGILFSSVECVKSTWDLIRLYLHESNRVYRDKMVEEKDFDLFDKIQTEVLKKTFDDIEDPVEQTQSPNLYCHFANGIGEPKYMPVQSWELLTQTLVEALENHNEVNTVMDLVLFEDAMRHVCHINRILESPRGNALLVGVGGSGKQSLTRLAAFISSMDVFQITLRKGYQIQDFKMDLASLCLKAGVKNLNTVFLMTDAQVADERFLVLINDLLASGEIPDLYSDDEVENIISNVRNEVKSQGLVDNRENCWKFFIDRIRRQLKVTLCFSPVGNKLRVRSRKFPAIVNCTAIHWFHEWPQQALESVSLRFLQNTEGIEPTVKQSISKFMAFVHTSVNQTSQSYLSNEQRYNYTTPKSFLEFIRLYQSLLHRHRKELKCKTERLENGLLKLHSTSAQVDDLKAKLAAQEVELKQKNEDADKLIQVVGVETDKVSREKAMADEEEQKVAVIMLEVKQKQKDCEEDLAKAEPALTAAQAALNTLNKTNLTELKSFGSPPLAVSNVSAAVMVLMAPRGRVPKDRSWKAAKV-TMAKVDGFLDSLINFNKENIHENCLKAIRPYLQDPEFNPEFVATKSYAAAGLCSWVINIVRFYEVFCDVEPKRQALNKATADLTAAQEKLAAIKAKIAHLNENLAKLTARFEKATADKLKCQQEAEVTAVTISLANRLVGGLASENVRWADAVQNFKQQERTLCGDILLITAFISYLGFFTKKYRQSLLDRTWRPYLSQLKTPIPVTPALDPLRMLMDDADVAAWQNEGLPADRMSVENATILINCERWPLMVDPQLQGIKWIKNKYGEDLRVTQIGQKGYLQIIEQALEAGAVVLIENLEESIDPVLGPLLGREVIKKGRFIKIGDKECEYNPKFRLILHTKLANPHYQPELQAQATLINFTVTRDGLEDQLLAAVVSMERPDLEQLKSDLTKQQNGFKITLKTLEDSLLSRLSSASGNFLGETVLVENLEITKQTAAEVEKKVQEAKVTEVKINEAREHYRPAAARASLLYFIMNDLSKIHPMYQFSLKAFSIVFQKAVERAAPDESLRERVANLIDSITFSVYQYTIRGLFECDKLTYLAQLTFQILLMNREVNAVELDFLLRSPVQTGTASPVEFLSHQAWGAVKVLSSMEEFSNLDRDIEGSAKSWKKFVESECPEKEKLPQEWKNKTALQRLCMLRAMRPDRMTYALRDFVEEKLGSKYVVGRALDFATSFEESGPATPMFFILSPGVDPLKDVESQGRKLGYTFNNQNFHNVSLGQGQEVVAEAALDLAAKKGHWVILQNIHLVAKWLSTLEKKLEEHSENSHPEFRVFMSAEPAPSPEGHIIPQGILENSIKITNEPPTGMHANLHKALDNFTQDTLEMCSRETEFKSILFALCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNFLEANAKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLGEFIRPEMLEGELSLAPGFPLPGNMDYNGYHQYIDAELPPESPYLYGLHPNAEIGFLTQTSEKLFRTVLELQPRDSQARDGAGATREEKVKALLEEILERVTDEFNIPELMAKV--EERTPYIVVAFQECGRMNILTREIQRSLRELELGLKGELTMTSHMENLQNALYFDMVPESWARRAYPSTAGLAAWFPDLLNRIKELEAWTGDFTMPSTVWLTGFFNPQSFLTAIMQSTARKNEWPLDQMALQCDMTKKNREEFRSPPREGAYIHGLFMEGACWDTQAGIITEAKLKDLTPPMPVMFIKAIPADKQDCRSVYSCPVYKTSQRGPTYVWTFNLKTKENPSKW 4475          
BLAST of DNAHb-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|20328990 (tr|A0A0H3YKL3|A0A0H3YKL3_SCHMD DNAHb-1 OS=Schmidtea mediterranea OX=79327 GN=DNAHb-1 PE=2 SV=1)

HSP 1 Score: 8850.72 bits (22965), Expect = 0.000e+0
Identity = 4457/4457 (100.00%), Postives = 4457/4457 (100.00%), Query Frame = 1
Query:   61 MASELELNDKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            MASELELNDKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNLVVKKHDELLELLKKHEMKYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNTKKVAVTVKQTVAPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALVTEVEETTNVVKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSLAKLKFLKEAEEENTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTVLSESVSSVEEKSRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISVEVLSVVAVQVKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDLAKAEPALQAAQEALNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDALEAANEELREATEKLSGIQNKIKQLEDQLQKLQDEFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWLSALEKKLEEYAEESHESYRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSLKELDLGLKGELTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW
Sbjct:    1 MASELELNDKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNLVVKKHDELLELLKKHEMKYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNTKKVAVTVKQTVAPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALVTEVEETTNVVKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSLAKLKFLKEAEEENTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTVLSESVSSVEEKSRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISVEVLSVVAVQVKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDLAKAEPALQAAQEALNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDALEAANEELREATEKLSGIQNKIKQLEDQLQKLQDEFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWLSALEKKLEEYAEESHESYRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSLKELDLGLKGELTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 4457          
BLAST of DNAHb-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|21097692 (tr|A0A2T7Q0D5|A0A2T7Q0D5_POMCA Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01763 PE=4 SV=1)

HSP 1 Score: 6352.31 bits (16479), Expect = 0.000e+0
Identity = 3150/4463 (70.58%), Postives = 3710/4463 (83.13%), Query Frame = 1
Query:   61 MASELELNDKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVS---GNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQ--IEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLG-SNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            M  ELELND R EF+ DY LK+LK K+D+F K+++ DE+KQ+  DFFEK +I  + ++    GG LN+Q E+P N K KAC+F KK+KE I++DA     L++GD+S  PLDQ S+FVDEV++P+LSN KN + WP V+S DV RH ++LK    VV GQ+KGKTLLPLPVG+++V   + +   E  R++++AIETVVIEW HQI DVL + S++ L+ GL+PTPFVE+ +W+ ++ NLECIYEQL+ PKV+KMA LLE   S+Y+P +K  F+ VV AL E+Q+IN+YL PLR   E++EQ EF    PM+ PL H +CL+WA+ K Y  P RI+VL QEI N+II    ++L P EIFKGE EE ++KV ++ K+L  FKES+E HR+K+K+YFKDGAEP EW+FAS L+FGR + F  R++ ++ +++  +EF KLEKVE+ G++G+ LS  +V +FE+F   +K F E TYDCLDP + +FL+ Y  F   I D+DRR+AT + Q F DC   +A FKLIDI G LLDR ++K +FD +Y  +VKM+DE+++  K +YD  ++    N   P +HKNMPKV+G L W KEMR+RI  P+    HL+H   ++ +  LV  K++E++ LL + +   Y +W+ GVDE CSFNL++PL+ RN +T  ISVNFD KL AVLREVKYL+I  +EEIP SA  ++SKN+  RK++ NLDL V+WYN +R+  L VE PLIE +L  ID QLE+A  +L W S+    G W+YIEQ RD VH+L +RV K+K+N++ I+ IM+ W K PLFERKE K DTLLNLDDREDR NKRY +I  AG+R+H L+ +N E  KA   +E WK YVD +D+M+VE F  TI  SLQ++++   ++ S DPL+E  ++LQ  E+VF PSLD +    F +LVD LV DI++Q+S + RLA  S  E Y+ D++E EEL + R E+ +R +    KA  Y+  FD Y+ LW D+R EFM QFL Y   ++AEE+EAH ++ +    E PPTL+QFK QID YEK ++E ++M+G  I D WFR+D + FKQA LN IKRWS MFKQHLIDHVTNSLKELAEFIK T+SGL KE  EGD+EGLV +MGHL  VKERQ ATDEMFEPLKQTI+LLK Y+QEMP+EVH+QL+ELPE WNNTKK+++TVKQ VAPLQ  EVANIRRK A+FDV QH FRE+FR + PF + C   Y  LDR H EI  +EK M  L ESA LFEV VP+FKQLKQCRKE++LLK+LWD+I +V SSIE WK T WK INVEQMD DCK FAK IRSLDKEMR+WDAYTG+E+ +KNM+TS RAV+ELQNPAIRDRHW QLMAATKV+F M+ESTTL DLL LNLHN+E+EVR+IV+KAVKEMSMEKVLKEL STW+ MEFEHEKH RT IT+LK SEELIETLE++QV+LQNMMTSKYI+HF  EV SWQK LSTADQVI I  EVQRTWSHLESIFIGS+DIR QLPEDS+RFD IDTDFK LV+++E T NVV++T +PRLYERLE +Q +L LCEKALAEYLETKRLAFPRFYFVSS+DLLDILSNGN+P  V +HLTKLFDS+AKLKF K++E  + KV + M++KDGE V+    CDLGGQVE WLNRLLE    T+R  ++E+V   EEK RDQW+F+FPAQVAL  +QI W TEV ++F RLEEGYENALKD+NKKQ+ QLNALIT+L+G+LS  DRQK+MTICTIDVH RDVV K+ITQK+++SQ+F WL QLRHRW + +KDC  NICDAQFRY+HEYLGNTPRLVITPLTDRCYITLTQSLHL MSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKS+GNIYKGLAQSG+WGCFDEFNRI+VEVLSVVAVQVKCIQDAI++K+  F+FLGE I L   +GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGF+ AR+LARKFITLY LC+ELLSKQDHYDWGLRAIKSVLVVAGALKR+D  RPEDQVLMRALRDFNIPKIVTDD PVFMGLIGDLFPALDVPRKRD +FEK +RQATLD KLQ E+NF+LKVVQL+EL  VRHSVFVLGNAG+GKS VW TL +TY NL +KP A DL+PKAVTNDELFG+INP+TREWKDGLFSVIMRDLAN+  DGPKWIVLDGDIDPMWIESLNTVMDDNK+LTLASNERIPLTP+MRL+FEISHLKTATPATVSRAGIL++NPQDLGW P+V SWI  RE+QSE+ANLTILFDKYVP+CLE L+ RFKKITPIVEISHVQMLCHLLE LL PENTP DCPKE YELYFVF  +WAFGSCMFQDQLVD+RVEFTKWW T+FKTIK P  GTVFDYYID ETKKFEPWTK++ KFE D E PLQA LV TSETTR RYFLD+LI+KRRPVMLVG AGTGKTVL+Q+KL+++ D+++VANVPFNFYTTSEMLQRVLEKPLEKKAGRN+GP G+++LIYF+DDMNMPEVDKY+TVQPHTLIRQHID+ HWYDRAKLTLKEIHNTQY++CMNPTAGSFTI  RLQRHFCVFA+SFP Q++L  IY +ILS+ L  +NF   + K   NLV+ AL  H KI STFLPTAIKFHYVFNLRDLSNIFQG+LF+GPDC K P +L+RLW+HE +RVY DKLID+ D+ T+ ++QKE  KK FE+ DE  +F KPL+YCHFAQGIGE KY+PV    +L+KIL EAL++YNE+NAAMNLV+FEDA+ H+ RINRILESPRG ALL+GVGGSGKQSLSRLAA ISSL+VFQI+L+KGY I DLK DLAALY K+G+K IGVVFL+TDAQ+++E+FLVL+NDLLASGEI +LF DDE+E +I+ +RNEVK  GM D+RENCW FFI+KVR  L++VLCFSPVG+TLRVR+RKFPAV NCTSIDWFHEWPE+ALISVS RFL++V+ +    ++S +KFM++VHK+VN++S  YL NERRYNYTTPKSFLEQI LY N+LKKK+ ELQ K+ RLENGL+KL STA QVDDLKAKLA+QEVEL QKN  AN+L++ V  +T+KVS EK IAD EE KVSKI  EV  KQ+DCE DLAKAEPAL AA+EALNTLNKNNLTE+KSFGTPP AV +V+AA MCL+A  GKVPKD+SWK AKA IMGKID FLDNLINY+KDNI E   KA + Y  DP F PE I++KS AAAGLCSW INI+ YY +FC+V+PKR AL  AN +L  A EKL  I+ K+  LE  L KLQ EFE A ++K RCQ EA++T KTIELANRLVGGLASENVRW + +++Y++ EKTLPGD L+  AF+SYVGCFTK YR  L+D  WLP+L  L   IP+++ LDPL ML+DDA IA WNNEGLP DRMS ENATILTN ERWPL+IDPQLQGIKWIKTR+GADLKVVRLG KGYLD+IE+AVS GDVVL+EN+ E+MDPVLD LLGRNTIKKGRAIK+GDKE EYN +FRLILQTKLANPHYKPEMQAQTT+INFTVTRDGLEDQLL  VV+KER DLE LK DLT+QQN+FKITLKELED+LL RLSAAEGNFLGDY LVENLE  KRTA EIE K ++AK TEV IN  RE YRPAAARAS+LYF++NDL+KINPMYQFSLKAF VVF+KAID+A+PS+E+K RV+NLID IT+SV++YT+RGLFEKDKLIF  QM+FQIL+  KEIN  ELDFLLRFP  PN+T+P+DFLSNNSWGGIKALS +EEF+NLDRDIEGSAKRWKKFVESE PEKEKFPQEWKNKTSLQ+LCMMRALRPDRM+YAV  FV+EKLG KYVEG  +EF++S+EESGPATPIFFILSPGVDPLKDVE LGKKLGF+ D++NF NISLGQGQEIVAE+AM+L AK+GHWVVLQN+HLV+KWL  LEK LEEYAE S+E+YR+FISAEP+GSP++HIIPQGILE+AIKITNEPPTGM ANLHK+L+NFNQET+EMCA+ENEFK+ILFALCYFHAVV ERRKFGP GWNR YPFNTGDL ISVNVLYNYLEAN+KVPW DLRYLFGEIMYGGHITDDWDR LC+TYLE Y+ P+M DGEL + PGF +PPN+DYKGYH YIDE LP ESPYLYGLHPNAEIEFLT++ D LF+TV EMQPRDS   G TG SREE++K +LD+I+EKLPD+FNM EI AKVPPEER PYVVVAFQECERMNMLTSE+RRSLKELDLGLKGELTITADME LSN+L++DV+P  W++RAYPSLY LA WYADLL RIKELE WT+DFQLP+ +WL G FNPQSFLTAIMQQMARKNEWPLDRM LQCDVTKK +EDM GPPR+GAYVHGL+MEGARWDTQ+GMI EA+LKEL P MPVIFIKAIPVDRQDLR +Y CPVYKTK RGPTFVWTFNLK+KEK SKW
Sbjct:    1 MTDELELNDTRVEFMADYTLKTLKCKADRFAKMYSLDESKQLFTDFFEKSDIMSILIIATASGG-LNVQYEWPNNPKGKACYFVKKSKEPITKDANLRTTLLYGDMSQFPLDQLSAFVDEVLVPLLSNEKNHDHWPKVVSEDVKRHVHNLKSNVYVVCGQAKGKTLLPLPVGADRVETVEEDKSDEYDRTLVHAIETVVIEWTHQIRDVLKRDSAQPLLEGLHPTPFVEIKFWENKAQNLECIYEQLSDPKVRKMAELLEKTKSSYSPSYKSTFRDVVEALHEAQDINMYLKPLRRLFEDLEQAEFDMCAPMLPPLLHTVCLVWANSKYYNTPARIIVLLQEICNMIIEMARNFLAPDEIFKGEVEETIDKVRKANKVLLSFKESYEEHRKKLKDYFKDGAEPREWEFASELVFGRYDLFTMRVQTIETLMDTAMEFMKLEKVELGGVQGKTLSAQVVSVFEDFNEQYKVFAEGTYDCLDPTQPEFLRVYENFVEKISDIDRRMATIICQGFDDCSGLEATFKLIDIMGSLLDRELIKADFDSKYPLIVKMMDEDLDEVKAIYDQQMAFKKANGWAP-VHKNMPKVSGSLRWSKEMRDRISVPMGKFKHLEHPCMQSEDAQLVFTKYEEMMNLLAQWDKDVYQDWIAGVDEACSFNLNRPLISRNEETKLISVNFDQKLVAVLREVKYLEIRAEEEIPPSAAAMYSKNEMFRKFLANLDLTVQWYNKVRRTVLEVEFPLIEGQLQDIDVQLEQAEKSLNWESE----GVWEYIEQTRDKVHDLETRVQKAKDNVEDIQKIMTTWSKQPLFERKEEKNDTLLNLDDREDRLNKRYTDIKAAGQRIHDLLAQNREFFKASPETETWKAYVDYVDEMVVEGFFNTIKCSLQFLLNNTDLKLSPDPLYEARLELQVPEMVFMPSLDFNVPYGFYDLVDGLVGDIYRQSSLIPRLASHSGQEHYQPDMDETEELSEMRQELMDRVQTIMNKANEYRNSFDNYAYLWVDDRNEFMRQFLLYNHVLTAEEIEAHADEGVP---ENPPTLNQFKEQIDTYEKIYQEADQMSGITIFDSWFRVDAKPFKQALLNIIKRWSFMFKQHLIDHVTNSLKELAEFIKSTDSGLQKEVKEGDYEGLVFVMGHLFAVKERQAATDEMFEPLKQTIELLKAYDQEMPEEVHMQLQELPEHWNNTKKISITVKQQVAPLQANEVANIRRKSASFDVNQHKFREKFRSIPPFRYDCERPYLLLDRNHEEIQFMEKEMAMLIESAGLFEVNVPDFKQLKQCRKEIKLLKLLWDYIIIVRSSIEDWKTTPWKGINVEQMDLDCKKFAKDIRSLDKEMRAWDAYTGLENTVKNMLTSNRAVSELQNPAIRDRHWQQLMAATKVRFMMDESTTLADLLSLNLHNYEEEVRNIVDKAVKEMSMEKVLKELDSTWTAMEFEHEKHPRTNITMLKTSEELIETLEDNQVQLQNMMTSKYIAHFLTEVSSWQKKLSTADQVISIHMEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDTDFKELVSQMERTKNVVESTNQPRLYERLEALQGQLSLCEKALAEYLETKRLAFPRFYFVSSSDLLDILSNGNNPTSVARHLTKLFDSMAKLKFEKDSEGNDAKVALGMFSKDGEYVDMDQACDLGGQVEIWLNRLLERQCATVRHEMTEAVQGYEEKPRDQWLFDFPAQVALCGTQIWWTTEVNIAFGRLEEGYENALKDYNKKQVAQLNALITMLLGDLSSGDRQKIMTICTIDVHARDVVSKMITQKVESSQAFLWLSQLRHRWDEGEKDCLANICDAQFRYSHEYLGNTPRLVITPLTDRCYITLTQSLHLIMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSVGNIYKGLAQSGAWGCFDEFNRIAVEVLSVVAVQVKCIQDAIRDKKSVFNFLGENIKLKQTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIDARLLARKFITLYSLCRELLSKQDHYDWGLRAIKSVLVVAGALKRNDRGRPEDQVLMRALRDFNIPKIVTDDLPVFMGLIGDLFPALDVPRKRDLDFEKQIRQATLDQKLQPEDNFILKVVQLKELLEVRHSVFVLGNAGSGKSKVWNTLQRTYKNLGQKPTAADLDPKAVTNDELFGVINPATREWKDGLFSVIMRDLANMGGDGPKWIVLDGDIDPMWIESLNTVMDDNKILTLASNERIPLTPSMRLIFEISHLKTATPATVSRAGILFVNPQDLGWNPYVQSWIDKREVQSERANLTILFDKYVPMCLEVLRTRFKKITPIVEISHVQMLCHLLECLLTPENTPPDCPKELYELYFVFSCVWAFGSCMFQDQLVDYRVEFTKWWTTDFKTIKFPTAGTVFDYYIDPETKKFEPWTKKVPKFEFDPELPLQAALVHTSETTRIRYFLDMLIDKRRPVMLVGNAGTGKTVLMQNKLSNLSDDFMVANVPFNFYTTSEMLQRVLEKPLEKKAGRNFGPPGTRRLIYFVDDMNMPEVDKYYTVQPHTLIRQHIDHGHWYDRAKLTLKEIHNTQYVSCMNPTAGSFTIDSRLQRHFCVFAISFPNQDALSTIYMSILSQHLALANFLGPVQKFSQNLVNGALGLHAKIASTFLPTAIKFHYVFNLRDLSNIFQGLLFSGPDCCKTPLELIRLWLHETDRVYRDKLIDETDLATFDKVQKETVKKCFEDADENFVFSKPLIYCHFAQGIGEAKYLPVVGWPELNKILVEALDNYNELNAAMNLVMFEDAMMHVCRINRILESPRGNALLIGVGGSGKQSLSRLAASISSLEVFQISLKKGYAIPDLKADLAALYRKSGLKGIGVVFLMTDAQVSNEQFLVLINDLLASGEIPELFADDEVEEVIAGVRNEVKGLGMEDTRENCWRFFIDKVRRLLKVVLCFSPVGATLRVRSRKFPAVTNCTSIDWFHEWPEEALISVSARFLEDVD-VDSQTRESISKFMAYVHKSVNEISQQYLINERRYNYTTPKSFLEQITLYQNLLKKKNLELQAKIVRLENGLEKLRSTASQVDDLKAKLASQEVELAQKNEDANKLIQVVGAETEKVSKEKAIADEEEAKVSKITIEVEAKQRDCEEDLAKAEPALLAAKEALNTLNKNNLTELKSFGTPPTAVTNVTAAVMCLLAPGGKVPKDKSWKNAKATIMGKIDQFLDNLINYDKDNIHENCRKAVQPYLDDPEFEPEFIRAKSFAAAGLCSWAINIMRYYTVFCEVEPKRIALAQANSDLNTAREKLRVIKAKVSDLEAALAKLQAEFEHATAEKLRCQQEAEMTAKTIELANRLVGGLASENVRWAESIKEYRVNEKTLPGDTLMITAFVSYVGCFTKRYRTELLDNCWLPYLKGLKYPIPVSEGLDPLTMLIDDADIAGWNNEGLPGDRMSTENATILTNCERWPLMIDPQLQGIKWIKTRYGADLKVVRLGSKGYLDIIERAVSNGDVVLLENLGETMDPVLDSLLGRNTIKKGRAIKMGDKEVEYNKDFRLILQTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLGAVVSKERPDLEKLKSDLTRQQNEFKITLKELEDNLLARLSAAEGNFLGDYELVENLETTKRTAAEIEVKAKEAKHTEVEINLARENYRPAAARASLLYFLMNDLHKINPMYQFSLKAFSVVFDKAIDKADPSDEVKQRVKNLIDCITYSVFVYTTRGLFEKDKLIFITQMTFQILMMNKEINSVELDFLLRFPATPNVTTPVDFLSNNSWGGIKALSNMEEFRNLDRDIEGSAKRWKKFVESECPEKEKFPQEWKNKTSLQKLCMMRALRPDRMSYAVRGFVEEKLGGKYVEGRSIEFAKSYEESGPATPIFFILSPGVDPLKDVEALGKKLGFTDDSRNFHNISLGQGQEIVAEQAMELAAKDGHWVVLQNVHLVAKWLPKLEKTLEEYAEVSNENYRLFISAEPAGSPDAHIIPQGILESAIKITNEPPTGMYANLHKALDNFNQETLEMCARENEFKSILFALCYFHAVVCERRKFGPIGWNRVYPFNTGDLTISVNVLYNYLEANAKVPWTDLRYLFGEIMYGGHITDDWDRTLCRTYLEVYMHPDMFDGELYLAPGFPIPPNSDYKGYHTYIDEALPPESPYLYGLHPNAEIEFLTTLCDNLFRTVLEMQPRDSGSGGGTGASREEKVKALLDEILEKLPDEFNMTEIMAKVPPEERTPYVVVAFQECERMNMLTSELRRSLKELDLGLKGELTITADMEELSNALFLDVVPAKWARRAYPSLYNLAAWYADLLQRIKELETWTSDFQLPAAVWLAGFFNPQSFLTAIMQQMARKNEWPLDRMVLQCDVTKKTREDMAGPPREGAYVHGLYMEGARWDTQTGMITEARLKELNPQMPVIFIKAIPVDRQDLRGMYQCPVYKTKTRGPTFVWTFNLKSKEKVSKW 4453          
BLAST of DNAHb-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|23904157 (tr|K1PAG1|K1PAG1_CRAGI Dynein beta chain, ciliary OS=Crassostrea gigas OX=29159 GN=CGI_10005381 PE=4 SV=1)

HSP 1 Score: 6333.05 bits (16429), Expect = 0.000e+0
Identity = 3123/4464 (69.96%), Postives = 3705/4464 (83.00%), Query Frame = 1
Query:   61 MASELELNDKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVS--EGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPK--IHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEG--SKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLG-SNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            MASELELND R EFI DYV+K+LK K DK+ K+++ ++T+QM +DFFEK ++  L V     GG LN Q E+P N K+KAC+F KK +++I ++  F    ++GD+SY PLDQ S+FVDEV++P+LSN +N E WP V+S DV RH ++LK    VV GQ+KGKTLLPLPVG+EKV   E D +S     R++I+AIE+V+I+W HQI DVL K S++ L+ G NPTPFVE+++WK ++ NLECIY+QL  PKV+KMA +LE   S+Y P FK IF+ VVAAL E+Q+IN+YL PLR+  E+ EQ EF E  P++ P+ H  CL WA+ + Y  P RI+VL QE+ N+IIN   ++LDP EIFKGE EE +EKV ++  +L+ ++ ++E H+E++K YF +G EP  W+FA  L+F R + F+ R++ V+ ++   LEF KLEKVE+ GIKG+ LSQ +V + EEF+  +  FT +TYDCLDP   +FL DY  F   I D DRRLAT + Q F DC   ++VFKL+DI G LL+R ++K +FD++Y  +VKM+D+E++  K +YD  ++  ++  K  +HKNMPKV+G L W +E+RERI  P+     LDH+  +     LV  K++E+  LL + + + Y  W  GV E CSFNLSQPL++R+ +T  ISVNFD +L AVLREVKYL+   QE+IP SA +++  NDTL KY+ NLDL V  YN +R   L VE PLIE +L  ID QLE+A  +L W S     G W+YIE+ RD + +L  RV ++K+N++ ++ +M+ W K PLFERKE KYDTLLNLDDR++R NKRY+EI   GE++HGL+++N EL KAD  ++ WK YVD +D+MIV+ F  TI+ SL++++DQ +   + +PLFE  ++LQ  E+VF PSLD   AD F +LVD LV D++KQAS ++RLA  S  E Y+ DLE+ EEL + R E+ +R +    KA  Y+  FD YS LW D+R EFM QFL Y   ++ EE+EAH E  +    E PPTL+QFK QI+ YEK ++E EK+    I + WFR++ + FKQA LNTIKRWS MFKQHLIDHVTNSLKELAEFIK T+SGL K   EGD+ GLV+ MG+L  VK+RQ  TDEMFEPLKQTI+LLKTY QE+P+EVH QL+ELPE+WNNTKK+A+TVKQ VAPLQ  EVANIRRK ATFDV QH FRE+FR + PF F C + Y  LD+ H EIS +EK M EL +SA LFEV +P+FKQLKQCRKE++LLK LWD+I +V SSI+ WK T WK+INVEQMD DCK FAK IR+LDKEMR+WD+Y G+E+ +KNM+TSLRAV+ELQNPAIRDRHW QLM ATKV+F M++STTL DLL LNLHNFED+VR IV+KAVKEMSMEKVLKEL +TW+ MEFEHE H RT IT+LK SEELIETLE++QV+LQNM++SKYI+HF  EV  WQK LSTADQVI IW EVQRTWSHLESIFIGS+DIR QLPEDS+RFD IDTDFK LVTE+E+  NVV+AT +P LYERLE +Q +L LCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGN+P  V +HLTKLFDS+AKLKF ++ +  +TK+  +MY+KDGE+VE    CDL GQVE WLN LL+ MR+T+R  ++E+V++ EEK RDQW+F+FPAQVAL  +QI W TEV ++F RLEEGYENALKD+NKKQI QLN LITLL+G+L+  DRQK+MTICTIDVH RDVV KLI  K+D+SQ+F WL QLRHRW D DKDC+ NICDAQFRY+HEYLGNTPRLVITPLTDRCYITLTQSLHL MSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKS+GNIYKGLAQSG+WGCFDEFNRI+VEVLSVVAVQVKCIQDAIK K+K F+F+GE I L   +G+FITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFL+AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAGALKR DPDRPEDQVLMRALRDFNIPKIV DD P+FMGLI DLFPAL+VPRKRD + EK ++QATLD KLQ E+NF+LK+VQLQEL  VRHSVFVLG AG GKS VW TL +TY N  KKP A+DL+PKAVTN+ELFGIINPSTREWKDGLFSVIMRDLAN++ DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTP+MRL+FEISHL+TATPATVSRAGIL+INPQDLGW P+  SWI  RE+QSE+ANLTILFDKYVP+CLE ++ RFKKITP+ + SH+QMLC+LLE LL PENTP DC KE YELYFVF  +WAFG   FQDQLVD+RVEFTKWW TEFKT+K P  GTVFDYYID ETKKFEPWTK + KFE+D E PLQA LV TSETTR +YFLD+L++KRRPVMLVG AGTGKTVL+ DK+N + ++++VAN+PFNFYTTSEMLQR LEKPLEKKAGRN+GP G+++LIYF+DDMNMPEVDKYFTVQPHTLIRQHID+SHWYDRAKLTLKEIHNTQY+ACMNPTAGSFTI  RLQRHFCVF+++FP  E+L  IY++IL + L  S FS  + K  S L++ AL    K+ +TFLPTAIKFHY+FNLRD+SNIFQG+LFA P+C K P +LVRLW+HE ERVY DKL D+ D+ET+ +L K++ KK+FE++DE ++FK+PLLYCHFAQG+G+PKY  VE   +L+KIL EAL+SYNE+NA MNLVLFEDA+ H+ RINRILESPRG ALL+GVGGSGKQSLSRLAA ISSL+VFQITLRKGY I DLKLD++ LY+K G+KN+G+VFL+TDAQ+ADEKFLVL+NDLLASGEI DLFPDDE+ENII+ +RNEVK  GM DSRENCW FFI+KVR TL++VLCFSPVGSTLRVR+RKFPAV NCTSIDWFHEWPEDAL SVS RFL+EVELL  D + S A FMS+VHK+VN++S SYLQNE+RYNYTTPKSFLEQI LY N+L K ++ELQ K+ RLENGL+KL STA QVDDLK+KLA+QEVEL QKN  AN+L+  V  +T+KVS EK IAD EE+KV++I  EV+KKQ DCERDLAKAEPAL AA+EALNTLNK NLTE+KSFG+PP AV++V++ACMCL+A  GKVPKDRSWKAAK+ IMGKID FLDNLINY+KDNI E  LKA + Y  DP F+PE I+SKSLAAAGLCSW INI+ YY ++C V+PKR AL  AN EL  A EKL  I NKI+ LE  L KL  EFEKA ++K RCQ EA++T KTIELANRLVGGLASENVRW   ++ ++ +E TLPGDVL+  AF+SYVGCFTK YRL LMD +W+P+L  L   IP+++ LDPL +L DDA IASWNNEGLPSDRMS ENATILTN ERWPL+IDPQLQGIKWIKT++GADLKV+RLGQKGYLD +E+A+++GDVVL+ENIEES+DPVLD L+GRNTIKKGRAIK+GDKE EY+P+FRLILQTKLANPHY+PEMQAQTT+INFTVTRDGLEDQLLA VV KER DLE LK DLT+QQN+FKITLK+LED+LL RLS+AEGNFLGDYALVENLE  KRTA EIE K  +AK TE+ IN  RE YRPAAARAS+LYFILNDL+KI+PMYQFSLKAF VVFEKAIDRAE +EE+K RV NLID ITFSV+ YT+RGLFE+DK+IFT+QM+F IL+   +INP ELDFLLRFP VPN+TSP+DF+SNNSWGGIKA++ +EEF+NLDRDIEGSAKRWKKFVESE PEKEKFPQEWKNKTSLQ+LCMMRALRPDRMTYAV ++V+EKLG KYVEG  VEF++S+EESGPATP+FFILSPGVDPLKDVE LG+ LGF+ D  NF NISLGQGQE+VAE AMDL AKEGHWVVLQN+HLV+KWL+ LEKKLE+Y+ ESHE+YRV+ISAEP+G+ +SHIIPQGILE AIKITNEPPTGM ANLHK+L+NF Q+T+EMCA+E EFK+ILFALCYFHAVV ERRKFG QGWNR YP+NTGDL IS+ VLYNYLEAN+KVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLE YL P+MLDGEL + PGF VPPN+DYKGYHNYIDECLP ESPYLYGLHPNAEIEFLT+ S+ LFKTV EMQPRDS  +   G+SREE+IK ILD+I+EKLP++FNM+EI AKVPPEER PYV+VAFQECERMNMLT+EIRRSLKELDLGLKGELTIT+DME L N+L+MD IPESW+K+AYPSLYGL  WYADLLLR+KELE W++DFQLP+ +WLGG FNPQSFLTAIMQQMARKNEWPLDRM LQCDVTKK +EDM GPPR+GAYVHGLFMEGARWD Q+GMI EA+LKEL P+MPVIFI+AIPVDRQD RN+Y CPVYKTK RGPTFVWTFNLK+KEK SKW
Sbjct:    1 MASELELNDTRVEFIADYVIKTLKIKPDKWSKMYSVEDTRQMFMDFFEKQDVPCLIVTATAAGG-LNTQFEWPNNPKAKACYFVKKGRDAIQKETNFRNAYLYGDMSYQPLDQLSAFVDEVLVPLLSNDRNHEQWPHVVSKDVTRHVHNLKSNVYVVCGQAKGKTLLPLPVGAEKVEQVEDDKDSLD---RALIHAIESVIIDWTHQIRDVLKKDSAQPLLEGHNPTPFVEIEFWKNKATNLECIYDQLRDPKVRKMAEILERTQSSYFPTFKDIFRDVVAALTEAQDINIYLKPLRHHFEDFEQAEFDESIPLLAPMMHTTCLTWANSEYYNTPARIIVLLQEMCNMIINMARNFLDPSEIFKGEIEETIEKVRKACNVLDAYRNTYEDHKERLKSYFPEGTEPRLWEFAPKLVFARYDKFVERVKTVRELMETALEFMKLEKVELGGIKGKLLSQQVVQLHEEFQEQYGVFTNKTYDCLDPGSNEFLDDYQAFLDKISDFDRRLATIICQGFDDCSGLESVFKLLDIMGSLLERELIKKDFDEKYPLIVKMIDKELDTAKSIYDEQMAAKKEGGKAVLHKNMPKVSGSLRWAQELRERITAPMGNFKALDHRCMEEEGAKLVFTKYEEMCNLLSQWDEEIYKEWAAGVSEACSFNLSQPLVVRDEETKLISVNFDPQLTAVLREVKYLESSSQEDIPASAAEMYKSNDTLWKYLTNLDLSVHLYNKVRNTILEVEFPLIEGQLQDIDVQLEQAEKSLNWES----QGVWEYIEKTRDQITDLEKRVQQAKDNVEEVKTLMATWSKQPLFERKEDKYDTLLNLDDRKERLNKRYEEIKNIGEKIHGLLQKNLELFKADGNADTWKAYVDYVDEMIVDGFFNTIHCSLKFLLDQTDNKNNPNPLFEAHLELQVPEMVFLPSLDYGVADGFYDLVDGLVGDVYKQASLIRRLAAHSGQEHYQPDLEDMEELSEMRQELMDRIQNIMNKACEYRNTFDNYSYLWVDDRNEFMRQFLLYNHVLTTEEIEAHAEDGVP---ECPPTLNQFKEQINTYEKIYDEAEKIEPLTIFEHWFRVNSKPFKQALLNTIKRWSFMFKQHLIDHVTNSLKELAEFIKTTDSGLMKPVEEGDYNGLVDCMGYLFAVKDRQATTDEMFEPLKQTIELLKTYEQELPEEVHQQLQELPEQWNNTKKIAITVKQQVAPLQATEVANIRRKTATFDVSQHKFREKFRSIPPFRFDCDKPYAHLDKYHEEISAMEKEMVELMDSAGLFEVNIPDFKQLKQCRKEIKLLKTLWDYIIMVQSSIDDWKTTFWKEINVEQMDMDCKKFAKDIRALDKEMRAWDSYLGLENTVKNMLTSLRAVSELQNPAIRDRHWQQLMVATKVRFVMDDSTTLADLLSLNLHNFEDDVRGIVDKAVKEMSMEKVLKELDATWTTMEFEHEPHPRTKITMLKTSEELIETLEDNQVQLQNMLSSKYIAHFLQEVSQWQKKLSTADQVISIWMEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDTDFKELVTEIEKYKNVVEATNQPNLYERLEGLQGQLTLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNNPTAVSRHLTKLFDSMAKLKFNEDDKGNDTKIATSMYSKDGEVVELDKPCDLAGQVEHWLNNLLDAMRSTVRHEMTEAVATYEEKPRDQWLFDFPAQVALCGTQIWWTTEVNIAFGRLEEGYENALKDYNKKQIQQLNNLITLLLGKLTSGDRQKIMTICTIDVHARDVVAKLIATKVDSSQAFAWLSQLRHRWDDNDKDCFANICDAQFRYSHEYLGNTPRLVITPLTDRCYITLTQSLHLIMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSVGNIYKGLAQSGAWGCFDEFNRIAVEVLSVVAVQVKCIQDAIKEKKKVFNFMGETIKLVWTVGLFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLEARLLARKFITLYSLCKELLSKQDHYDWGLRAIKSVLVVAGALKRGDPDRPEDQVLMRALRDFNIPKIVIDDLPIFMGLISDLFPALNVPRKRDMDLEKQIKQATLDQKLQPEDNFILKIVQLQELLDVRHSVFVLGFAGVGKSKVWGTLNRTYKNQGKKPSAIDLDPKAVTNNELFGIINPSTREWKDGLFSVIMRDLANMSGDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPSMRLIFEISHLRTATPATVSRAGILFINPQDLGWIPYTQSWIDKREVQSERANLTILFDKYVPMCLETMRTRFKKITPVADNSHIQMLCYLLECLLTPENTPPDCAKELYELYFVFAVVWAFGGVTFQDQLVDYRVEFTKWWTTEFKTVKFPTTGTVFDYYIDPETKKFEPWTKMVPKFELDPELPLQAALVHTSETTRIKYFLDMLVDKRRPVMLVGTAGTGKTVLMGDKMNGLSEDFMVANIPFNFYTTSEMLQRTLEKPLEKKAGRNFGPPGTRRLIYFVDDMNMPEVDKYFTVQPHTLIRQHIDHSHWYDRAKLTLKEIHNTQYVACMNPTAGSFTIDSRLQRHFCVFSINFPNAEALATIYTSILQQHLAMSGFSQGVQKYCSTLINGALALQAKMATTFLPTAIKFHYIFNLRDMSNIFQGLLFAQPECAKTPVELVRLWLHEAERVYRDKLTDEKDMETFDKLAKDIVKKSFEDIDEALLFKQPLLYCHFAQGVGDPKYNAVEGWPELNKILVEALDSYNELNAVMNLVLFEDAMMHVCRINRILESPRGNALLIGVGGSGKQSLSRLAASISSLEVFQITLRKGYSIADLKLDISQLYIKTGLKNMGMVFLMTDAQVADEKFLVLINDLLASGEIPDLFPDDEIENIINGVRNEVKGLGMEDSRENCWRFFIDKVRRTLKVVLCFSPVGSTLRVRSRKFPAVTNCTSIDWFHEWPEDALNSVSARFLEEVELLAPDMRISIANFMSYVHKSVNEMSSSYLQNEKRYNYTTPKSFLEQIKLYQNLLNKNNSELQAKIIRLENGLEKLRSTATQVDDLKSKLASQEVELAQKNEDANKLIAIVGAETEKVSKEKAIADDEEKKVAQINIEVTKKQMDCERDLAKAEPALLAAKEALNTLNKGNLTELKSFGSPPSAVVNVTSACMCLLAPGGKVPKDRSWKAAKSSIMGKIDLFLDNLINYDKDNIHEACLKAIQPYLDDPEFDPEFIRSKSLAAAGLCSWCINIVGYYRVYCTVEPKRIALAQANAELAAAQEKLRVITNKIQSLESDLAKLTAEFEKATNEKLRCQQEAEMTAKTIELANRLVGGLASENVRWADSIKDFRKQELTLPGDVLLITAFVSYVGCFTKQYRLDLMDKHWVPYLKGLKIPIPVSEGLDPLTLLTDDAQIASWNNEGLPSDRMSTENATILTNCERWPLMIDPQLQGIKWIKTKYGADLKVLRLGQKGYLDALERALASGDVVLLENIEESVDPVLDPLIGRNTIKKGRAIKIGDKEVEYHPDFRLILQTKLANPHYQPEMQAQTTLINFTVTRDGLEDQLLAAVVRKERPDLEKLKADLTRQQNEFKITLKKLEDNLLARLSSAEGNFLGDYALVENLETTKRTAAEIEVKATEAKKTEIDINLARENYRPAAARASLLYFILNDLHKIHPMYQFSLKAFSVVFEKAIDRAEAAEEVKQRVLNLIDCITFSVFTYTARGLFERDKIIFTSQMTFLILMAANDINPVELDFLLRFPAVPNVTSPVDFMSNNSWGGIKAMANMEEFRNLDRDIEGSAKRWKKFVESECPEKEKFPQEWKNKTSLQKLCMMRALRPDRMTYAVTNYVEEKLGTKYVEGRSVEFAKSYEESGPATPMFFILSPGVDPLKDVEALGRTLGFNEDKGNFHNISLGQGQEVVAEAAMDLSAKEGHWVVLQNVHLVAKWLATLEKKLEQYSVESHEAYRVYISAEPAGTADSHIIPQGILEAAIKITNEPPTGMFANLHKALDNFTQDTLEMCARETEFKSILFALCYFHAVVCERRKFGAQGWNRVYPYNTGDLRISMMVLYNYLEANAKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEVYLHPDMLDGELYLAPGFPVPPNSDYKGYHNYIDECLPPESPYLYGLHPNAEIEFLTTTSENLFKTVLEMQPRDSGASAGGGVSREEKIKGILDEIVEKLPEEFNMIEIMAKVPPEERTPYVLVAFQECERMNMLTNEIRRSLKELDLGLKGELTITSDMEDLGNALFMDFIPESWNKKAYPSLYGLTAWYADLLLRVKELETWSSDFQLPAAVWLGGFFNPQSFLTAIMQQMARKNEWPLDRMCLQCDVTKKAREDMAGPPREGAYVHGLFMEGARWDMQTGMINEARLKELAPAMPVIFIRAIPVDRQDTRNIYECPVYKTKTRGPTFVWTFNLKSKEKASKW 4453          
BLAST of DNAHb-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|20342481 (tr|A0A1S3IDL2|A0A1S3IDL2_LINUN dynein beta chain, ciliary isoform X2 OS=Lingula unguis OX=7574 GN=LOC106163313 PE=4 SV=1)

HSP 1 Score: 6319.57 bits (16394), Expect = 0.000e+0
Identity = 3117/4465 (69.81%), Postives = 3723/4465 (83.38%), Query Frame = 1
Query:   61 MASELELNDKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEG-DINSFGEV-PRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKI--HKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSK--DPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            MAS+LEL D R EFI DYVLK++K K DK++K++N +E K M+L++F+K ++Q+L +L     G +  Q E+PTN K KAC+F KK   +I++D       ++GD+S++PLDQ S+FVDE+++P+LSN +N + WP V+S+DV RH ++LK    VV GQ KGKTLLPLPVGS +V E     + G+   R++++AIE+V+IEW HQI DVL K S++ L+ GLNPTP VE+++WK +  NLECI++QL  PKV+KMA LLE  +S+Y P FK++F+ VVAAL E+Q+IN+YL PLRN +++IE  +F +++P++ PL HV+CLIW++ + Y  P RI+V+ QE+ N +IN   +YLDP EIFKGE EE +EKV  +++IL  F+ ++E H+ K+K+YFK+G +P EW+FA  L+F R ++F+ R+E V+ +    LEF KLEK+E+ GIKGR+LS  +V +F+EF  ++K F+E+ YD LDP++T+F +DY  F+A I+DLDRRL   + QAF DC   ++  KL+DIFG LL+RPI+K  FD  Y +L+ M+DE+++  K +YD+ +   ++  K   HKNMPKVTG L+W  E+RERI  P+   SH++H   +      +  K++++L LL+K E + Y+ W  GV+E CSFNL+QPLL RN +T  I+VNFD +L AVLREVKYL+I  QE+IP++A+ ++ +N+T R++  NLDL V+WYN +R+  L VE PLIE +L  ID+QLEKA  +L W     + GAW YI + RDLV +L  RV K+K N++ I+ +M+ W  +PLFER EGK+++LLNL+D+EDR  KRY EI   GE++HGLV++N E  KAD+ S+ WK YVD +D+M V+ F  TI+ SL + +D  +  K   PLFE  M+LQ  ++VF PSLD   AD F +LVD LV DI+KQAS + RLA  S  E Y+ DLEE +EL + R E+ +R +    KA  Y+  FD Y+ LW D+R EFM QFL YG  ++AEE+EAH +  +    E PPTLDQFK Q+D YEK +EE+E+ +G  ++D WFR++ + F+Q+ LN IKRWS MFKQHLIDHVTNSL ELAEFIK+ +SGL K   EGD++GLVE MGHL  VK+RQ +TDEMFEPLKQTI+LLKTY QE+P+EVH+QL+ELPE+WNNTKK+A+TVKQ VAPLQ+ EVANIR+KCA+FDV+QHTFRE FR++  + +SC + Y  LD  + +I+ +EK M  L ESA LFEV VP++KQLKQCRKE+ +LK LWD++ +V +S + WK T W +INVEQMD DCK FAK IR LDKEMR+WD Y+GVE  +KNM+TSLRAV+ELQNPAIR+RHW QLM AT VKF M+E TTL DLL LNLHNFEDEVR+IV+KAVKEMSMEKVLKEL  TW+ MEFEH+KH+RTGITLL  +EELIETLE++QV+LQNM+TSKYI+HF +EV  WQK LSTADQVI IW EVQRTWSHLESIFIGS+DIR QLPEDS+RFD IDTDFK +V EVE T N V+AT KP LY++LEV+Q +L+LCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGN PE+V +HLTKLFDS+A LKF ++++  N K GV M++KDGE V+F + CD  GQVE WLNRLL+  RTT+R  ++E+V++ EEK+R+QW+F+FPAQVAL  +QI W TEV ++FARLEEGYENALKD++KKQI QLN LIT+LIG L+K +RQKVMTICTIDVH RDV+ ++ITQKI++ Q+F WL QLRHRW +  KDC+ NICDAQFRY+HEYLGNTPRLVITPLTDRCYITLTQSLHL MSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKS GNIYKGLAQSG+WGCFDEFNRISVEVLSVVAVQVK IQDAI++K+  F+F GE ISL + +GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFL+AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAGALKR DP+RPEDQVLMRALRDFN+PKIVTDD P+FMGLIGDLFPALDVPRKRDPEFEK ++QATLDLKLQ E+ F+LKVVQLQELF VRHSVF++GNAGTGKS VWKTL +T+ N  KKP+A DLNPKAVTNDELFGIINP+TREWKDGLFSVIMRDLANLT DG KWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI LTP MRLLFEISHLKTATPATVSRAGIL+INP DLGW PFV+SWI TRE+QSE+ANL ILFDKY+P CLEA + RFKKITPI EISH+QMLC+LLEV+L PENTP DCPKE YELYFVFC IWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIK P+QGT+FDYYID ETKKFEPWTK++  FE D E P+QA LV T+ETTR R+F+D+LIE+ RP+MLVG AGTGKTVL+ DKLNS+  DN+VVANVPFNFYTTSEMLQ VLEKPLEKKAGRNYGP GSK+L+YFIDDMNMPEVD+YFTVQPHTLIRQH+DY HWYDRAKLTLK+IHNTQY++CMNPT+GSFTI+PRLQRHFCVFA+S P  E+L  IY++ILS  L  N F A + K    LV+ AL  H K+ ++FLPTAIKFHYVFNLRD+SNIFQG+LF+ PDCIK   D VRLW+HE +RVY DK+ID+ D++ ++++ KE+ KK+FE++DE  +F KPL+YCHFA GIGEPKYM VE    L+K L EAL+SYNE+NAAMNLVLFEDA++HI RINRILESPRG ALLVGVGGSGKQSLSR+AAFISSL+VFQ+TLRKGYGI DLKLDL+ALYMKAGVKNIG VFL+TDAQ+ADEKFLVL+NDLLASGEI  LFPDDE+ENII++MR EVK  G++DSRENCW FFI++VR  L++VLCFSPVG+T+RVRARKFPAVVNCT IDWFH+WPE+AL+SVS RF++EVELL  + ++S A+FM++VH++VN+ S  YLQNERRYNYTTPKSFLEQIALY N+LK K++ELQGK+ RLENGL+KL ST+ QVDDLKAKLAAQEVEL QKN  AN+L+  V  +T KVS EK IA  EE KV+ IKAEV+KKQ DCE DLAKAEPAL AAQEALNTLNKNNLTE+KSFG PP A +  +AA M L+A  GK+PKDRSWKAAK  +M K+D FLD LINY+K+NIPE  LKA +EY  +P F+P+ I+SKS AAAGLC+W INI+ +Y IFCDV+PKR AL+AAN EL  ATEKL+GI  KI+QLE+ + KL  EFE+A ++K RCQ+EAD T +TI LANRLVGGLASENVRW + V+ ++ +EKTLPGDVL+  AF+SY+GCFTK YR+ LMD  WLPFL  L   IPIT +LDPL ML D A IA+WNNEGLPSDRMS ENATIL N ERWPL+IDPQLQGIKWIKT++G DL VVRLGQKGYLD IE+AVS+G  VL+ENIEE++DPVLD +LGRNTIKKGRAI++GDKE EYNP+FRLI+ TKLANPHYKPEMQAQTT++NFTVTRDGLEDQLLA VV KER DLE LK DLTKQQN+F +TLKELED+LL RLS+A GNFLGD ALVENLE  KRTA EIEEKV++AK+TEV INE RE YRPAAARAS+LYFI+ND+ KI+PMYQFSLKAF VVFEKAI+RAEP+EE+K RV NLID IT+SV++YT+RGLFEKDKLIFTAQM+FQIL   KEIN  ELDFLLR+P  PN+T+P+DFL+N  WGGIKALSA+E+F+NLDRDIEGSAKRWKKFVESE PEKEKFPQEWKNKTSLQ+LCMMRALRPDRM+YAV +FV+EKLG KY E   V F +S+EE+GP TP+FFILSPGVDPLKDVE LGKK+GF GDN NF NISLGQGQEIVAE+AMDL AKEGHWVVLQN+HLV+KWLS LEKKLEEY    HE+YRVFISAEP+ S E HIIPQGILE+AIKITNEPPTGM ANLHK+L+NFNQ+T+EMCA+E EFK+ILFALCYFHAVV ERRKFGPQGWNRSYPFNTGDL ISVNVLYNYLEAN+KVPWEDLRYLFGEIMYGGHITDDWDRKLC+TYLEEY+ P+MLDGEL + PGF +PPN+DYKGYH YIDECLP ESPYLYGLHPNAEIEFLT+ S+ LF+TVFEMQPRD+ G G  G +REE+IK ILD+I++KLP++FNMVEI AKVP EER PYVVVAFQECERM+ML  EIRRSLKELDLGLKGELTIT DME L NSL+MD +P++W+KRAYPSL GL  WYADLLLR+KELE W +DFQLP+ +WL G FNPQSFLTAIMQQMARKNEWPLDRM LQCDVTKK++EDMGGPPR+GAYVHGLFMEGARWD+Q+GMIAE++LKEL P +PVIFIKAIPVDRQD RNVY CPVYKTK RGPTFVWTFNLKT+EK +KW
Sbjct:    1 MASDLELGDSRVEFIADYVLKTMKLKPDKWMKMYNQEEYKLMILEYFDKTDVQNLILL-VNSAGVITPQYEWPTNFKGKACYFVKKGTGAINKDNPVRNATVYGDLSHSPLDQLSAFVDEILVPLLSNEQNHDQWPQVVSADVKRHVHNLKSNVYVVAGQVKGKTLLPLPVGSTRVEEAAQEEAKGDTYDRNLVHAIESVIIEWTHQIRDVLKKDSAQPLLEGLNPTPSVEIEFWKAKVANLECIFDQLRDPKVRKMAELLEKTNSSYFPSFKNLFRDVVAALTEAQDINMYLKPLRNHVDDIEGADFCDVKPLLPPLMHVICLIWSNSQFYNTPARIIVVLQEVCNTLINSARNYLDPTEIFKGEVEETIEKVRETVEILKYFQVTYEEHKAKLKDYFKNG-DPKEWEFAPQLVFSRYDTFVQRVETVRDLFETALEFMKLEKIELGGIKGRSLSAQVVQIFDEFNELYKMFSERAYDALDPVDTEFTEDYKNFQAKIEDLDRRLGAIICQAFDDCSGLESALKLVDIFGSLLERPIIKEIFDPSYPKLIVMMDEDLDTAKSIYDLQMQVVQQTGKAISHKNMPKVTGGLKWATELRERISAPMENFSHIEHPCMEGEAAKKMKTKYEQMLALLEKFEKQMYDEWTAGVNEACSFNLAQPLLTRNEETKLIAVNFDPQLVAVLREVKYLEIKGQEDIPEAASGLYQRNETYRQFNGNLDLTVQWYNKVRETILEVEYPLIEGQLADIDKQLEKAEKDLNWE----EKGAWDYIVETRDLVQDLEQRVQKAKNNVEEIQKLMATWSNTPLFERLEGKHESLLNLNDKEDRLKKRYNEIKTTGEKIHGLVQQNLEFFKADAESDIWKAYVDYVDEMAVDGFFNTIHCSLNFFLDCTDPKKPSSPLFEALMELQVPDMVFNPSLDYGVADGFYDLVDGLVGDIYKQASLIGRLAAHSGQEHYQPDLEEMDELSEMRQELMDRVQTVMNKACEYRNSFDNYAYLWVDDRNEFMRQFLLYGHVLTAEEIEAHADDGVP---ENPPTLDQFKEQVDTYEKIYEEVEQFDGTVMVDHWFRVNSKPFRQSLLNIIKRWSFMFKQHLIDHVTNSLNELAEFIKVADSGLTKPVEEGDYDGLVECMGHLLAVKDRQASTDEMFEPLKQTIELLKTYGQELPEEVHVQLQELPEQWNNTKKIAITVKQQVAPLQSNEVANIRKKCASFDVQQHTFRENFRQISVYRYSCEDPYTVLDEFNQQITDMEKEMAALLESAGLFEVNVPDYKQLKQCRKEICMLKQLWDYVYIVRTSFDDWKTTPWVEINVEQMDMDCKRFAKDIRGLDKEMRAWDTYSGVEGTVKNMLTSLRAVSELQNPAIRERHWQQLMQATGVKFVMDEDTTLSDLLSLNLHNFEDEVRNIVDKAVKEMSMEKVLKELDVTWATMEFEHQKHNRTGITLLVTTEELIETLEDNQVQLQNMLTSKYIAHFLEEVSGWQKKLSTADQVITIWMEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDTDFKEVVKEVEGTLNCVEATNKPGLYDKLEVIQGQLILCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNQPELVARHLTKLFDSMAALKFQQDSDGNNLKTGVGMFSKDGEYVDFDHECDCTGQVEVWLNRLLDVQRTTVRHEMTEAVTAYEEKAREQWLFDFPAQVALCGTQIWWTTEVNIAFARLEEGYENALKDYSKKQIQQLNTLITMLIGSLTKQERQKVMTICTIDVHARDVITQMITQKIESGQAFKWLSQLRHRWDEGHKDCFANICDAQFRYSHEYLGNTPRLVITPLTDRCYITLTQSLHLVMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQSGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKTVFEFQGETISLIATVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALKRGDPNRPEDQVLMRALRDFNVPKIVTDDLPIFMGLIGDLFPALDVPRKRDPEFEKEIKQATLDLKLQPEDGFILKVVQLQELFDVRHSVFIVGNAGTGKSQVWKTLNRTFRNKGKKPIAQDLNPKAVTNDELFGIINPATREWKDGLFSVIMRDLANLTGDGNKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPMMRLLFEISHLKTATPATVSRAGILFINPADLGWNPFVSSWIETREVQSEKANLMILFDKYIPTCLEATRSRFKKITPIAEISHIQMLCYLLEVMLTPENTPPDCPKELYELYFVFCCIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKFPSQGTLFDYYIDPETKKFEPWTKKVPPFEFDPEMPMQATLVHTAETTRIRFFMDMLIEQGRPIMLVGTAGTGKTVLMNDKLNSLDTDNWVVANVPFNFYTTSEMLQIVLEKPLEKKAGRNYGPPGSKRLVYFIDDMNMPEVDQYFTVQPHTLIRQHLDYKHWYDRAKLTLKDIHNTQYVSCMNPTSGSFTINPRLQRHFCVFAMSNPSSEALGTIYTSILSGHLSLNGFPAVIQKYAQTLVNGALAMHAKVATSFLPTAIKFHYVFNLRDMSNIFQGLLFSQPDCIKTTQDFVRLWIHESQRVYGDKMIDETDMQNFEKIHKEIVKKSFEDVDEAAVFVKPLIYCHFAAGIGEPKYMMVEDYNVLNKTLVEALDSYNELNAAMNLVLFEDAISHICRINRILESPRGNALLVGVGGSGKQSLSRIAAFISSLEVFQVTLRKGYGIADLKLDLSALYMKAGVKNIGTVFLMTDAQVADEKFLVLINDLLASGEIPGLFPDDELENIINAMRPEVKGLGLLDSRENCWKFFIDRVRRQLKVVLCFSPVGATIRVRARKFPAVVNCTCIDWFHDWPEEALVSVSARFMEEVELLSPEMRESIAQFMAYVHRSVNETSALYLQNERRYNYTTPKSFLEQIALYRNLLKIKNSELQGKIQRLENGLEKLRSTSAQVDDLKAKLAAQEVELAQKNEDANKLIAIVGAETTKVSKEKAIASEEEAKVAVIKAEVTKKQIDCETDLAKAEPALMAAQEALNTLNKNNLTELKSFGAPPAACVMTTAAVMVLLAPGGKLPKDRSWKAAKT-MMAKVDGFLDQLINYDKENIPESCLKAVQEYLDNPEFDPDFIRSKSQAAAGLCAWAINIVNFYRIFCDVEPKRLALQAANAELAAATEKLNGIMAKIQQLEEAMAKLTAEFERATNEKLRCQEEADNTNRTISLANRLVGGLASENVRWAESVKNFQEQEKTLPGDVLLITAFVSYMGCFTKKYRVDLMDGMWLPFLKGLKNPIPITPDLDPLSMLTDSAQIATWNNEGLPSDRMSTENATILANCERWPLMIDPQLQGIKWIKTKYGEDLVVVRLGQKGYLDTIERAVSSGFTVLLENIEETVDPVLDAILGRNTIKKGRAIRMGDKEVEYNPQFRLIIHTKLANPHYKPEMQAQTTLVNFTVTRDGLEDQLLAGVVRKERPDLEKLKSDLTKQQNEFTVTLKELEDNLLARLSSAGGNFLGDTALVENLETTKRTASEIEEKVKEAKVTEVQINEAREHYRPAAARASLLYFIMNDIFKIHPMYQFSLKAFSVVFEKAIERAEPAEEVKQRVLNLIDCITYSVFIYTTRGLFEKDKLIFTAQMTFQILQMKKEINNVELDFLLRYPAAPNVTTPVDFLNNLGWGGIKALSAMEDFRNLDRDIEGSAKRWKKFVESECPEKEKFPQEWKNKTSLQKLCMMRALRPDRMSYAVTNFVEEKLGSKYTENKSVPFPKSYEETGPGTPVFFILSPGVDPLKDVEALGKKIGFHGDNHNFHNISLGQGQEIVAEQAMDLAAKEGHWVVLQNVHLVAKWLSNLEKKLEEYGLTGHEAYRVFISAEPAASAEYHIIPQGILESAIKITNEPPTGMFANLHKALDNFNQDTLEMCAREAEFKSILFALCYFHAVVCERRKFGPQGWNRSYPFNTGDLTISVNVLYNYLEANAKVPWEDLRYLFGEIMYGGHITDDWDRKLCRTYLEEYMHPDMLDGELYLAPGFPIPPNSDYKGYHGYIDECLPPESPYLYGLHPNAEIEFLTTRSEVLFRTVFEMQPRDAGGDGGGGGTREEKIKAILDEIVDKLPEEFNMVEIMAKVPVEERTPYVVVAFQECERMSMLIKEIRRSLKELDLGLKGELTITTDMENLGNSLFMDTVPDAWAKRAYPSLMGLTQWYADLLLRVKELESWVSDFQLPAAVWLAGFFNPQSFLTAIMQQMARKNEWPLDRMCLQCDVTKKSREDMGGPPREGAYVHGLFMEGARWDSQAGMIAESRLKELAPPVPVIFIKAIPVDRQDTRNVYECPVYKTKFRGPTFVWTFNLKTREKANKW 4455          
BLAST of DNAHb-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|20327046 (tr|A0A1S3IEP3|A0A1S3IEP3_LINUN dynein beta chain, ciliary isoform X1 OS=Lingula unguis OX=7574 GN=LOC106163313 PE=4 SV=1)

HSP 1 Score: 6317.64 bits (16389), Expect = 0.000e+0
Identity = 3118/4465 (69.83%), Postives = 3723/4465 (83.38%), Query Frame = 1
Query:   61 MASELELNDKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEG-DINSFGEV-PRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKI--HKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSK--DPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            MAS+LEL D R EFI DYVLK++K K DK++K++N +E K M+L++F+K ++Q+L +L     G +  Q E+PTN K KAC+F KK   +I++D       ++GD+S++PLDQ S+FVDE+++P+LSN +N + WP V+S+DV RH ++LK    VV GQ KGKTLLPLPVGS +V E     + G+   R++++AIE+V+IEW HQI DVL K S++ L+ GLNPTP VE+++WK +  NLECI++QL  PKV+KMA LLE  +S+Y P FK++F+ VVAAL E+Q+IN+YL PLRN +++IE  +F +++P++ PL HV+CLIW++ + Y  P RI+V+ QE+ N +IN   +YLDP EIFKGE EE +EKV  +++IL  F+ ++E H+ K+K+YFK+G +P EW+FA  L+F R ++F+ R+E V+ +    LEF KLEK+E+ GIKGR+LS  +V +F+EF  ++K F+E+ YD LDP++T+F +DY  F+A I+DLDRRL   + QAF DC   ++  KL+DIFG LL+RPI+K  FD  Y +L+ M+DE+++  K +YD+ +   ++  K   HKNMPKVTG L+W  E+RERI  P+   SH++H   +      +  K++++L LL+K E + Y+ W  GV+E CSFNL+QPLL RN +T  I+VNFD +L AVLREVKYL+I  QE+IP++A+ ++ +N+T R++  NLDL V+WYN +R+  L VE PLIE +L  ID+QLEKA  +L W     + GAW YI + RDLV +L  RV K+K N++ I+ +M+ W  +PLFER EGK+++LLNL+D+EDR  KRY EI   GE++HGLV++N E  KAD+ S+ WK YVD +D+M V+ F  TI+ SL + +D  +  K   PLFE  M+LQ  ++VF PSLD   AD F +LVD LV DI+KQAS + RLA  S  E Y+ DLEE +EL + R E+ +R +    KA  Y+  FD Y+ LW D+R EFM QFL YG  ++AEE+EAH +  +    E PPTLDQFK Q+D YEK +EE+E+ +G  ++D WFR++ + F+Q+ LN IKRWS MFKQHLIDHVTNSL ELAEFIK+ +SGL K   EGD++GLVE MGHL  VK+RQ +TDEMFEPLKQTI+LLKTY QE+P+EVH+QL+ELPE+WNNTKK+A+TVKQ VAPLQ+ EVANIR+KCA+FDV+QHTFRE FR++  + +SC + Y  LD  + +I+ +EK M  L ESA LFEV VP++KQLKQCRKE+ +LK LWD++ +V +S + WK T W +INVEQMD DCK FAK IR LDKEMR+WD Y+GVE  +KNM+TSLRAV+ELQNPAIR+RHW QLM AT VKF M+E TTL DLL LNLHNFEDEVR+IV+KAVKEMSMEKVLKEL  TW+ MEFEH+KH+RTGITLL  +EELIETLE++QV+LQNM+TSKYI+HF +EV  WQK LSTADQVI IW EVQRTWSHLESIFIGS+DIR QLPEDS+RFD IDTDFK +V EVE T N V+AT KP LY++LEV+Q +L+LCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGN PE+V +HLTKLFDS+A LKF ++++  N K GV M++KDGE V+F + CD  GQVE WLNRLL+  RTT+R  ++E+V++ EEK+R+QW+F+FPAQVAL  +QI W TEV ++FARLEEGYENALKD++KKQI QLN LIT+LIG L+K +RQKVMTICTIDVH RDV+ ++ITQKI++ Q+F WL QLRHRW +  KDC+ NICDAQFRY+HEYLGNTPRLVITPLTDRCYITLTQSLHL MSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKS GNIYKGLAQSG+WGCFDEFNRISVEVLSVVAVQVK IQDAI++K+  F+F GE ISL + +GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFL+AR+LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAGALKR DP+RPEDQVLMRALRDFN+PKIVTDD P+FMGLIGDLFPALDVPRKRDPEFEK ++QATLDLKLQ E+ F+LKVVQLQELF VRHSVF++GNAGTGKS VWKTL +T+ N  KKP+A DLNPKAVTNDELFGIINP+TREWKDGLFSVIMRDLANLT DG KWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI LTP MRLLFEISHLKTATPATVSRAGIL+INP DLGW PFV+SWI TRE+QSE+ANL ILFDKY+P CLEA + RFKKITPI EISH+QMLC+LLEV+L PENTP DCPKE YELYFVFC IWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIK P+QGT+FDYYID ETKKFEPWTK++  FE D E P+QA LV T+ETTR R+F+D+LIE+ RP+MLVG AGTGKTVL+ DKLNS+  DN+VVANVPFNFYTTSEMLQ VLEKPLEKKAGRNYGP GSK+L+YFIDDMNMPEVD+YFTVQPHTLIRQH+DY HWYDRAKLTLK+IHNTQY++CMNPT+GSFTI+PRLQRHFCVFA+S P  E+L  IY++ILS  L  N F A + K    LV+ AL  H K+ S+FLPTAIKFHYVFNLRD+SNIFQG+LF+ PDCIK   D VRLW+HE +RVY DK+ID+ D++ ++++ KE+ KK+FE++DE  +F KPL+YCHFA GIGEPKYM VE    L+K L EAL+SYNE+NAAMNLVLFEDA++HI RINRILESPRG ALLVGVGGSGKQSLSR+AAFISSL+VFQ+TLRKGYGI DLKLDL+ALYMKAGVKNIG VFL+TDAQ+ADEKFLVL+NDLLASGEI  LFPDDE+ENII++MR EVK  G++DSRENCW FFI++VR  L++VLCFSPVG+T+RVRARKFPAVVNCT IDWFH+WPE+AL+SVS RF++EVELL  + ++S A+FM++VH++VN+ S  YLQNERRYNYTTPKSFLEQIALY N+LK K++ELQGK+ RLENGL+KL ST+ QVDDLKAKLAAQEVEL QKN  AN+L+  V  +T KVS EK IA  EE KV+ IKAEV+KKQ DCE DLAKAEPAL AAQEALNTLNKNNLTE+KSFG PP A +  +AA M L+A  GK+PKDRSWKAAK  +M K+D FLD LINY+K+NIPE  LKA +EY  +P F+P+ I+SKS AAAGLC+W INI+ +Y IFCDV+PKR AL+AAN EL  ATEKL+GI  KI+QLE+ + KL  EFE+A ++K RCQ+EAD T +TI LANRLVGGLASENVRW + V+ ++ +EKTLPGDVL+  AF+SY+GCFTK YR+ LMD  WLPFL  L   IPIT +LDPL ML D A IA+WNNEGLPSDRMS ENATIL N ERWPL+IDPQLQGIKWIKT++G DL VVRLGQKGYLD IE+AVS+G  VL+ENIEE++DPVLD +LGRNTIKKGRAI++GDKE EYNP+FRLI+ TKLANPHYKPEMQAQTT++NFTVTRDGLEDQLLA VV KER DLE LK DLTKQQN+F +TLKELED+LL RLS+A GNFLGD ALVENLE  KRTA EIEEKV++AK+TEV INE RE YRPAAARAS+LYFI+ND+ KI+PMYQFSLKAF VVFEKAI+RAEP+EE+K RV NLID IT+SV++YT+RGLFEKDKLIFTAQM+FQIL   KEIN  ELDFLLR+P  PN+T+P+DFL+N  WGGIKALSA+E+F+NLDRDIEGSAKRWKKFVESE PEKEKFPQEWKNKTSLQ+LCMMRALRPDRM+YAV +FV+EKLG KY E   V F +S+EE+GP TP+FFILSPGVDPLKDVE LGKK+GF GDN NF NISLGQGQEIVAE+AMDL AKEGHWVVLQN+HLV+KWLS LEKKLEEY    HE+YRVFISAEP+ S E HIIPQGILE+AIKITNEPPTGM ANLHK+L+NFNQ+T+EMCA+E EFK+ILFALCYFHAVV ERRKFGPQGWNRSYPFNTGDL ISVNVLYNYLEAN+KVPWEDLRYLFGEIMYGGHITDDWDRKLC+TYLEEY+ P+MLDGEL + PGF +PPN+DYKGYH YIDECLP ESPYLYGLHPNAEIEFLT+ S+ LF+TVFEMQPRD+ G G  G +REE+IK ILD+I++KLP++FNMVEI AKVP EER PYVVVAFQECERM+ML  EIRRSLKELDLGLKGELTIT DME L NSL+MD +P++W+KRAYPSL GL  WYADLLLR+KELE W +DFQLP+ +WL G FNPQSFLTAIMQQMARKNEWPLDRM LQCDVTKK++EDMGGPPR+GAYVHGLFMEGARWD+Q+GMIAE++LKEL P +PVIFIKAIPVDRQD RNVY CPVYKTK RGPTFVWTFNLKT+EK +KW
Sbjct:    1 MASDLELGDSRVEFIADYVLKTMKLKPDKWMKMYNQEEYKLMILEYFDKTDVQNLILL-VNSAGVITPQYEWPTNFKGKACYFVKKGTGAINKDNPVRNATVYGDLSHSPLDQLSAFVDEILVPLLSNEQNHDQWPQVVSADVKRHVHNLKSNVYVVAGQVKGKTLLPLPVGSTRVEEAAQEEAKGDTYDRNLVHAIESVIIEWTHQIRDVLKKDSAQPLLEGLNPTPSVEIEFWKAKVANLECIFDQLRDPKVRKMAELLEKTNSSYFPSFKNLFRDVVAALTEAQDINMYLKPLRNHVDDIEGADFCDVKPLLPPLMHVICLIWSNSQFYNTPARIIVVLQEVCNTLINSARNYLDPTEIFKGEVEETIEKVRETVEILKYFQVTYEEHKAKLKDYFKNG-DPKEWEFAPQLVFSRYDTFVQRVETVRDLFETALEFMKLEKIELGGIKGRSLSAQVVQIFDEFNELYKMFSERAYDALDPVDTEFTEDYKNFQAKIEDLDRRLGAIICQAFDDCSGLESALKLVDIFGSLLERPIIKEIFDPSYPKLIVMMDEDLDTAKSIYDLQMQVVQQTGKAISHKNMPKVTGGLKWATELRERISAPMENFSHIEHPCMEGEAAKKMKTKYEQMLALLEKFEKQMYDEWTAGVNEACSFNLAQPLLTRNEETKLIAVNFDPQLVAVLREVKYLEIKGQEDIPEAASGLYQRNETYRQFNGNLDLTVQWYNKVRETILEVEYPLIEGQLADIDKQLEKAEKDLNWE----EKGAWDYIVETRDLVQDLEQRVQKAKNNVEEIQKLMATWSNTPLFERLEGKHESLLNLNDKEDRLKKRYNEIKTTGEKIHGLVQQNLEFFKADAESDIWKAYVDYVDEMAVDGFFNTIHCSLNFFLDCTDPKKPSSPLFEALMELQVPDMVFNPSLDYGVADGFYDLVDGLVGDIYKQASLIGRLAAHSGQEHYQPDLEEMDELSEMRQELMDRVQTVMNKACEYRNSFDNYAYLWVDDRNEFMRQFLLYGHVLTAEEIEAHADDGVP---ENPPTLDQFKEQVDTYEKIYEEVEQFDGTVMVDHWFRVNSKPFRQSLLNIIKRWSFMFKQHLIDHVTNSLNELAEFIKVADSGLTKPVEEGDYDGLVECMGHLLAVKDRQASTDEMFEPLKQTIELLKTYGQELPEEVHVQLQELPEQWNNTKKIAITVKQQVAPLQSNEVANIRKKCASFDVQQHTFRENFRQISVYRYSCEDPYTVLDEFNQQITDMEKEMAALLESAGLFEVNVPDYKQLKQCRKEICMLKQLWDYVYIVRTSFDDWKTTPWVEINVEQMDMDCKRFAKDIRGLDKEMRAWDTYSGVEGTVKNMLTSLRAVSELQNPAIRERHWQQLMQATGVKFVMDEDTTLSDLLSLNLHNFEDEVRNIVDKAVKEMSMEKVLKELDVTWATMEFEHQKHNRTGITLLVTTEELIETLEDNQVQLQNMLTSKYIAHFLEEVSGWQKKLSTADQVITIWMEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDTDFKEVVKEVEGTLNCVEATNKPGLYDKLEVIQGQLILCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNQPELVARHLTKLFDSMAALKFQQDSDGNNLKTGVGMFSKDGEYVDFDHECDCTGQVEVWLNRLLDVQRTTVRHEMTEAVTAYEEKAREQWLFDFPAQVALCGTQIWWTTEVNIAFARLEEGYENALKDYSKKQIQQLNTLITMLIGSLTKQERQKVMTICTIDVHARDVITQMITQKIESGQAFKWLSQLRHRWDEGHKDCFANICDAQFRYSHEYLGNTPRLVITPLTDRCYITLTQSLHLVMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQSGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKTVFEFQGETISLIATVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALKRGDPNRPEDQVLMRALRDFNVPKIVTDDLPIFMGLIGDLFPALDVPRKRDPEFEKEIKQATLDLKLQPEDGFILKVVQLQELFDVRHSVFIVGNAGTGKSQVWKTLNRTFRNKGKKPIAQDLNPKAVTNDELFGIINPATREWKDGLFSVIMRDLANLTGDGNKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPMMRLLFEISHLKTATPATVSRAGILFINPADLGWNPFVSSWIETREVQSEKANLMILFDKYIPTCLEATRSRFKKITPIAEISHIQMLCYLLEVMLTPENTPPDCPKELYELYFVFCCIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKFPSQGTLFDYYIDPETKKFEPWTKKVPPFEFDPEMPMQATLVHTAETTRIRFFMDMLIEQGRPIMLVGTAGTGKTVLMNDKLNSLDTDNWVVANVPFNFYTTSEMLQIVLEKPLEKKAGRNYGPPGSKRLVYFIDDMNMPEVDQYFTVQPHTLIRQHLDYKHWYDRAKLTLKDIHNTQYVSCMNPTSGSFTINPRLQRHFCVFAMSNPSSEALGTIYTSILSGHLSLNGFPAVIQKYAQTLVNGALAMHAKVASSFLPTAIKFHYVFNLRDMSNIFQGLLFSQPDCIKTTQDFVRLWIHESQRVYGDKMIDETDMQNFEKIHKEIVKKSFEDVDEAAVFVKPLIYCHFAAGIGEPKYMMVEDYNVLNKTLVEALDSYNELNAAMNLVLFEDAISHICRINRILESPRGNALLVGVGGSGKQSLSRIAAFISSLEVFQVTLRKGYGIADLKLDLSALYMKAGVKNIGTVFLMTDAQVADEKFLVLINDLLASGEIPGLFPDDELENIINAMRPEVKGLGLLDSRENCWKFFIDRVRRQLKVVLCFSPVGATIRVRARKFPAVVNCTCIDWFHDWPEEALVSVSARFMEEVELLSPEMRESIAQFMAYVHRSVNETSALYLQNERRYNYTTPKSFLEQIALYRNLLKIKNSELQGKIQRLENGLEKLRSTSAQVDDLKAKLAAQEVELAQKNEDANKLIAIVGAETTKVSKEKAIASEEEAKVAVIKAEVTKKQIDCETDLAKAEPALMAAQEALNTLNKNNLTELKSFGAPPAACVMTTAAVMVLLAPGGKLPKDRSWKAAKT-MMAKVDGFLDQLINYDKENIPESCLKAVQEYLDNPEFDPDFIRSKSQAAAGLCAWAINIVNFYRIFCDVEPKRLALQAANAELAAATEKLNGIMAKIQQLEEAMAKLTAEFERATNEKLRCQEEADNTNRTISLANRLVGGLASENVRWAESVKNFQEQEKTLPGDVLLITAFVSYMGCFTKKYRVDLMDGMWLPFLKGLKNPIPITPDLDPLSMLTDSAQIATWNNEGLPSDRMSTENATILANCERWPLMIDPQLQGIKWIKTKYGEDLVVVRLGQKGYLDTIERAVSSGFTVLLENIEETVDPVLDAILGRNTIKKGRAIRMGDKEVEYNPQFRLIIHTKLANPHYKPEMQAQTTLVNFTVTRDGLEDQLLAGVVRKERPDLEKLKSDLTKQQNEFTVTLKELEDNLLARLSSAGGNFLGDTALVENLETTKRTASEIEEKVKEAKVTEVQINEAREHYRPAAARASLLYFIMNDIFKIHPMYQFSLKAFSVVFEKAIERAEPAEEVKQRVLNLIDCITYSVFIYTTRGLFEKDKLIFTAQMTFQILQMKKEINNVELDFLLRYPAAPNVTTPVDFLNNLGWGGIKALSAMEDFRNLDRDIEGSAKRWKKFVESECPEKEKFPQEWKNKTSLQKLCMMRALRPDRMSYAVTNFVEEKLGSKYTENKSVPFPKSYEETGPGTPVFFILSPGVDPLKDVEALGKKIGFHGDNHNFHNISLGQGQEIVAEQAMDLAAKEGHWVVLQNVHLVAKWLSNLEKKLEEYGLTGHEAYRVFISAEPAASAEYHIIPQGILESAIKITNEPPTGMFANLHKALDNFNQDTLEMCAREAEFKSILFALCYFHAVVCERRKFGPQGWNRSYPFNTGDLTISVNVLYNYLEANAKVPWEDLRYLFGEIMYGGHITDDWDRKLCRTYLEEYMHPDMLDGELYLAPGFPIPPNSDYKGYHGYIDECLPPESPYLYGLHPNAEIEFLTTRSEVLFRTVFEMQPRDAGGDGGGGGTREEKIKAILDEIVDKLPEEFNMVEIMAKVPVEERTPYVVVAFQECERMSMLIKEIRRSLKELDLGLKGELTITTDMENLGNSLFMDTVPDAWAKRAYPSLMGLTQWYADLLLRVKELESWVSDFQLPAAVWLAGFFNPQSFLTAIMQQMARKNEWPLDRMCLQCDVTKKSREDMGGPPREGAYVHGLFMEGARWDSQAGMIAESRLKELAPPVPVIFIKAIPVDRQDTRNVYECPVYKTKFRGPTFVWTFNLKTREKANKW 4455          
BLAST of DNAHb-1 vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 5592.31 bits (14506), Expect = 0.000e+0
Identity = 2814/4461 (63.08%), Postives = 3464/4461 (77.65%), Query Frame = 1
Query:   85 DKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVIL-------PVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSKD--PLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLG-SNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPL-LYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            D+R  F+ + VLK+L+ K D++ K    +E KQ++ DF +K +   L V+     G L    +F  + K+KA +F K+ + S++ D+    V  FG +   PL+Q  +FV+EV L        +L N KN   WP V+S D++RH + L+    VV+GQ+KGKT+LPLP GSE++          V +SII++IE++VI+W+HQI  VL + SSE L+ G NPTP VEL++WK R  +L+CI +Q  SPKV KMA LL+ ++S+Y P ++++ + V  AL+E+ +INL+L PL+   E++E  EFS ++  I PL H +CL+WA+ K Y  P R++VL QE  NL I                                  +  FE  R  + +Y ++G E                           +L A ++  KLEK+E  G++GR+LSQ +V + EEF+  FK F E++YDCLD    +F  D++ FK  ++D DRRL     QAF D    +  FK+     G+                           + L  ++ +        ++KNMP V G L W ++++ERI+      S                                        V E   +NL+QPL+ R+  T  I+VNF+ +L +VLREVKYLK  + E+IP    DI+S  + L +Y+ NLDLMV WYN +    L VE PLI+++L  ID QL++A   + W S    NG W+YI+ VR+ VH+L  R+ K+K+N+D I+ IM  W  +P+FERK+GK D+LLNL+DR +R  K Y +   +G ++H L+K N  L KAD  S+ W+ YV+ ID+M+++ F  +I+ SL++ +D  +      PLFE  +DLQ +++VF PSL+   +D F +LV+SL+ D+++ +S V RLA  SS   Y+ D+E+  +L   R  + ER      +   ++  F+ Y+ L+ D+R+EFM QFL YG  ++ EE+EAH ++ +    E PPTL++F+ Q+D YE+ +EE++K+   ++ + W R+D R FK A LN IK+WSLMFKQHLIDHVTNSL EL EFIK T  GL  +  EGD+ GLV++MGHL  VKERQ ATDEMFEPL+ TIDLLKTY QE+PD V+ QLEELPEKW N KK AV VKQ VAPLQ  EVAN+RRKCATFDV+Q  FRE FRK  PF F  +  YE LD  H +I  +E  M +L ESA LFEV +P++KQLKQCRKE+ +LK LWD ++VV  ++E W+ T W++INVE+M+ +CK F+K +R LDKE R+WDA+ G++  +KN +TSLRA+ ELQNPAIR RHW QLM AT V+F M+E TTL DLL LNLH+FEDEVR+IV++AVKEM MEKVL EL +TW+ MEF +E H RT + LLK+ E+L+ETLE++QV+LQN+M+SK+++ F +EV SWQK LS AD VI IWFEVQRTWSHLESIFIGS+DIR QLPEDS+RF+ IDTDFK L  +  +T NVV+AT KP LY RLE +Q  L LCEKALAEYL+TKRLAFPRFYF+SSADLLDILSNG  P  V +HL+KLFD+ AK+KF  +A+ + +K G+ M++K+ E V F   CD  GQVE WLNR+L+ MR T+R  ++E+V + E+K R+QW+F++PAQVAL+ +QI W ++V L+F+RLEEGYENA+K++ KKQ++QLN LIT+LIG+LS  DRQKVMTICTIDVH RDVV K+I QK++NSQ+F WL QLRHRW + +K C+ NICDAQF Y++EYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKS GNIYKGLAQ+G+WGCFDEFNRISVEVLSVVAVQVK IQDAI++K+KRF+F+GEEI+L  ++GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGF++AR+LARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAG+LKR DP+RPEDQVLMRALRDFN+PKIVTDD PVFMGLIGDLFPALDVPRKRD +FEK VR++ LDLKLQAE+NFVLKVVQL+EL AVRHSVFV+GNAGTGKS V K+L KTY N+K++P+  DLNPKAVTNDELFGIINP+TREWKDGLFS IMR+LAN++  GPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPL PTMRL+FEISHL+TATPATVSRAGILYIN  DLGW P V+SWI  REIQSE+ANLTILFDKY+P CL+ L+ RFKKI PI E S VQMLCHLLE LL PE+TP DC KE YELYFVF AIWAFG  +FQDQLVD+RVEF+KWWVTEFKTIK P+QGTVFDYYID ETKKFEPW+K + +FEMD E PLQA LV T+ET R  YF++ L+E+RRP+MLVG AGTGK+VL+  KL S+  D Y + NVPFN+YTTS MLQ VLEKPLEKKAGRNYGP GSK+LIYFIDDMNMPEVD Y TVQPHTLIRQH+DY+HWYDR+KL LKEIH+ QY++CMNPT+GSFTI+PRLQRHF VFALSFPG ++L  IY +IL + L    FSA + K+   LV LAL+FH ++ +TFLPTAIKFHY+FNLRDLSNIFQG+LF   +C+K P DLV++++HE  RVY DK+++D D  T+ +LQ E+  K +E+M+E +   K + +YCHFA GIGEP+YMPV+  E L+K L EAL+SYNEVNAAMNLVLF DA++HI RINRILESPRG ALLVGVGGSGKQSL+RLAAFISSL+VFQITL+KGYGI DLK DL AL +KAGVKNIG VFL+TDAQ+ADEKFLVLVNDLLASGEI DL+PDDE+ENII+S+RNEV+  G++DSRENCW FFI +VR  L++ LCFSPVGS LRVR+RKFPAVVNCT IDWFHEWP++AL SVS RFLQEVE +  + KDS +KFM++VH +VNK S  YL NERRYNYTTPKSFLEQI LY N+L  K  +L  KM RLENGLQKL ST+ QVDDLKAKLAAQEV+L+QKN  A+ L++ V  +T+KVS EK +AD EEEKV+ I   V++KQ+DCE DLAKAEPAL AAQEALNTLNKNNLTE+KSFG+P  AV +V+AA M LMA  G+VPKDRSWKAAK  +M K+DAFLD+L+N+NK+NI E  LKA + Y +DP F PE + +KS AAAGLCSWVINI+ +YE++C+V+PKR AL  AN EL  A EKLS I+ KI  L + L KL  +FEKA +DK +CQ EA+ T +TI LANRLVGGLASENVRW + V  +K +E+TL GDVL+  AF+SY+G FTK YR  LMD  W P+L+ L   IP+T  LDPL ML+DDA +A+W NEGLP+DRMS ENATILT+ ERWPL++DPQLQGIKWIK ++G +L+V+R+GQ+GYLD IE+A+SAG+VVLIEN+EE++DPVL  LLG+ TIKKGR IK+GDKECEYNP FRLIL TKLANPHY+PE+QAQ T++NFTVTRDGLEDQLLA VV+ ER DLE LK +LTKQQN FKITLK LED+LL RLS+A GNFLGD  LVENLE  KRTA EIEEKV++AK+TE  INE RE YRPAAARAS+LYFI+NDLNKI+PMYQFSLKAF VVF+KA+ +A P E LK RV NLIDSIT SV+ YT+RGLFE DKL +TAQ++FQILL  KEINP ELDFLLR+P+ P +TSP+DFLS++SWGGIKAL +++EF+NLDRDIE SAKRWKKFVE E PEKEKFPQEWKNKTSLQ+LCMMRALRPDRM YA+ DFV+EKLG KYV G  V+F+ SFEESG ATP+FFILSPGVDPLKDVE  G+ +G++ DN+NF N+SLGQGQE+VAE+A+DL A+EGHWV+LQNIHLV+KWL  LEKKLE++ E S +++RVFISAEPS SPE HIIPQGILEN+IKITNEPP GM ANLHK+L+NFNQ+T+EMCA+ENEFK+ILF+LCYFHAVV+ERRKFGPQGWNRSYPFNTGDL ISVNVLYNYLEANSKVP++DLRYLFGEIMYGGHITDDWDR+LC+TYLEE+++PEM++GEL + PGF +P N DY GYH YID+ LPAESPYLYGLHPNAEI FLT  S+KLF+TV EMQPRD+     +G SR+E++K +L++ +EKLP++FNMVE+  KV  EER+PYVVVA QECERMN+LT EI+RSLKEL+LGLKGELT+T DME L N++Y+D +P+SW+KRAYPS+ GLALW+ DLL RI+ELE W++DF LP  +WL G FNPQSFLTAIMQ  AR+NEWPLD+M+LQCDV KKN+ED   PPR+GAYVHGLFMEGARWDTQ+G+I +A+LKEL P++PVIFIKA+PVD+Q+ RNVY CPVYKT++RGPT+VWTFNLKTKE PSKW
Sbjct:    5 DQRLHFLQERVLKTLRLKPDRWQKCLAVEEQKQVIQDFLDKSDHTTL-VISLTAAGQLIPAVDFAVSQKNKAVYFIKRGQTSLTPDSVKTNVY-FGTMCGPPLEQLPAFVEEVTLIFDLTYASILCNTKNHFHWPCVVSEDLMRHAHVLRTSVSVVVGQAKGKTVLPLPPGSERIEH-------LVDKSIIHSIESMVIDWSHQIHGVLKRDSSEPLLEGTNPTPQVELNFWKNRYADLQCINDQFKSPKVTKMAQLLDVIESSYYPAYRNMVQDVERALEEATDINLFLKPLQRLTEDLESTEFSNVKERIAPLMHTVCLVWANSKHYNTPARVIVLLQEFCNLFIQ---------------------------------QSVFEDKRNSLSQYQRNGMEA--------------------------LLLAVVDMMKLEKLEFGGVRGRSLSQQVVWLHEEFQERFKTFAEKSYDCLDVCNLEFEADFNDFKHKLEDTDRRLGAIFCQAFDDSGNLEHAFKI-----GV---------------------------EVLFTNLFIVALPGYSPVNKNMPVVAGGLRWAQQLQERIQTTAACKS----------------------------------------VGEKSQYNLNQPLISRDPTTTLITVNFNPQLVSVLREVKYLKARESEDIPDLTADIYSNKELLWQYVANLDLMVGWYNKVIGTVLEVEFPLIQDQLRTIDLQLKEAEDTINWTS----NGIWEYIQGVREAVHDLEKRLQKTKDNVDEIQSIMKTW-ANPVFERKDGKNDSLLNLEDRPERLEKTYGQFRTSGAKIHLLLKNNLSLFKADPSSDEWRSYVEYIDEMVIDGFFNSIDSSLKFFLDNTDQKPGLAPLFEAQLDLQVHDLVFHPSLEFGASDGFYDLVESLINDVYRISSLVPRLAEHSSFPHYQADMEDMADLADMRQLLMERVHRVMAQCCEHRNAFERYAYLYVDDRKEFMRQFLLYGHVLTTEEIEAHADEGVP---EDPPTLERFREQVDSYERMYEEVQKLEPVHVFEGWMRVDARAFKSALLNIIKKWSLMFKQHLIDHVTNSLSELEEFIKCTEGGLGIKVEEGDYAGLVKVMGHLMAVKERQGATDEMFEPLQHTIDLLKTYEQELPDVVYKQLEELPEKWINMKKQAVVVKQHVAPLQASEVANLRRKCATFDVEQFKFREHFRKNGPFRFDIVNPYEMLDTTHKQIQEMESIMAKLIESAGLFEVNIPDYKQLKQCRKEVSILKELWDVVSVVRFNLEAWRTTPWREINVEEMELECKRFSKELRLLDKEARAWDAFCGLDSTVKNTLTSLRAIAELQNPAIRPRHWQQLMTATGVRFSMDEDTTLTDLLNLNLHHFEDEVRAIVDRAVKEMGMEKVLTELDATWTAMEFGYESHPRTSVPLLKSDEDLVETLEDNQVQLQNLMSSKHVAFFLEEVSSWQKRLSVADSVISIWFEVQRTWSHLESIFIGSEDIRSQLPEDSKRFEGIDTDFKELAYDAHKTPNVVEATNKPGLYSRLEDIQGRLALCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTDPHQVQRHLSKLFDNTAKMKFETDADGKPSKTGIGMFSKEEEYVPFNEPCDCTGQVEMWLNRVLDTMRATVRHEMTEAVVAYEDKPREQWLFDYPAQVALTCTQIWWTSDVGLAFSRLEEGYENAMKEYYKKQVSQLNTLITMLIGQLSPGDRQKVMTICTIDVHARDVVAKIIAQKVENSQAFVWLSQLRHRWDEREKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKKRFNFMGEEINLFPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPERPEDQVLMRALRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDLDFEKFVRESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGNAGTGKSQVLKSLNKTYQNMKRRPVWADLNPKAVTNDELFGIINPATREWKDGLFSNIMRELANVSHAGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINQADLGWNPPVSSWIDKREIQSEKANLTILFDKYLPACLDTLRSRFKKIIPIPEQSMVQMLCHLLECLLTPEHTPPDCHKELYELYFVFAAIWAFGGALFQDQLVDYRVEFSKWWVTEFKTIKFPSQGTVFDYYIDPETKKFEPWSKMVPRFEMDPEIPLQACLVHTTETIRVSYFMERLLERRRPIMLVGNAGTGKSVLVGGKLGSLDPDKYTIKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGSKRLIYFIDDMNMPEVDAYGTVQPHTLIRQHMDYNHWYDRSKLQLKEIHSVQYVSCMNPTSGSFTINPRLQRHFSVFALSFPGVDALNTIYCSILGQHLSREGFSAVVQKSGPQLVQLALDFHQRVTATFLPTAIKFHYIFNLRDLSNIFQGMLFCKSECMKTPQDLVKVYLHESNRVYRDKMVEDKDFSTFDKLQSEMVGKFYEDMEEALEEAKVMNMYCHFALGIGEPRYMPVQSWESLNKTLLEALDSYNEVNAAMNLVLFGDAMSHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQITLKKGYGITDLKSDLGALCIKAGVKNIGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLYPDDEVENIINSVRNEVRGQGLLDSRENCWKFFIERVRRQLKVALCFSPVGSKLRVRSRKFPAVVNCTVIDWFHEWPQEALESVSLRFLQEVEHIEPEVKDSVSKFMAYVHVSVNKTSKDYLANERRYNYTTPKSFLEQIKLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKLAAQEVDLKQKNEDADRLIQVVGVETEKVSREKAVADEEEEKVASIAVVVTRKQKDCEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLMAPGGRVPKDRSWKAAKV-MMAKVDAFLDSLMNFNKENIHENCLKAIQPYLQDPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTWKPYLSQLKVPIPVTPGLDPLSMLMDDADVAAWQNEGLPADRMSTENATILTSCERWPLMVDPQLQGIKWIKNKYGDNLQVIRIGQRGYLDSIERALSAGEVVLIENLEEAVDPVLGPLLGQETIKKGRYIKIGDKECEYNPRFRLILHTKLANPHYQPELQAQCTLMNFTVTRDGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTELVENLEITKRTAAEIEEKVKEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAVLKAAPDEALKQRVLNLIDSITSSVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINPSELDFLLRYPVQPGVTSPVDFLSHHSWGGIKALCSMDEFRNLDRDIESSAKRWKKFVECECPEKEKFPQEWKNKTSLQKLCMMRALRPDRMNYAIRDFVEEKLGSKYVMGRSVDFAVSFEESGAATPMFFILSPGVDPLKDVEKHGRTMGYTFDNQNFHNVSLGQGQEVVAEQALDLAAREGHWVILQNIHLVAKWLGTLEKKLEQHGEGSSQNFRVFISAEPSSSPEGHIIPQGILENSIKITNEPPLGMHANLHKALDNFNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNYLEANSKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIKPEMMEGELYLAPGFPLPGNMDYNGYHQYIDDALPAESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDAGSGEGSGTSRDEKVKAVLEETLEKLPEEFNMVELMGKV--EERSPYVVVALQECERMNILTQEIKRSLKELNLGLKGELTMTNDMENLQNAIYLDQVPDSWTKRAYPSMCGLALWFTDLLNRIRELESWSSDFNLPPAVWLAGFFNPQSFLTAIMQSTARRNEWPLDKMSLQCDVLKKNREDFSSPPREGAYVHGLFMEGARWDTQAGVIVDARLKELTPAIPVIFIKAVPVDKQETRNVYQCPVYKTRQRGPTYVWTFNLKTKENPSKW 4314          
BLAST of DNAHb-1 vs. Ensembl Cavefish
Match: dnah9l (dynein, axonemal, heavy polypeptide 9 like [Source:ZFIN;Acc:ZDB-GENE-050506-1])

HSP 1 Score: 3851.6 bits (9987), Expect = 0.000e+0
Identity = 1949/2978 (65.45%), Postives = 2356/2978 (79.11%), Query Frame = 1
Query: 4519 ADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXN---TKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVL-EKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEK-LGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAK-EYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQI-LLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            AD VI  W  VQRTW+HL+SIF  S+DIR QL +D+ERF   DT    L                        +    L +CEKALAEYLETKRL FPRFYFVS+ADLL+I+S G  P  V +HL KLFD+LA LKF  E E+E+   T+V V MY+++GE V F+  C   GQ E WL  L   MR+T+R  +SE+VS+ E+K RDQW+ ++PAQVAL+ SQI W T+V ++F R+EEG+E ALKD+NKKQ++QLN+LI +L+GEL+  DRQK+MT+CTIDVH RDVV KLI+QK+ N Q+F WL QLRHRW +  K CY+NICDAQF++++EYLGNT RLVITPLTDRCYITLTQSLHLTMSGAP+GPAGTGKTETTKDLGR+LGIMVYVFNCSEQMDYKSIGNIYKGLAQ+G WGCFDEFNRISVEVLSVVAVQVK IQDA++NK+ RF FLGEEI L   +GIFIT+NPGYAGRTELPENLKALFRPCAMV+PDFELICEIMLVAEGF+ AR+LARKFI+LY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKR D + PE+QVLMRALRDFN+PKIVT D P+F+GLI DLFP LDVPRKRD + E+HVRQA  +L+LQ EENF+LKV QL+EL AVRHSVFV+G  GTGKS + KTL KTYSN+K KP+  D+NPKAVT DELFG ++P+TREWKDGLFS  MR+L+ L+ DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI LT +MRLLFEISHLK ATPATVSRAGILY+NPQDLGW  +V SWI TR+ QSE+ANLTILFDKYVP CLE ++   K ITPI E S VQ LC LL+ LL  ENTPAD P+E YE+YFVF  +WAFG  +FQD L+D+R EF++WW  E + +K P+QGTVFDYYID  TKKF PW++R   FE++ + P+Q VLV ++ET    YF++LL+EK +PVMLVG AG GKT+L+ D ++   + Y+VA VPFN+YTTS MLQR   EK LEKKAGRN+ P G+KKLIYF+DD+NMPEVD Y TVQPHTLIRQH+DYSHWYDR +L LKEIHN QY+ CMNPTAGSF+++PRLQRHF VFA+ FPG E+L  IYS+ILS   L   +S  + ++V  LV  A+  H K+   FLPTAI+FHY+FNLRD+SNIFQGILFA P+ ++ P DLV LW+HE  RVY+DKL+++ D+E + ++  +  K+ FE +DE +   +PL+Y HFA G+GEP+Y  V   E L K L EALE YNE++A MNLVLFE+A+ HI RI+RILE+P G ALL+GVGGSGKQSL RLAAF+S L+VFQITLRKGYGI+DL+ D+AALY+K GVKNIG VFL TDAQI DE+FLVL+ND+LASG+I DLF ++E++ I++S+R E++  G++D+RENCW FFI+++R  L++VLCFSPVG TLR RARKFPA+VNCT+IDWFH WP+ AL SVS  F+  +  L    K S + F+SF H +VN+VS+ Y QNE+ +NYTTPKSFLE + LY N+L  K  EL  KM RLENGLQKL STA QV+DLKAKLA QEVEL Q+N     L+ K+   T K++ EK +AD EE+KV+ I+AEV+K+QQ+ E DLAKAEPALQAA  ALNTLN+ NLTE+++F  PP  V +V AA + LMA  G++PKDRSWK AK  IM K+D FL  L+N++K++IP+ +++  + EY  DP+FNPE ++ KS AAAGLC+WVINII ++E+ C+V+ KR  L  AN +L EA EKL  I+ K+ +L++ L  L   FEKA S+K RCQDE + T KTI+LANRLV GL    VR    + QY+ +E TL GDVL+T AF+SY G F+K YRL L+   W+P+L      +     LDP+ ML DDA +A WNNEGLP D+MS +NATIL N ERWPL+IDPQLQGIKW+K+R+G+ L+V+ LGQKGY+DVIEQAV  G+ VLIEN+EE++DPV+D LLGR+TIKKGR IK+GDKEC YNP FRLIL TKLANPHYKPE+QAQTT+INFTVTRDGLEDQLLA          E LK+ LTKQQN FKI LK+LED LL RLSAAE NFLGD  LVE LE  K TA EIE KV +AK+ EV INE RE YRP A RAS+LYFI+NDLNKINPMYQFSLKAF VVF KA+  AE   ++  RV  LID ITFS + Y +RGLFE+DKL FT+Q++FQ+ LL +KEIN  ELDFLLRF I  +  SP+DFLSN+SW  IK +S  +EF+ LDRDIEGS KRWKK VESE PEKEK PQEWK+K+SLQ+L +MRALRPDRMTYAV +FV+EKLG +Y EG  +EF++SF+ESGPA+P+FFILSPGVDPLKDVE+LGKKLGF+ D     N+SLGQGQE VAE AM+  ++EGHWV+LQNIHLV+KWL +LEK LE   E SH  YRVF+SAEPS +P+ HIIPQGILEN+IKITNEPPTGMLAN+H +L+NF+Q+ ++ C++E EFKTILF+LCYFHA V+ERRKFGPQGWNR YPFNTGDL ISV+VLYNYLEANS+VPWEDLRYLFGEIMYGGHITDDWDR+LC+TYLEEY+QP   D +L + PGF VP N DY+GYHNYIDE LP ESP  YGLHPNAEIEFLT  SD LF T+ E+Q RDS        S EE++K +LDDI+EKLP+++NM +I +K    ER PY++V FQECERMNML +EIRRSLKELDLGLKGEL I+++ME +  +L+ D + +SW++ AYPS Y LA WY D+LLR +EL+ WT D  LPSVIWL GLFNPQSFLTA+MQ +ARKNEWPLD+M L  DVTKK KE+   P RDGAYV+GL+MEGARWD Q+G I EA+LKEL PSMPVI ++A+P DRQ+ RN+Y CPVYKTK R  T VWTFNLKT+E+P+KW
Sbjct:    3 ADLVIGTWLAVQRTWAHLQSIFTNSEDIRNQLAQDAERFQ--DTVIICL----------------------FSICTLRLSVCEKALAEYLETKRLTFPRFYFVSAADLLEIVSKGTQPRQVTRHLLKLFDNLADLKFRDEEEQEDEGRTEVAVGMYSREGEYVPFSEPCVCEGQAECWLGGLELAMRSTVRHEISEAVSAYEDKPRDQWLLDYPAQVALTGSQIWWATDVGIAFERVEEGFETALKDYNKKQVSQLNSLINMLLGELTPGDRQKIMTLCTIDVHARDVVAKLISQKVMNGQAFAWLSQLRHRWDEQQKHCYVNICDAQFQFSYEYLGNTNRLVITPLTDRCYITLTQSLHLTMSGAPSGPAGTGKTETTKDLGRSLGIMVYVFNCSEQMDYKSIGNIYKGLAQTGVWGCFDEFNRISVEVLSVVAVQVKTIQDAVRNKKHRFHFLGEEIELRPTVGIFITLNPGYAGRTELPENLKALFRPCAMVIPDFELICEIMLVAEGFIDARLLARKFISLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKREDRNHPEEQVLMRALRDFNLPKIVTSDVPIFLGLISDLFPLLDVPRKRDLQLEQHVRQAVTELRLQPEENFILKVTQLEELLAVRHSVFVVGGPGTGKSQILKTLHKTYSNMKLKPVWTDINPKAVTTDELFGFLHPATREWKDGLFSSTMRELSALSHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERISLTSSMRLLFEISHLKAATPATVSRAGILYVNPQDLGWSSYVTSWIDTRKAQSERANLTILFDKYVPYCLEQVRCNLKTITPIPETSMVQTLCCLLDCLLTDENTPADSPRELYEIYFVFACVWAFGGALFQDHLIDYRAEFSRWWCKEMRAVKFPSQGTVFDYYIDPNTKKFTPWSERTPPFELEPDVPMQMVLVHSAETISLAYFMELLLEKGKPVMLVGNAGVGKTILVWDTISKRKEEYMVAKVPFNYYTTSAMLQRKCGEKSLEKKAGRNFAPPGTKKLIYFVDDLNMPEVDTYGTVQPHTLIRQHLDYSHWYDRQRLVLKEIHNCQYITCMNPTAGSFSVNPRLQRHFSVFAVHFPGAEALSTIYSSILSGHFLQGGYSYGVSRSVGTLVQAAICLHQKMTQNFLPTAIRFHYIFNLRDISNIFQGILFAQPESVRYPIDLVYLWLHECSRVYSDKLMEEKDVELFNKILLDTGKRYFEGIDESIFIHQPLIYSHFAHGVGEPRYAQVSDWEKLQKTLTEALEHYNELHANMNLVLFEEAMQHICRISRILEAPVGNALLIGVGGSGKQSLCRLAAFLSMLEVFQITLRKGYGISDLRSDIAALYIKVGVKNIGTVFLHTDAQIPDERFLVLINDMLASGDIPDLFSEEEVDMIVASIRLELRGLGLLDTRENCWNFFIDRIRKQLKVVLCFSPVGFTLRTRARKFPALVNCTAIDWFHPWPQHALQSVSRTFINNISGLEPAVKLSISDFISFAHTSVNEVSVKYQQNEKHFNYTTPKSFLEFMKLYGNLLGAKQRELTQKMERLENGLQKLLSTASQVEDLKAKLALQEVELHQRNTDTEALIAKIGQQTDKLNQEKSVADEEEQKVAAIQAEVTKQQQESEDDLAKAEPALQAANAALNTLNRLNLTELRTFANPPVIVANVLAAVLVLMAPGGRIPKDRSWKTAKV-IMSKVDDFLQALVNFDKEHIPDATVRVLREEYLSDPDFNPEFVRLKSSAAAGLCAWVINIIHFHEVTCEVEMKRMCLSQANADLIEAAEKLEVIRKKLSELDNSLDTLTAAFEKATSEKLRCQDEVNRTNKTIQLANRLVKGL---EVR----LSQYREQEATLCGDVLLTAAFISYAGSFSKRYRLELLHKLWMPYLRTQKVCLC---GLDPISMLTDDATVAKWNNEGLPGDKMSTQNATILLNCERWPLLIDPQLQGIKWLKSRYGSSLRVINLGQKGYVDVIEQAVVTGEPVLIENLEETIDPVIDPLLGRHTIKKGRFIKVGDKECTYNPNFRLILHTKLANPHYKPEIQAQTTLINFTVTRDGLEDQLLA----------EHLKVCLTKQQNTFKIELKQLEDELLTRLSAAESNFLGDNMLVEKLETTKHTAAEIEMKVLEAKVNEVKINEAREHYRPVAVRASLLYFIINDLNKINPMYQFSLKAFNVVFRKAVQNAELCVDVNTRVNTLIDCITFSTFNYINRGLFERDKLTFTSQLAFQVLLLMSKEINVRELDFLLRFSIDHSYISPVDFLSNSSWSAIKTMSFTDEFRGLDRDIEGSPKRWKKVVESECPEKEKLPQEWKSKSSLQKLILMRALRPDRMTYAVRNFVEEKLGVQYTEGRKMEFARSFKESGPASPVFFILSPGVDPLKDVESLGKKLGFTIDLGKLHNVSLGQGQEAVAELAMEKASEEGHWVILQNIHLVAKWLGSLEKLLERCCENSHPDYRVFMSAEPSPTPQEHIIPQGILENSIKITNEPPTGMLANVHAALDNFDQDILDQCSREQEFKTILFSLCYFHACVAERRKFGPQGWNRKYPFNTGDLTISVSVLYNYLEANSQVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEYMQPNQFDRKLALAPGFIVPSNLDYQGYHNYIDEMLPHESPVHYGLHPNAEIEFLTVTSDNLFHTLLELQSRDSLLGEGAPQSTEEKVKTVLDDILEKLPEEYNMSDITSKTA--ERTPYILVCFQECERMNMLINEIRRSLKELDLGLKGELAISSEMEQIQTALFFDNVADSWTRLAYPSTYSLAQWYNDVLLRCRELDSWTQDLSLPSVIWLSGLFNPQSFLTAVMQSLARKNEWPLDKMTLTVDVTKKFKEEFNQPARDGAYVYGLYMEGARWDIQNGTITEARLKELTPSMPVIAVRAVPNDRQETRNIYECPVYKTKLRANTHVWTFNLKTRERPAKW 2933          
BLAST of DNAHb-1 vs. Ensembl Cavefish
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:HGNC Symbol;Acc:HGNC:2942])

HSP 1 Score: 3296.91 bits (8547), Expect = 0.000e+0
Identity = 1658/3002 (55.23%), Postives = 2219/3002 (73.92%), Query Frame = 1
Query: 4432 QVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKL-GSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAK-EYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            Q++LQ M+  K +  F+ +V   Q  LS A+ V+ +W EVQR W+HLES+FIGSDDI+ QLP D+  F  I+TDFK L+ +  ET NV++AT KP L E L+ +Q  L +CEKALA+YLETKR+ FPRFYF+SS DLLDILSN   P+ V  HL KLFDS+A L F +E  E      V +++ + E +     CD  G VE WL R+ E MR  +R  ++E+V + EE+ R+ W  E PAQ  L++SQI W  +V L+F R+ EG++ AL+D++KKQ  QL +LI++L GELS  DRQK+MT+CT+DVH RDVV +L+ QK+ ++Q+FTWL QLRH W +  K CY  ICD QF Y++EYLGN PRLVITPLTDRCY+TLTQSLHL M GAPAGPAGTGKTETTKDLGRALG+MVYVFNCSEQMDYKSIGNI+KGL Q+G+WGCFDEFNRI+VEVLSVVAVQVK +QDA+++++ RF FL EEISL  ++G+FITMNPGY+GRTELPENLKALFRPCAMVVPD ELICEIML+AEGFL A++L RKFITLY LCKELLSKQDHYDWGLRA+KSVLVVAG L+R D   PEDQVLMRALRDFN+PK+V +D PVF+GL+GDLFP ++V R+ D +FE+ VRQ+ L+LKLQ E+ F+LKV QL+EL +VRHSVFV+G AGTGKS + +TL +TY+N K+KP+  DLNPKAV+ D+LFG I+P+TREWKDG                  +   +      W        D ++V               R   EIS L+ +TPATVSRAGILYINPQDL W  +VNSWI  R+ Q+E+A+LTILFDKYV  C+E ++  FK IT + E S VQ LC LL+ LL PEN P D P++ YE+YFVF  IWAFG    QDQL D+R EF++WWV E K++KLPA  TVFD+Y+D +T++F PW +R+  F+++ +  LQ VLVPT ET R +YFL LL+++ +PVMLVGG GTGK+ L+++ L+++ D+++  + P ++YT+S  LQR+LE+PLEK+AGR+Y P GS++L+YFIDDMNM   D Y TVQPH LIRQH+DY+HWYD   L +K I NTQY+ACMNP AG +TI+PRLQRHF V  ++ P +E+L +I+S IL + L   +FS S+      LV  A+  HN  +  FLPTA  F +VF+L DLS +FQG+LF+ P+C+K+  +L++LW+HE  RVY+D+  D  D   + +LQ +  ++A E+   +   ++P++Y H+  G  EP Y PV   E+LS IL EAL SYN++ ++MNLVLF+ A+ H  +    L +       VGVGGSGKQSL+RLAA  S++DVFQ T+ +GYG+ +LK+DLA L +K GVKN+  V LLTDAQI D++FL +++ L+ SGE+ ++  ++E++ ++  ++ EV++ G++D+ ENCW FF  +VR  L++VL  SPVG++LRVR ++FPA+++CT++DWFHEWP+ AL SVS  FL+E+  +    ++  + FM+  H +  +    Y Q+ERR+ Y+TP+SFLE + LY  +L +++  LQ K+ RL +GLQKL++TA QV++LKAKL +QEV+L  KN +A  L+ K+   T++VS ++R AD+EE+KV+ I+AEV+ +Q+DCE DLAKAEPAL+AA  ALNTLNK NLTE+K+F  PP AV++V AA M L+A  G++PK+R WKAA+A  MGK+D FL  L++Y+K+ IP+  L   K EY   P+F PE + +KS AAAGLC+W INI+ YYE++C+V PKR AL  AN EL  AT KL  I+ K+  L+  LQ L  +FE+A  +K RCQ+E   T  TI++ANRLVGGL SE VRW + V + + ++  L GDVL+  AF+SY G F++PYR  L++  W PFL  L+P +P+T+ LDP+ +L D A +A+W+N+GLP+DR+S+ENATILT ++R PL++DPQ Q  KW++  +G  L++V+ GQKGY++++E+A++ G+ VLIEN+EE +DPVL+ LL R T   GR++ LG ++ +     RLIL TKLANPH+ PE+QAQTT+INFTVT  GLE+QLL  VV++ER DLE LKL+L+ QQN  +I LKELED LL RLSAAEG+FL D  LVE LE+ K TA+ I  KV +A+  E+ IN  RELYRP A RA++LYFI+ +L+ INP+YQ SL++F  VF +AI+ AE  E++  RV +L  S+T+SV  + +RGLF++D+L F    +FQ+LL    I   EL+ LL  P   +  SP+ FLS  +WG I+ALS LE F  LDRD+EGSAKRW+K VESE PE+E+ P +WK K+S+Q+L ++RA+RPDRM+YA+ +FV+E LG +Y++ G VEF + FEES   +PIFFILSPGV+PL +VETLG KLGFS +  N  ++SLGQGQE VAEKA++  A +GHWV+LQN+HLV  WL  L   LE     +   YRVF++ +P+ SP+ HIIP+ ILEN++K+TNEPPTGM A+LH +L+NFNQ+T+EM + E EFK +LF+LCYFHA VSERRKFGPQGWN  YPFNTGDL+IS +VLYN LEANSKVPWEDL YL GEIMYGGHITD+ DR+LC+T L+E   P++ +GEL + PGF  PP+ DY GYH Y+DE LPAE+P LY LHPNAEIEF+T  SD LF+T+ E+QPRDS+    +  S EE ++  L+ ++EKLP+++++ E+ AK   + R+PY++V  QECERMN+L SE+  SL ELDL LKGEL+I+  MEAL  +L+   +PE WS+  +PS   LA W++D+L++ +EL+ WT DF LP+V+WL G FNPQSFLTAIMQ +ARKN WPLDRMAL  DVT+K K+D G PPR+GAYVHGL+++GARWD  +G+++EA LK+L P+MPV++I+A+P D+ +L+N Y CPVY+TK RGPT +W F+LKT+  P+KW
Sbjct:   23 QMQLQAMLQMKQVEFFHAQVLVLQTRLSRAECVLMLWLEVQRRWAHLESVFIGSDDIQHQLPVDALHFLSINTDFKDLMYKSAETKNVIEATNKPGLLETLKDLQMRLAVCEKALAKYLETKRMMFPRFYFISSTDLLDILSNRTQPKQVTPHLAKLFDSVADLHFSQEGTE-----AVGIFSGEREYLPLDTLCDCTGPVEVWLGRVEEVMRAGVRRQIAEAVGAYEERPRELWALERPAQAVLTASQIWWAADVELAFQRVTEGFDTALRDYSKKQTAQLTSLISMLTGELSPGDRQKIMTVCTLDVHARDVVSRLVDQKVSSAQAFTWLSQLRHCWDEDQKHCYAKICDTQFLYSYEYLGNKPRLVITPLTDRCYVTLTQSLHLNMGGAPAGPAGTGKTETTKDLGRALGVMVYVFNCSEQMDYKSIGNIFKGLCQTGAWGCFDEFNRIAVEVLSVVAVQVKTVQDALRHRKTRFVFLEEEISLKPSVGVFITMNPGYSGRTELPENLKALFRPCAMVVPDMELICEIMLMAEGFLNAKLLGRKFITLYNLCKELLSKQDHYDWGLRAVKSVLVVAGELRRGDKASPEDQVLMRALRDFNMPKMVMEDVPVFLGLVGDLFPGVEVQRQMDSDFEELVRQSALELKLQPEDPFILKVAQLEELLSVRHSVFVVGGAGTGKSQILRTLYRTYANRKQKPVWNDLNPKAVSTDQLFGFIHPATREWKDGT----------------DFCCFEFRFSREW-------RDSSRV--------------RRRCCEISALRNSTPATVSRAGILYINPQDLSWNMYVNSWIDRRQRQTERAHLTILFDKYVSRCIEQIRNSFKTITLVPENSMVQTLCSLLDGLLTPENVPVDSPRDVYEMYFVFACIWAFGGATHQDQLRDYRAEFSQWWVKEMKSVKLPAHATVFDFYLDPQTRRFVPWAERVPGFQLEADALLQGVLVPTVETVRLQYFLRLLLDRGQPVMLVGGTGTGKSSLIRNLLDTLPDDFLSISAPLHYYTSSSSLQRLLERPLEKRAGRSYTPPGSRRLVYFIDDMNMTAADCYGTVQPHALIRQHLDYTHWYDTQTLRMKLIINTQYIACMNPQAGHYTINPRLQRHFSVLTMNSPSRETLSSIFSPILIQHLQNQSFSPSVASIGPALVQAAIALHNTASCHFLPTAKNFLHVFSLWDLSRLFQGLLFSRPECVKRGCELLQLWVHESRRVYSDRFTDPADQNLFYKLQTDAARQACEQEPGL---QEPVVYLHYGGGAAEPMYAPVLGWEELSSILNEALHSYNQLYSSMNLVLFQQAMLHPSQHPPSLHNIHP----VGVGGSGKQSLTRLAAHFSNMDVFQPTVHRGYGLQELKVDLAGLCVKTGVKNLPTVLLLTDAQIPDDRFLNILSALI-SGEVPEVLSEEEVDGVVRGVKTEVRALGLLDTTENCWRFFKERVRQQLKVVLGVSPVGNSLRVRVQRFPALLSCTTVDWFHEWPQKALHSVSLHFLRELPAIEPTVQEPISLFMAHAHASARQAGERYRQSERRHYYSTPRSFLELLRLYGVLLGERNQLLQEKLHRLHSGLQKLKTTAVQVEELKAKLNSQEVDLNVKNGAAEALISKIGQQTERVSQKRRDADLEEQKVAAIQAEVTLRQRDCENDLAKAEPALEAATTALNTLNKVNLTELKTFPNPPKAVMNVLAAVMVLLAPRGRIPKERGWKAARA-FMGKVDDFLQALVSYDKECIPDQCLTVVKQEYLSSPDFLPEHVLTKSYAAAGLCAWTINIVRYYEVYCEVAPKRQALSQANTELDSATAKLFSIRKKLDDLDGHLQNLTAQFERAAGEKLRCQEEVTHTSTTIQMANRLVGGLQSEKVRWSEAVLELEAQQGALCGDVLLAAAFVSYAGYFSQPYREQLLENSWRPFLRQLSPPVPLTEGLDPVLLLADQASVAAWHNQGLPADRLSVENATILTRSQRCPLLVDPQQQAGKWLRNLYGPGLRLVQHGQKGYVELVEEALACGEAVLIENLEEKLDPVLEPLLNRTTRNSGRSVGLGAQQHQNPSSVRLILHTKLANPHFPPELQAQTTLINFTVTHAGLEEQLLGQVVSRERPDLENLKLELSIQQNLCRIELKELEDELLTRLSAAEGSFLKDAVLVEQLEHTKTTALHIHSKVVEARENELKINAARELYRPVAQRAALLYFIIKELHSINPLYQHSLQSFSAVFLRAIEDAEADEDVSARVRSLTQSLTYSVLQHINRGLFQRDRLTFLTHTTFQVLLMEGHIEVEELNLLLHLPAESSSGSPVSFLSAQAWGNIRALSVLEAFWGLDRDVEGSAKRWRKLVESECPERERLPLDWKKKSSMQKLIILRAMRPDRMSYALRNFVEESLGCEYLDAGKVEFEKVFEESSSLSPIFFILSPGVNPLTEVETLGLKLGFSTEQGNLHSVSLGQGQEGVAEKALEAAALKGHWVILQNVHLVKHWLVRLSDLLELSGRNADPQYRVFLTGQPAPSPDQHIIPRAILENSLKLTNEPPTGMSASLHAALSNFNQDTLEMSSHEQEFKLLLFSLCYFHACVSERRKFGPQGWNCCYPFNTGDLSISTSVLYNCLEANSKVPWEDLCYLVGEIMYGGHITDELDRRLCRTQLQELFNPKLFEGELFLCPGFPAPPDLDYAGYHRYVDETLPAENPSLYSLHPNAEIEFMTVTSDSLFRTLLELQPRDSALREESEQSVEEMVRDELEQLLEKLPEEYDLAELLAKT--DRRSPYILVCVQECERMNLLISEMHTSLMELDLALKGELSISPHMEALQTALFYGRVPEIWSRLTFPSTKSLAPWFSDVLVQCRELDTWTQDFVLPAVVWLSGFFNPQSFLTAIMQSIARKNNWPLDRMALCVDVTRKTKDDYGHPPREGAYVHGLYIDGARWDCSAGVLSEAVLKDLTPAMPVLYIRAVPADQLELKNTYECPVYQTKLRGPTLIWNFHLKTRHPPAKW 2971          
BLAST of DNAHb-1 vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2142.47 bits (5550), Expect = 0.000e+0
Identity = 1376/4081 (33.72%), Postives = 2199/4081 (53.88%), Query Frame = 1
Query: 1396 SGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXX-XXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTM-FISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLK-----ADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSK----DPLFEVSMDLQ------GNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLA-----IGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPF--NFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMR--SWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNEST-TLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXX--XXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYE-NALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKP-------LAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPEN--TPADCPK--EWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTK-FEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGD-NYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFT-ISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKK--PLLYCHFAQGIGEPK-YMPVERSEDLSKILKEALESYNEVNAA--MNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLP-EDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVS----KIKAEVSKKQ---QDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGA-DLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRN-TIKKGRA-IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPID-----FLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTS-LQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXX-RVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDG---ELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPR-DSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERG-----PTFVWTFNLKT 13410
            +G +G  +++N++++   F    +         LD   T +   Y++F+A + DL+  +   ++ AF   +  +   +L+D+F  L  R  +K    ++  ++  ML +E      VY +    N+++ + H           W + M+ RI+  + +    +       E +  V++    L     +   + Y+ W   +D     NL+QPL+IR  +    + +NFD  L  +  E+ Y + L Q EIP   ++ + + + LR    N+ L+V  YN +       E  L    +  +D++L+  ++ L W+S    N    +I + R  +H  + +++  +     + I     + S L   +        +L+  ED+   R  ++         +V   S + +        V +HW  Y + +D M+ E  +  + +SL  +   I G      DPLF+V + L+        ++ F P+L +      +++V+S+ + +    S  +RL        S  +     +E++EE+ K +  I+          + Y   +D++  +W  N++ F                       I  ++   P +  F   I +Y +    ++K      + ++  +DC   K + +     W   F Q L    +  LKEL  F++     L++         LVE +  L  ++      +    P+ +   +L+ Y   +  EV   LE L  +W   ++V +     +   +++  + +      F  K  T  + F    PF  N S     E +     ++  L++    +    ++F+   P  K ++   K++  L  +W+     ++  + WK   +  +  E M+   ++  K++  L +E++   W+     +++I+    ++  + +L++PA+RDRHW Q+    +  FD N +  TLE ++ L L    + +  I   A KE+S+E+ L+ +  TW +   +   +   G      +EE+ + LE++QV L  M  S+++  F  EV  W++ LS   +VI++   VQR W +LE IF+G +DIRKQLP +S  FD I++ +K ++  + +  N ++ T  P L E+L  + S+L   +K+L  YLETKR  FPRFYF+S+ DLL+IL    +P+ V  HL K FD++  L+  K    ++   G  M++ DGE VEFT+   L G VE WL  +   MR T++  L    +        RD+W+ ++P Q+ +++SQI W T+V       +E  + +ALK   KKQ++ L+     + G LSK  R K++ + T++VH RDV+ KL      +  +F WLCQLR  W     DC I   +  F+Y +EYLGN+ RLVITPLTDRCY+TLT +LHL   G+P GPAGTGKTET KDLG+ LG+ V V NCS+ +DYKS+G +Y GLAQ+G+WGCFDEFNRI++EVLSVVA Q+  I  A+      F F G +I L S+ GIFITMNPGYAGRTELP+NLK++FRP +MVVPD  LI EI L  EGF   ++LA+K  TLY L  + LSKQDHYD+GLRA+ S+L  AG  +R  PD  ++++L+ +++D NI K+ + D P+F G+I DLFPA++ P     + ++ + +      LQ     V KV+QL E    RHS  ++G  G+ KS+ W+ L K  S + +K            LNPKAV+  EL+G  + ST EW DG+ S +MR          KWIV DG +D +WIES+N+VMDDNKVLTL + ERI +   + LLFE+  L  A+PATVSR G++Y +  DLGW+P+V SWI  R+ + E  +L  LFD+Y+   +   +   K++ PI E++ V  LC L + L  PEN   PAD        EL+F+F  IW+   C   D+  D R +    ++ E +    P + T+++YY+DT+ K +  +  ++ K +      P   ++VPT +T R+ + ++ L+  + PV+L G  GTGKT + Q  L  +    + +  +  +  TTS  +Q ++E  +EK+    Y P G KK++ F+DD+NMP VD + +  P  L+R  IDY  WYDR     +   +   LA M P  G  T IS RLQ  F +  ++FP +  +K I+ T++++KL   F   +    S L    L  +  I++ FLPT  K HY+FNLRD+S +FQG+L +  D       + RLW+HE  RV++D+L+D  D E +  L  E     F+     +   K  P+    F   + EP  Y  +   + L   ++  LE YN       M+LVLF DA+ H+ R+ R++  PRG  LLVG+GGSG+QSLSRLAA+I    VFQ+ + K Y   + + D+  LY   GV N   VFL  D QI DE FL  +N++L+SGE+ +L+  DE E + S++ +  +   ++++ +  + + I +VR+ L +VLC SPVG   R R R++PA+VNCT++DWF EWP+DAL+ V+ R+L  + L   E  +   A+    +H++V + S       +R+NY TP ++LE ++ Y  +L +K  EL  ++S+L NGL K       +DD ++K+ A  VELE       E+ ++       +  +KR AD ++  VS    KI AE  K +   ++ +RDL +A PAL+ A +AL +LNK ++TE+KS+G PP  V  V  A M L         + +W  AK   +G+ + F+  L++++KDNI +  LK   +YC  P+F PE I   SLAA  LC WV  +  Y  I+  V+PKR  L  A  +L E    L+  +NK +++E++L++L++++++  + K+  + +++     ++ A +LV GLA E VRW + VE  + +   L GD L+  AFLSY+G F   YR  L+   W+    +L   +P +   +    L     +  WN +GLPSD  S EN  I+T   RWPL++DPQ Q +KWIK       LKV+ L    +L ++E AV  G  VL++N++E +DP L  +L ++ T   GR  +KLGDKE EYNP+F+  + TKL+NPHY PE+  +TTI+NF V   GLE QLL  VV +ER +LE  K  L       K  L+ELED +L  L+ A G+ L D  LV  L+ +K TA E+ +++E ++ TE+ I+  RE YRP A RAS+L+F+LND+ +I+PMYQFSL A+  +F  +I++++ S +L+ R+ NL D  T++VY YT RGLFE+ KL+F+  M  +IL    ++N  E  F LR  +V +    +D     +L++++W  I  L  L  F  L    E   K W ++  S  PE    P EW+   + LQ++ ++R+LR DR+++ V  F+   LG ++VE   ++     E+S   TP+ F+LSPGVDP   +  L +    SG   +F  +SLGQGQ  +A + +  G K GHWV L N HL   W+  L+K +E+   E      R+++S+ P   PE    P  IL+  IK+T EPP G+ +N+ +      +     C++   ++ +LF+LC+FH+++ ER+KF   GWN  Y FN  D  +S N++  YL+   ++PW+ L+YL   + YGGH+TDDWDR+L  TY+ +Y     ++    +L+ +P + +P +     Y  YI +  P E P ++G HPNA+I    S +  LF T+  +QP+  S+ A   G SRE+++ +I  D+ +K+P+  +    Q K+  ++ +P  VV  QE +R N L   IR SL EL+ G+KG + +++ +E +   ++   +P  W K AYPSL  LA W  DL  R+++   W      P + WL G   P  FLTA++Q  AR++   +D ++ +  V+  +  ++  PP+DG ++ GL++EGA WD ++  + EA+  +L   MP I  + +   ++  +N+Y+CP Y    R      P+FV   +LK+
Sbjct:  417 AGRQGPEVTRNLLEIEATFDKSLQVLRSVRKGILDVRNTSWHDSYNRFRAEVKDLEVMMQNLINTAFKTVNSVEEGVQLLDVFQHLSAREAIKRTLSRKTVDVYAMLSKE------VYLV----NKELSQAH-----------WARAMQRRIQGQMQVCVLENAHFLPQIENDKKVREACMQLLQKLDELVRRMYSEWSQSLDRGSLKNLNQPLMIRCKEKAGMLDINFDKNLLKMFNEMYYWERL-QFEIPHHVSEAYQRREDLRTMRENVLLVVRDYNRIISALSADEVGLFRERIRFLDKKLQPGLSKLLWSSHGASNF---FISECR--LHASKVQLIVDEYKAANLAISKHCGEISELLLVRLDGRTVYRDLEFEEDQQAHRLSQLLRIKTSYQHIVNTMSRVYETFHNDGPEVQQHWVSYTEKMDLMLEEALRLNVKWSLLELSKAISGDSKSPPDPLFKVQVVLRQYGPGSTAQVEFSPTLQK-----LAQIVNSINSQLISTISVFQRLPDLLTRKRSQRKPVHNIIEQDEEICKIQAAIAAGMTANASHLQAYLKTWDKHREIWEINKDSF-----------------------IRRYQHLNPPVSSFDSDIARYSEVANNVQKEETVLSV-QFVLLDCSPLKFSLVQHCNEWQGKFTQLLSLMASTRLKELHSFLQDNAHRLSQPPQ--TLVELVEGLKLLETLQGDLNKIESQIPPIHEQFAILEKYEVSVEREVQDLLEALNGEWQGFQQVVIDSDIMLKKHKDKFKSGLFFSAEEFKKKMQTTMQDFNSTGPFGSNVSSEAALEQISVLRAQLESLKEEEGTIRHGLSIFKTEQPTSKDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTENMESTAQTMYKNLNKLSRELKDKQWEIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDKG------TEEVFQALEDNQVTLSTMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLG-EDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAG--MFSADGEFVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDICLVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDKRQ-KMEVDHLKRLFDRYIKKTISFKRTHCKELVPITELNGVISLCRLYDSLASPENGVNPADNENYGRMVELWFIFSLIWSI--CASVDE--DGRKKIDN-FLREMEGT-FPNKDTIYEYYVDTKNKTWASFEDKLPKGWRYPSNAPFYKIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGLDPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWYDR-----QMKMDMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIFGTMINQKL-QEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAEKLGSLFDLTYHNICPNKQQPI----FGDFLKEPHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARKENVLETADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGLILGNVEKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFK-------IDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGC------EPTWAEAKRQ-LGESN-FIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLE--VPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKLANFHGLMSSFEKYPKDWHQWYTSSEPENAPLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAEA---SGMGPSFHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQVEDSHPDFRLWLSSSP--HPE---FPIAILQAGIKMTTEPPKGVKSNMKRLYQLVTESQFSRCSRPVVYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLDEYEEIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVPELVDYESTQ-KLLQDDPSPLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEK-AYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNVSVDTLSWEFIVSTVDDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKKVAKNMYSCPCYYFPVRSGGAGRPSFVVGVDLKS 4386          

HSP 2 Score: 100.523 bits (249), Expect = 4.702e-20
Identity = 75/312 (24.04%), Postives = 150/312 (48.08%), Query Frame = 1
Query:  166 TDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKESISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPV----GSEKVSEGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEI 1089
            ++E  + +  F     I+ L +   P  G L +Q+  P+ +  +  +F ++ +E++  + +F   + FG +    ++   S +  ++    S      +WP  I ++   H N           +  GKT+L +PV     S +V+  D        + ++  +E V+I W  QI +VL+ Q + ++  G +  P  E+D+WK+R  +L  I +QL  P V  +  +L+   S+Y PPF  + K +    +++Q+   +L+ LR   EE+  ++  E+EP +  + +V  +IW +   Y   ER+  L +++
Sbjct:   99 SEENNRALDKFITDSTIKILIIYLDPFTG-LRVQHTMPSQVVEQLAYFIRE-EETVIMEESFESSVQFGIVRGGDME---SLLRLMMGIHASQVALSTAWPESIKNNYSTHMNRFLTNLTDTRYKLVGKTVLYIPVEALQHSPEVAARD--------KELVKRMEVVMIHWTRQIKEVLNAQETVEI--GDSSGPLEEIDFWKSRCSDLSGISQQLQKPGVLHIQAILQLAKSSYVPPFCRLAKQIQDGTQQAQSNLSFLSLLREPCEELALLKPREVEPKLAHIINVSRVIWVNSVYYNTRERLTTLFRKV 395          
BLAST of DNAHb-1 vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 2105.1 bits (5453), Expect = 0.000e+0
Identity = 1435/4388 (32.70%), Postives = 2313/4388 (52.71%), Query Frame = 1
Query:  643 IETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQ-VEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEF--KNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDK---RYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLT----LASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDT-----MFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLF---------------------ERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEH---WKQYV-DNIDDMIVENFQETINYSLQYMIDQIEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSME--DYRTDLEENEEL---------QKKRNE----ISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEK---MNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLE-ELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHI-----EISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKH---SRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMR-TXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGP-KWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEAL---------KLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQ------DQLVDHRVEFTKWWVTEFKTIKLPAQ-----GTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNY-VVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAK-LTLKEIHNTQYLACMNPTAGSFT-ISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAF-EEMDEMVMFKKPLLYCHFAQGIGEPK---YMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVV-RLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTI-KKGR-AIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLT-------SPIDFLSNNSWGGIKALSAL--EEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNK-TSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYL-----EANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGEL------NIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKED-MGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKER----GPTFVWTFNLKTKEKPSKW 13431
            +E  V+ W  QI  VL +Q  ++  A   P P  E+D+W+ R+  L  + EQL  P VKK+  ++   +             +   L E+ N   +L+ L    + +   V F  +   I  + + L L+W     Y   ER+V L + I+                      E  E+V R + I   FKE     RE  K    DG + ++                      +W    +  F    ++E SG   R           EF  K +F+        C D         Y+  + ++D+      + +     D    D V + +D     L  PI +L FD    R     KM+ ++  +   V +       + P + K  P V G + W + +  RIK P+     L   LD++  K+       +K+ E+   ++ +E+K    W    +      +++ LL+  +D+     + + VNF  +L+ ++ E  YL  L    +P+ A ++  +     + ++ L  +V+  + L  +    E  L+  ++ ++   L      L WNS     G  ++I +    V    S V + K+N   +   + + + + LF                     E++  K   LL+L          Y  I     +   L+ + S   +A+S++++   W++ V D +  M+++N Q   N +L        GS  PLF++   L   EIV  P      +++  +L+   V D  +   +  R   G+ +E    R D E+   +         Q + NE    +S+  +        Y  ++  Y  LW  ++   M +F                         + P    +  ++  Y    +E+ +   +   +++    R+D           ++ W     + L D     L  L   ++  +  L K  +    E L  ++  + N+++     +  F  +++    L  YN ++P+E  LQL   +   W++    +  V +++   +       + +   +  +   F E F    P         ++LD+  +     E++ +E   ++L  +  LF++ +  + +L   ++E+R L+ +++   V  ++   W +TLW ++N++ + +  + F KS+R L K++R+      +E ++K    SL  + +L+N A+RDR+                         L LH +    R  + K    +   + +KE+  TW  M+F  +++   ++    +L + +E+ + L+++ V LQ+M  S++I  F + +  W+K LS   +VI++W  VQR W +LESIFIG D IR QLPE++++FD ID  FK ++++      + +    P     L+ +   L  C+K+L +YL++KR AFPRF+F+S  +LL IL + + P  V +H+ K++D++A L+F          V  A+ + +GE++E        G+VE W+  +L EMR T R           ++KSR  W+ ++   V L+ +Q+ W  EV   F ++  G + A+K + KK   Q++ L+  +   L K+DR+K+ T+  IDVH RD+V   +   I ++  F W  QLR  W     D ++  C A+F Y +EY+G   RLVITPLTDR Y+TLTQ+L + + GAPAGPAGTGKTE+TKDL +ALG++  V NC E MDY ++G I+ GLAQ G+WGCFDEFNRI   VLSV++ Q++ I++A+  + KRF F G+EISLDS +GIFITMNPGYAGRTELPE++KALFRP  ++VPD + ICEIML +EGFL A++LA+K   LY+L +E LSKQ HYD+GLRA+KSVLV+AG LKR  PD  ED VLMRALRD N+PK V +D P+F+GLI DLFP LD PR R P F   V     + K     N V KVVQ+ E    RH+  V+G  G GKS+V  TL +  + L        LNPKA++  EL+GI++P TR+W DG+ S I RD+   T     ++I+ DGD+D +W+E++N+VMDDNK+LTLA+ ERI L     LLFE+  L+ A+PATVSR G+++++P++L + P+   W+++R    EQA+L  LF+KYVP  +E +           + K I P  +++ V  L  +L+ LL PE    D   E  E +F+     + G+ + +      D LV          V + KT+  P +      T+FD++ D  TKK+ PW+  + K+  + +     +LVPT +TTR  + L+ +++ +RPV+LVG +GT KT   Q+ LN++  ++ +V  + F+  TTS  LQR LE  +EK+    YGP   K L+ F+DD+NMP VD+Y T QP  L++  +D    YDR K L  K++ +  ++A M    G    +  R    F VF + FP +E+L  IYS+IL       F   +      L    L  +  I     PT  KFHY+FNLRDLS ++ G+     +     +  VR+W +E  RV+ D+LI++ D    Q   K L ++ F  E+D  +  + P+L+  +   + E +   Y  ++  +    + +E LE YNE    MNLVLF+DA+ H+ R++RI+   RG+ALLVGVGGSGKQSL++LAAF +  DVF+I L +GY  ++ + DL  LY+K G++N   VFL TDA +A+E FL L+N++L SG +  LFPDDE E++++ +R+E    G   S+E+ W +FINK  S L +VL  SPVG  LR R R FP +VN T IDWF  WP  AL +V+  FL E  ++P  + ++    +  VH +V + S  + Q  RR NY TPK++L+ I+ YS +L+ K   +  +  RLE GL KLE  + Q+ DL  KLA Q+V L +K+++   LL++++T+T     +K++A+ + +++ +    +  +++D E  LA+A PAL+AA+ AL  L+K+++TE++SF  PP     V   C C++   G   K+ +WK AK G+M + + FL +L+  + D+I    +K  + + K+ N + EE+++ S A +G+  +V  ++ Y ++  ++KPKR+ +    +   ++  +L  IQ++++ ++ +L  L +++  A  +KQ  Q+EA L  + +  A++L+ GL SEN RW + +E+ K +   L GD L++ AFLSY G F   +R  ++   W   +  L   IP++Q      +L D+  I+ W +E LP D +S++N  + T A R+P+ IDPQ Q + WIK +   +   +       +L  +E A+  G   L ++++E +DPV+D++L +N    +GR  I LGDKE +Y+P F+L L TKLANP Y P +  +  +IN+TVT  GLEDQLL+ +V  ER +LE  +  L ++ +Q K  LK+LEDSLL  L+ + GN L +  LV  LE  K  A E+ EK++ A+ T   I++ R+ YRPAA R ++L+F+L ++  +N MYQ+SL +F  VF+ ++ ++ P+  L  R+ N+++++T +VY Y   GLFE+ KL+F+  M+ +I          EL+F L+     NL+        P D+L +  W  I  L+ L   EF  L  DIE + K WK + + ++PE+  FP ++++  T  Q+L ++R  R DR+  AV+D+V   +G KYV+   + F   FE+S P +PI FILSPG +P  D+  L ++ GF  +   F  +++GQGQE VA + ++     G W++LQN HL+ KW     +K  E   + H  +R++++ +P         P GIL+ ++K+  EPP G+  N+  +      ET+  C     ++++++ L +FHAVV ERRK+G  GWN  Y FN  D  + + +L  YL     +    +PW  L+YL GE+MYGG   D +DR++   Y++EYL   + D         N    +++PP+   + Y   I+    A +P ++GLHPNAEI + T  +  ++  + E+QP+     G  GISR+E I Q+  DI  KLP  F++  I+ K+ P+  +P  VV  QE ER N L   + RSL EL   L GE+ ++++++ ++ +L+   IP  W K A  +L  L  W      R ++   W  +   P+V+WL GL  P+S+LTA++Q   R+N WPLDR  L   VT    ED +   P  G YV GL++EGA WD + G +  +K KEL   +P++ +  I   R  L+N    PVY T  R    G   V+  +L T E  S W
Sbjct:  158 LEQCVMNWQAQITIVLEEQQKKKPQA---PGPLAEIDFWRERAAALSALSEQLKLPVVKKILEVMTRAEPATVQNLDLTVTELNNYLVEAVNNVDFLSTLERHFKNLATGVSFIVILETIPQMMNGLQLVWIISSHYNTDERMVPLMERIA---------------------WELSERVARVVNIRLLFKE----RREVAKAKVLDGKKVLD----------------------QW---KSCYFEVRARIETSGTDPR----------WEFDRKKLFEKTDYMASICQDL--------YNVLQVTLDEFYNVFGSEMRAVTRDSRRIDDVVRWVDS----LVVPIEELNFDPFDIRKTGSWKMVMKDFRSKVEVINSMFVEQRENPPVSKIYPPVAGAVYWERLLFHRIKDPIIRFQELPEMLDNEQGKSV-----TEKYLEVGRRMRDYEVKKVEGWRKETERMLPELMNRTLLL-TVDSSGDRGIRLVVNFAPELKEIISETIYLDRLGYA-VPELARNVALQEHRFLRCVDELKNLVKRCHSLMDSLNDAEFLLLTPQVQELRRVLRAGWRRLNWNS----LGIAEFIGRSEQAVTKFESLVSQIKKNARDVDAKLQDIETANLFKFPAPDKAGDLPGVKEFFELVEKQRVKDVILLSL---------MYTAIGPLLTKTESLIMQTSTG-RAESMTQYYAYWERKVYDALTKMVLKNLQ-VFNTALM-------GST-PLFKIETILSAPEIVLHPK-----SNDVYKLMMQSVRDCLECTKRFVRWMNGTCIECPPQRVDGEDEPFVFSFYSEIYPQPQVNECAVAVSQSAQQLLGSLGRYLGRWKRYHPLWNLDKSIMMEKF-----------------------AAKKPACVTYDEKLKFYSNIGQEVAQQPLVKDVHVV----RLDLEPLAHTVQENVQAWVSSLGRLLNDSAREDLYALRSELQQLSENLKK--SPDTLEDLKFVLSTISNIRDMSVDVELRFRDIQERYRTLTMYNIQVPEE-ELQLAANIRNMWSDLFSESRQVDRSLGRAKKTFTEITKEQIVQYKQEVAIFAESFNMHGPGAVG-----DNLDKGRLRYCSEELAKIEAGRQDLVGAEKLFDLPITTYPELLNVQREMRALRQIYE---VYKAAKTEWSQTLWVNLNIQLLQEGTEGFIKSLRKLPKDVRAMPVAFFLEGRMKEFKESLPLLLDLKNEALRDRY-------------------------LFLHCY----RLYLLKDWSLIGSPQGVKEVVDTWEVMKFSVQRYFKGTQERGYILGSVDEIQQNLDDNAVNLQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGD-IRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILGS-SEPACVQEHMIKMYDNIASLRFDSGTN--GETVAGALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLDYQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQIDNLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLGLLTKMYALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRP-PKEQADLRKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQLSMMLDALLEPE----DLSSEELECFFIEALYCSLGAALLETGRKKFDDLVKKLSCLVS--VQDEKTLAGPGEIPGYLPTLFDFHFDGTTKKWMPWSSLVAKYIHNPDTKFIDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQNFLNNLNPDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGH-TRPFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGSELDSAM--RDPILFGDYRTALSESEPRVYEDIQDYDACKALFQEILEEYNENKTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGHSKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMIPAAHSETVIGHVCMVHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPK---QVQVVCECILVMRGH--KEINWKTAK-GMMSEAN-FLRSLMEMDCDSISGGQVKTVRGFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDV--LERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLK----GNLSLEKSKRKKPCDWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNWFDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKF--LAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKW-LKDLEKALERITKPHPDFRLWLTTDPIRD-----FPIGILQKSLKVVTEPPNGLKLNMRATYFKIQLETLMSCPHP-AYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYLTKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMDEYLGDFIFDTFQPFHFFHNKDVDYRIPPDGSKEVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGG--GISRDEYIAQVARDIQNKLPSAFDLDVIRKKLGPDV-SPTSVVLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSW-VEVGEPAVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLYTHVTHYRSEDEVTEKPGQGCYVSGLYLEGADWDVEQGCLVRSKPKELVVQLPILKVIPIEAHRLRLQNTLRTPVYTTSMRRNAMGVGLVFEADLFTTEHHSHW 4328          
BLAST of DNAHb-1 vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 1934.07 bits (5009), Expect = 0.000e+0
Identity = 1190/3305 (36.01%), Postives = 1869/3305 (56.55%), Query Frame = 1
Query: 3850 FEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKF-DMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRT-GITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXN-----TKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFE-FPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNL------KKKPL-----AVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSW---ISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYEL------YFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGD--NYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQ------YLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMF-KKPLLYCHFAQ-GI--GEPKYMPVERSEDLSKILKEALESYNEVNAA-MNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMID-SRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQ-QDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGAD-LKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNT-IKKGR-AIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSP----IDFLSNNSWGGIKAL-SALEEFKNLDRDI---------------------EGSAKRWKKFVESETPEKEKFPQEWKNKTS-LQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXX---RVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLD-GELNIVPG-FKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNM-VEIQAKVPPEER---NPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMAL----------QCDVTKKNKEDMGGPP----------RDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPT---------FVWTFNLKTKEKPSKW 13431
            F+V V  F  L +   EL+  +++WD ++      + W +  ++ ++ EQ++ +   +AK +  L+K +   +    ++ +++ +   L  V  L+NP+++ RHW  L         D     TL  L++L + ++ ++++ +  +A  E S+E +LK++   W   EF    H  +  + +L  ++E+   L++  + +  + +S+Y+      V  WQ+ L   +Q ++ W   QR W +LESIF  + DI++QLP +++ F ++D  +K ++ ++    N ++A  +P L +  +   + L   +K L  YLE+KR+ FPRFYF+S+ +LL+IL+   +P+ V  HL K FD++A+L+F     E       T   +AM + +GE V         G VE WL ++ E M  ++R +   ++   +   R +W+    P+QV L+ +Q+ W  ++       +  +  ++ +F K+   +LN+L  L+ G L K  R  +  + T+DVH RD+V  ++ +K++ + +F W  QLR+ W     +C   +  +Q+ Y +EYLG  PRLVITPLTDRCY+ L  +L L + GAPAGPAGTGKTETTKDL +AL I   VFNCS+ +DYK +G  + GLAQSG+W CFDEFNRI +EVLSV+A Q+  I++A   K  RF F G EI L      FITMNPGYAGRTELP+NLKALFRP AM+VP++ LI E++L +EGF  +R+LARK   +Y+LC E LS+QDHYD+G+RA+KSVLV+AG+LKR +P   ED VL+RALRD N+PK + DD  +F G++ DLFP +++P       +  +  A    KLQA  + V KV+QL E   VRH V ++G  G GK+ V+  L     +L      K  P         LNPK+++  EL+G +N  T EW+DGL ++ +R      S+  KWIV DG +D +WIE+LNTV+DDNK+L LA++ERI LTP + ++FE+  LK A+PATVSR G++YI+ ++L W P+V +W   I  +  +     +  LF+ YV   L  +  +  +  P V+IS V  L  LLE LL+ +  P D   E   L       FVFC +WA G  + ++   D    F K    E    KLP+ G ++ YY+D ++K+ +PW + +  F  + E P   +LVPT++T RF Y ++ L+  +  V+  G  G GK+V+ +  L+ I +   YV   + F+  T+S   Q ++E  LEKK     G  G K++I F+DD+NMP++D+Y +  P  L+RQ+ D+  +YDR K+  KEI + +         C  P  G   ++PR  RHF +  L  P + SLK I+  IL+  L  +F  ++ +  +N+V+ A+  + ++++  LPT  K HY+FNLRDLS   QGIL      ++  + + RL+ HE +RV++D+LI++ D + +  +  E+  K F    E   F K P+L+  F + G+   +  Y  +   E L  +L++ L+ YN  +A  M LV F+DA+ H+ RI R++   RG ALLVGVGG+GKQSL+RLA  +     FQI L +GY  +    DL  LY  AGV++   VFL TD QI  E+FL  +N++L SGE+ +LF  DE+E ++++ R + K  G+ + +R+    FFIN+VR+ L +VLC SPVG   R R R FP++VNC +IDWF +WP +AL+SVS  F   V+L  ++ K++ ++    +H +V +++  Y    RR  YTTP S+LE I LY +ML +K ++L     R++NGL KL  T + VD L+ +L+A E  L+QK+     L+EK+ATD +     +R+  +E+E V+K+KAE ++    D +RDL +A PALQAA  AL++L++++++E++ F  PP  V  V  A +C++ +     K   W +AK  ++G  + FL  L +Y+K+NI E  ++  K Y  + +F PE+++  S A   +C WV  +  Y  +  DV PKR  L  A  EL      L+  Q ++KQ+EDQ+  LQD+F+ + ++K+       LT   +  A +L   L  E +RW + V Q+++E   + G+V +  A ++Y G FT  YR  L+D  W+     L   IPI  N   + +L D   I  WN +GLP D +S EN  ++T   RWPL+IDPQ Q  +WI+ +   + LK+++L    +L  +E A+  G  VL+E ++E++DP L+ +L + T +  GR  I+LGD + +Y+  FR  + TK+ANPHY PE+  + TIINFTVT+ GLEDQLL+ VV  E+ +LE  + +L  + N  K  LK +ED +L  L  +EGN L +  L++ L+ +K T+  I+ ++++A+ TE  IN  RE YRP AAR S++YF++  L++I+PMYQ+SLK F+ +F   I+ +E   +L  R+E L+     + Y   SRGLFE+ KLIF+  +  +IL     ++  E +  LR     +   P    I +L+ ++W     L   L  FK L R+I                     EG  K    F E E  E E     W  + S  Q+L ++++   +++ +A+ DFV E LG  ++E   V+ +  +++   +TP+ F+LS G DP+   +   +++G+S   +    ISLGQGQ  +AEK ++   K G WV LQN HL + W+ A+E+ ++  +E +   +   R+F+S+ P+ +      P  +L+N++K+TNEPP G+ AN+ ++         E       ++ I+F +C+FHA++ ER+KFGP GWN  Y FN  D   ++  L N    + ++PW+ L Y+ GEI YGG +TD WD++  +T L+ +  P+ L+ G L    G +        + + +YI+     + P ++G+H NA + F    +  L KT+ E+QPR SSG GA G S +E +K++ D I+ KLP+  +M   +++    +E+   N    V  QE +R N L   IR SL  L   + G + ++ +ME + NS     +P  WS  AYPSL  L  W  DL LR   ++ W      P   W+ G F PQ FLT  +Q  ARK   P+D +            Q  V +  +    G            +DG  VHGLFM+ +RWD +  ++ +A   ++ P +PV+  +    + Q   ++Y  P+YKT  R  T         FV T  + +K     W
Sbjct:  825 FKVEVTNFDALNEVCDELKRKQMMWDSLDEWEVFTKEWLECQFETLDPEQLNSEVAKYAKIVNQLEKGLPPNNVVPLLKKKVEFIREKLPVVAFLRNPSLKARHWEMLEEIIGAPLRDKETPLTLAGLIELEVFHYAEQIQDVSGQASGEASLESILKKVEDGWKTAEFVVLPHRDSKDVFILAGTDEIQILLDDSIINISTITSSRYVGPIKSRVDEWQRQLLLFNQTLEEWMTCQRNWLYLESIF-SAPDIQRQLPAEAKMFMQVDKSWKDIMRKIYRLPNALRAATQPGLLDTFKNNNALLEQIQKCLEAYLESKRVVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAIARLEFALAPAEGEQERTFTNDILAMVSPEGEKVSLGKGLKARGNVEDWLGKVEEAMFQSLRRLTKMAIGEYQSMPRTEWVVSGLPSQVVLTVAQLMWCRDLTQCLEGGDHDHLQSVANFEKENFERLNSLACLVRGNLPKIHRCIITALITVDVHARDIVTDMVQEKVETANNFEWQRQLRYYWDLELDNCVARMALSQYVYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKVPRFMFEGREIKLIQTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSRVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPHLREDVVLIRALRDSNLPKFLADDAMLFSGILSDLFPGVEIPNHDYGSLQSSIENALKARKLQAVPSMVHKVIQLYETMLVRHGVMLVGPTGGGKTTVYTALSDALGSLHEAGESKHNPFYQKVHTTVLNPKSISMGELYGEVNNLTLEWRDGLMALSVRVAVADDSEDHKWIVCDGPVDALWIENLNTVLDDNKMLCLANSERIKLTPQIHMIFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWMNGIIDKFGEDTGQYIMALFENYVEDGLRFVNKKCTQAMPQVDISKVTTLSCLLESLLLGKGGP-DLKMEHSRLTSIVCQTFVFCYLWAVGGNLVEN-CWDQFDTFVKHQFEENHDAKLPSSGDLWSYYMDYDSKRLDPWERIVPNFRYNKEVPFFEMLVPTTDTMRFGYLMEKLLAVKHSVLFTGTTGVGKSVVARGLLDKIQEEAQYVPLYINFSAQTSSTRTQEIIESKLEKKRKNIIGAPGKKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDAREDRGAMQPFCAPPGGGRNPVTPRFIRHFSMLCLPSPSEHSLKQIFQAILTGFL-VDFPVAVKQVATNIVEAAVEMYGRMSTELLPTPAKSHYIFNLRDLSKCMQGILQCDSGTVRDQNQIFRLFCHECQRVFHDRLINNEDKDYFNTMLAEMASKQFGVQVEAEYFVKHPILFGDFMKVGVQRADRVYEDLTDVEKLKGVLQDYLDDYNLSSAKEMKLVFFQDAIEHVTRITRMIRQERGNALLVGVGGTGKQSLTRLACHMCGYRCFQIELSRGYSYDTFHEDLRKLYTIAGVEDKDTVFLFTDTQIVIEEFLEDINNILNSGEVPNLFEKDELEKVLAATRPKAKEAGIPEGNRDEVLQFFINRVRARLHIVLCMSPVGDAFRARCRMFPSIVNCCTIDWFVQWPREALLSVSKTFFTPVDLGSDELKENLSEMCVEIHMSVTELAEHYYAELRRRYYTTPTSYLELINLYLSMLGEKRSQLTNSRDRIKNGLTKLLETNELVDKLQLELSALEPVLKQKSEDVEALMEKLATDQENADQVRRVV-MEDEAVAKVKAEETQAMAADAQRDLDEALPALQAANRALDSLDRSDISEVRVFTNPPEGVRTVMEA-ICIVLS-----KKPDWASAKQ-LLGDSN-FLKRLTDYDKENISEDVIQKLKVYINNKDFVPEKVERVSKACKSMCMWVRAMDLYSRVLKDVGPKRQRLATAQAELDATMAMLNDKQRRLKQVEDQIGALQDQFDMSVAEKESLAKNMALTQARMSRAGKLTSALGDEQIRWQESVAQFQVEINNVIGNVFIASACVAYYGAFTSHYRQMLIDR-WISRCQELG--IPINANFSLIGILGDPFEIRQWNTDGLPRDTVSTENGILVTRGRRWPLMIDPQDQANRWIRNKEMKNGLKIIKLTDGNFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRLLIRLGDSDVDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRNELIVRINADKNQLKVIEDRILKLLFTSEGNILDNEELIKTLQESKVTSGAIKTRLKEAEATEEMINTAREKYRPVAARGSVMYFVIASLSEIDPMYQYSLKYFKQLFNMTIETSEKRSDLAERLELLLKQTLLATYTNISRGLFEQHKLIFSFMLCIEILRQHGHVSDAEWNLFLRGAAGMDKERPTKPEIGWLAESTWNLCCDLEDHLPCFKGLKREIVAIPILVTLGRLEIRLNPEAWEGCMKEPLHFTE-EVSENE-IQGHWNERLSKFQKLVLVKSFMEEKVVFAMTDFVIENLGKAFIENPPVDLATLYQDMSASTPLVFVLSTGSDPMGAFQRFAREMGYS---ERVHAISLGQGQGPIAEKLIEEAVKSGDWVFLQNCHLAASWMLAMEEIIKALSEPNAVIHPNYRLFLSSMPTRN-----FPVTVLQNSVKVTNEPPKGLRANIRRAFTEITPAFFEKNVLGQNWRKIIFGICFFHAIIQERKKFGPLGWNIHYEFNDSDRECALLNL-NLFCQDGRIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPKTLEPGYLYSTSGIYYASEEKTLQDHKDYIENLPLNDDPEIFGMHENANLAFQRQETGTLVKTILEVQPR-SSGQGA-GTSNDEIVKELADSILAKLPEILDMEGAMESLFTRDEKGRINSLTTVLEQEVDRFNTLLQVIRSSLHTLKKAIAGFVVMSEEMEKIYNSFLNSQVPVLWSDNAYPSLKPLGGWVKDLALRTTFIDAWIKTGP-PKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELGFHYKTLPVYRDQTSVAEAMRTQQFGQELEADIQLPAVQDGVLVHGLFMDASRWDDEDMVMEDALAAQMNPPLPVLHFEPCQ-NYQPDPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVFIPSKRDSDYW 4098          
BLAST of DNAHb-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005687.1 (pep scaffold:Pmarinus_7.0:GL479956:584:30186:1 gene:ENSPMAG00000005143.1 transcript:ENSPMAT00000005687.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1743.01 bits (4513), Expect = 0.000e+0
Identity = 853/1161 (73.47%), Postives = 997/1161 (85.87%), Query Frame = 1
Query: 5395 KIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDR--CYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXX-XXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKD-GLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSR-AGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSI-GDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSH-WYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKL-GSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPL-LYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRL 8850
            +++NSQ+F WL QLRHRW D  K C+ NICDAQF Y++EYLGNTPRLVITPLTDR  CYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKS G+IYKGLAQ+G+WGCFDEFNRISVEV   V   QVKCIQDAI++K+KRF+F GEEI+L  ++GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGF++AR+LARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAG+LKRSDPDRPEDQVLMRALRDFN+PKIVTDD PVFMGLIGDLFPALDVPRKRDPEFE+ V+++ LDLKLQAE+NFVLKVVQL+EL AVRHSVFV+G AGTGKS V ++L +TY   +++P+  DLNPKAVTNDELFGIINP+TREWKD GLFS IMRDLAN++ DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPL PTMRLLFEISHL+TATPATVSR AGILYIN  DLGW P V+SW+  RE+QSE+ANL+ILFDKY+P+CL+ L+ RFKKI PI E S VQMLCHLLE LL P N P D PKE YELYFVF A+WAFG  MFQDQLVD+R EF+KWWVTEFKTIK P+QGTVFDYYID E+KKFE WTK + KFE+D E PLQA +V T ET R R+ +DLL+E+RRPVMLVGGAGTGK+VL+ DKL+++ GD Y V NVPFN+YTTS MLQ VLEKPLEKKAGRNYGP G+++L+YF+DDMNMPEVD Y TVQPHTLIRQH+DY+H  +  ++  +K   N +     +     FTI+ RLQRHFCVFALSFPG E+L +IYS+IL + L GS+F A+L KTV  LV LAL  H K++S FLPTA+KFHY+FNLRDLSNIFQGILF+ P+CIK P DL++L++HE  RVY DK++++ D + + ++Q +  K+ ++++DE +   + + ++CHFA G+GEPKY+P    E L++IL EAL++YNE NA M+LVLFEDA+AH  RINRILESPRG ALLVGVGGSGKQSL+RLAAFISS++VFQITL+KGYGI DLK DLA LY+KAGVKN+  + L+TDAQ+ADEKFLVLVNDLLASGEI DLFPDDE+EN+I S+RNEVK+ G++D+RE CW FFI++VR  L++
Sbjct:    1 QVENSQAFVWLSQLRHRWDDERKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRQRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGSIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQQVKCIQDAIRDKKKRFNFQGEEINLVPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRSDPDRPEDQVLMRALRDFNVPKIVTDDLPVFMGLIGDLFPALDVPRKRDPEFERAVKESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGGAGTGKSQVLRSLYRTYQLARRRPVWADLNPKAVTNDELFGIINPATREWKDAGLFSTIMRDLANISHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLLFEISHLRTATPATVSRAAGILYINQADLGWNPPVSSWVDGREVQSERANLSILFDKYLPMCLDTLRTRFKKIIPIPEQSMVQMLCHLLECLLTPTNAPPDSPKELYELYFVFAAVWAFGGAMFQDQLVDYRTEFSKWWVTEFKTIKFPSQGTVFDYYIDPESKKFEQWTKLIPKFELDPEIPLQACMVHTMETMRVRFLMDLLMERRRPVMLVGGAGTGKSVLVGDKLSALDGDAYAVKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGTRRLVYFVDDMNMPEVDAYGTVQPHTLIRQHLDYNHCLFHPSRREIKS--NRRVKKTQSRDRHFFTINSRLQRHFCVFALSFPGSEALSSIYSSILGQHLRGSSFPAALQKTVPALVGLALALHQKVSSAFLPTAVKFHYIFNLRDLSNIFQGILFSTPECIKVPQDLMKLYLHESNRVYRDKMLEEKDFQNFDKIQVDTVKRFYDDIDETLAQAQQMNVFCHFASGVGEPKYLPAASWEYLNRILVEALDNYNETNAVMSLVLFEDAMAHSCRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSIEVFQITLKKGYGIPDLKADLANLYIKAGVKNLSTLLLMTDAQVADEKFLVLVNDLLASGEIPDLFPDDEVENVIGSVRNEVKAAGLLDTRETCWRFFIDRVRRNLKV 1159          
BLAST of DNAHb-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005694.1 (pep scaffold:Pmarinus_7.0:GL479956:584:24919:1 gene:ENSPMAG00000005143.1 transcript:ENSPMAT00000005694.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1448.34 bits (3748), Expect = 0.000e+0
Identity = 712/946 (75.26%), Postives = 816/946 (86.26%), Query Frame = 1
Query: 5395 KIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDR--CYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXX-XXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKD-GLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSR-AGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSI-GDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKL-GSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTK 8211
            +++NSQ+F WL QLRHRW D  K C+ NICDAQF Y++EYLGNTPRLVITPLTDR  CYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKS G+IYKGLAQ+G+WGCFDEFNRISVEV   V   QVKCIQDAI++K+KRF+F GEEI+L  ++GIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGF++AR+LARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAG+LKRSDPDRPEDQVLMRALRDFN+PKIVTDD PVFMGLIGDLFPALDVPRKRDPEFE+ V+++ LDLKLQAE+NFVLKVVQL+EL AVRHSVFV+G AGTGKS V ++L +TY   +++P+  DLNPKAVTNDELFGIINP+TREWKD GLFS IMRDLAN++ DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPL PTMRLLFEISHL+TATPATVSR AGILYIN  DLGW P V+SW+  RE+QSE+ANL+ILFDKY+P+CL+ L+ RFKKI PI E S VQMLCHLLE LL P N P D PKE YELYFVF A+WAFG  MFQDQLVD+R EF+KWWVTEFKTIK P+QGTVFDYYID E+KKFE WTK + KFE+D E PLQA +V T ET R R+ +DLL+E+RRPVMLVGGAGTGK+VL+ DKL+++ GD Y V NVPFN+YTTS MLQ VLEKPLEKKAGRNYGP G+++L+YF+DDMNMPEVD Y TVQPHTLIRQH+DY+HW ++ K  L  +  TQ     +     FTI+ RLQRHFCVFALSFPG E+L +IYS+IL + L GS+F A+L KTV  LV LAL  H K++S FLPTA+KFHY+FNLRDLSNIFQGILF+ P+CIK P DL++L++HE  RVY DK++++ D + + ++Q +  K
Sbjct:    1 QVENSQAFVWLSQLRHRWDDERKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRQRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGSIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQQVKCIQDAIRDKKKRFNFQGEEINLVPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRSDPDRPEDQVLMRALRDFNVPKIVTDDLPVFMGLIGDLFPALDVPRKRDPEFERAVKESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGGAGTGKSQVLRSLYRTYQLARRRPVWADLNPKAVTNDELFGIINPATREWKDAGLFSTIMRDLANISHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLLFEISHLRTATPATVSRAAGILYINQADLGWNPPVSSWVDGREVQSERANLSILFDKYLPMCLDTLRTRFKKIIPIPEQSMVQMLCHLLECLLTPTNAPPDSPKELYELYFVFAAVWAFGGAMFQDQLVDYRTEFSKWWVTEFKTIKFPSQGTVFDYYIDPESKKFEQWTKLIPKFELDPEIPLQACMVHTMETMRVRFLMDLLMERRRPVMLVGGAGTGKSVLVGDKLSALDGDAYAVKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGTRRLVYFVDDMNMPEVDAYGTVQPHTLIRQHLDYNHWNNKKKFYLDRVKKTQ-----SRDRHFFTINSRLQRHFCVFALSFPGSEALSSIYSSILGQHLRGSSFPAALQKTVPALVGLALALHQKVSSAFLPTAVKFHYIFNLRDLSNIFQGILFSTPECIKVPQDLMKLYLHESNRVYRDKMLEEKDFQNFDKIQVDTVK 941          
BLAST of DNAHb-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009595.1 (pep scaffold:Pmarinus_7.0:GL478108:144315:184457:1 gene:ENSPMAG00000008659.1 transcript:ENSPMAT00000009595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1394.02 bits (3607), Expect = 0.000e+0
Identity = 825/2312 (35.68%), Postives = 1317/2312 (56.96%), Query Frame = 1
Query: 6670 KWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQ---SEQANLTILFDKYVPVCLEAL---------KLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLV--DHRVEFTKWWVTEFKTIKLPAQG--------TVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSI-GDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEV-DKYFTVQPHTLIRQHIDYSHWYDRAK-LTLKEIHNTQYLACMNPTAGSFT-ISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGI--GEPK-YMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQ-EVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTR-HGADLKVV-RLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTI-KKGRA-IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTS---PIDFLSNNSWGGIKALSAL--EEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNK-TSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYL-----EANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDG------ELNIVPGFKVPPNTDYKGYHNYID-ECLP-AESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTK-KNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKER----GPTFVWTFNLKTKEKPSKW 13431
            ++I+ DGD+D +W+E++N+VMDDNK+LTLA+ ERI L  T  LLFE+  L+ A+PATVSR G++Y++P++L +QP+   W+++R  +    +QA L  LF+KYVP C+E +             K I P  +++ V  LC +L  +L      A+  +   E +F+     + G+ + ++     D  V+      T    +K  AQ         T+F+Y+ D E++ + PW++ +  +  D +     +LVPT +T R  + L+ ++  RRPV+LVG +GT KT    + L  +  D  ++  + F+  T+S  +QR LE  +EK+    YGP   K+L+ F+DD+NMP V D+Y T QP  L++  ++    YDR K +T K + +  Y+A M    G    + PR    F VF ++FP +ESL  IY++IL       FS  +      L    L  ++   S   PT  KFHY+FNLRDLS I+QG+    P+       +VRLW +E  RV++D+LI+ +D    +R  + L ++ F    E+ M + P+L+  +   +  GEP+ Y  ++  E    + +E LE YN     MNLVLFEDA+ H+ R++R L   RG+ALLVGVGGSGKQSLSRLAA+ +   VF+ITL +GY  + L+ DL ALY + GV+     FL TDA + +E FL L+N++L +G +  LFPDDE E +I  +R+E    G   +RE+ W +F++K  S L +VL  SP G TLR R R FP +VN T IDWF  WPE AL++V+  FL  E  ++P D++ +    +  VH +V   S+ + +  RR NY TPK++L+ +A Y+ +L++K   + G+  RLE GL KL   + Q+ +L  +LA Q+V L  K+ + + LLE+++  T+ V+ +K++A+ +  ++      ++ ++ + E  L  A PALQAA+ AL  L+K+++TE++SF TPP  V  V   C C++   G   K+ SWKAAK G+M + + FL NL+  + D I +  +K  +   K      EE+   S A AG+  +V  ++ Y E+  ++KPKRD +     +  ++  +L  IQ ++  L+++L  L  ++E A S++Q+ Q E ++  + +  A++L+ GL SEN RW  ++++ +     L GD L++ AFL Y G F+  +R  ++   W   +      IP++Q      +L DD  I+ W +EGLP D +S++N  + T+A R+PL IDPQ Q + WI+ +    +LKVV       +L  +E A+  G   L +++++ +DPV+D++L RN   ++GR  + LGDKE +Y+P FRL L TKLANP   P +  +  +IN+TVT  GLEDQLL+ +V  ERS+LE  +  L ++ +  K  LKELEDSLL  L+ + GN L +  LV  LE+ K  A E+ EK+  A+ T + I+  R+ YRPAA R ++L+F L D+ +++ MYQ+SL AF  VF+ ++ ++ P   L  R+ N+ D++T ++Y Y   GLFEK KL+F+  M+ ++    + +   ELDF L+  I    ++   P D+L    W  +  L+ +  + F +L   +E + + W ++ + +TPE+   P  + +  ++ Q L ++R  R DR+  A++D+V   +G +YV+   V      E+S P +P+ FILS G DP  D+  L ++ GFSG     + +++GQGQE  A + +      GHW++LQN HL+ +W     +K  E   + H  +R++++ +P+ S      P GIL+ ++K+  EPP G+  NL  +    + E ++ C     F+ +++ L +FHAVV ERRK+G  GWN SY FN  D  + + +L  YL     +AN ++PW  L+YL GE+MYGG   D +DR++  TY++EYL   + D         N    +++PP+     Y    + E LP A +P ++GLH NAEI + T  +  +++ + ++QP+  +G   +G+SR+E I  +  DI  +LP  F + + + ++     +P  VV  QE +R N L   + RSL EL   L GE+ ++ +++ ++ +L+   IP  W + A  +L  LA W      R ++   W  D + P+V+WL GL  P+S+LTA++Q   RKN WPLDR  L   VT  +  E++   P  G +V GLF+EGA WD ++  +  +K K L   +PV+ I  I   R  L++    PVY T  R    G   V+  +L T + PS W
Sbjct:    2 RYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNTCALLFEVGDLQYASPATVSRCGMVYVDPKNLEYQPYWQRWLNSRPAKVRLHDQAELQRLFEKYVPSCMEMIVDGVVDGRQGEPLKTIVPQTDLNMVSQLCAMLNAVL--HEEEAEEEEAVLECHFLEALYCSLGATLLEEARATFDSHVKGLSAMTTVADDLKTSAQPGELPGQCPTLFEYHFDRESQSWVPWSRLVPAYVYDAQVRFCDILVPTVDTVRTSWLLEQMVRTRRPVLLVGESGTSKTATTHNFLKGLDSDTTLLLPINFSSRTSSLDVQRSLEASVEKRTKDTYGPPVGKRLLIFMDDLNMPRVVDEYGTQQPIALLKLLLERGSLYDRGKEMTCKTLRDLGYVAAMGKAGGGRNQVDPRFLSLFTVFHVTFPSEESLHYIYASILRGHT-LMFSEEVRAACDRLTSCTLQLYHAAVSELPPTPSKFHYIFNLRDLSRIYQGLCLTTPERFTTVGHMVRLWRNECLRVFHDRLINTDDKILVERHVRRLLEEHFPHDVEVTM-RDPILFGDYRSALSPGEPRLYEDIQDYEAARALFQEILEEYNSSETPMNLVLFEDALEHVTRVHRTLRMERGHALLVGVGGSGKQSLSRLAAYAAGCQVFEITLSRGYNESSLRDDLKALYTRLGVEGKPTAFLFTDAHVVEEGFLELINNMLTAGIVPALFPDDEKEALIGQVRDEAARAGCGPARESVWHYFVSKCASNLHIVLAMSPDGDTLRTRCRNFPGLVNNTCIDWFLPWPEQALLAVAQSFLAGENPMIPGDHRGAVVSHVVSVHCSVGDFSVQFQRKLRRSNYVTPKNYLDYLATYTRLLEEKDLYILGQCQRLEGGLDKLAEASVQLAELNERLAEQKVVLAAKSLACDALLEEISRSTETVNEKKQLAEEKAREIEDQNRVIAVEKGEAEEALTAALPALQAARRALQELDKSDVTEIRSFATPPKQVQTV---CECILLMRGH--KEVSWKAAK-GMMSESN-FLRNLMEMDCDAIGQGQVKLIRGILKSLGTTYEEMVPISRAGAGMLKFVEAVMGYCEVAREIKPKRDKVARLERDFYQSKRELERIQAELATLQEELAALGSKYEAAMSERQQLQAENEVMERRLLAADKLISGLGSENARWTSELQELRQRRVRLLGDCLLSAAFLCYSGAFSWEFRSAMLSDAWEKEVRERE--IPLSQPFRVESLLTDDVEISRWGSEGLPPDELSVQNGILTTHASRFPLCIDPQQQALNWIRRKEQKNNLKVVSSFNDPDFLKQLEMAIKYGFPFLFQDVDDYIDPVIDNVLERNIKGQQGRQYVVLGDKEVDYDPSFRLYLNTKLANPRLSPSIFGKAMVINYTVTLKGLEDQLLSVIVAFERSELEEQRERLIQETSHNKRLLKELEDSLLRELATSTGNMLDNAELVLTLEDTKAKATEVAEKLALAEKTALDIDRLRDGYRPAAKRGALLFFSLADMAQVSGMYQYSLSAFLGVFDLSLRKSLPDTVLPKRLVNITDTLTHNIYNYGCTGLFEKHKLLFSLNMAIRLEQAEERVPQSELDFFLKGNISLEKSARARPFDWLPEQGWQDVVQLAEVSPDAFASLPDHVERNGQAWGQWFDLDTPEQAPLPDGYAHSLSAFQHLLVLRCFRVDRVYRAISDYVASTMGERYVQPPVVNLEGVLEQSSPTSPVVFILSAGSDPAGDLAKLAERTGFSG--SRLKMLAMGQGQEKAALQLLGHAVSRGHWLMLQNCHLLPRW-LKELEKALEGISKPHPDFRLWLTTDPTPS-----FPIGILQRSLKVVTEPPNGLKLNLRATYFRVSHEALDSCPHP-AFRPLVYTLAFFHAVVQERRKYGKLGWNVSYDFNESDFQVCMEILCTYLSKAHEQANGRIPWASLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFLFDSFQVFHFFCNSETDYRLPPDGPKDAYIVTAEVESLPLANTPEVFGLHSNAEIGYYTQAARDMWRHLVDLQPQ--TGETGSGVSRDEFISGVARDIQARLPLPFELGQTRKRLGA-VLSPTAVVLLQEMQRFNALLQRMARSLAELQKALAGEVGMSGELDEVARALFNGTIPAIWRRLAPDTLKSLANWMVHFHQRHQQYSAWVEDGE-PTVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTTFRGPEEVTERPGQGCFVSGLFLEGADWDVEASCLVRSKPKVLMVQLPVLKIIPIESHRLKLQSTLRTPVYTTSTRRNAMGVGLVFEADLFTTKHPSHW 2287          
BLAST of DNAHb-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1163.29 bits (3008), Expect = 0.000e+0
Identity = 788/2420 (32.56%), Postives = 1264/2420 (52.23%), Query Frame = 1
Query: 3025 FDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFS------------CLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDM-NESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASE--ELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDF-KALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNC----DLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFE--FPAQVALSSSQIAWG--TEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFL-GEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVL--LVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQG---TVFDYYIDTETKKFEPWTKRMTKFEM--DLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSI-GDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLT-LKEIHNTQYLACM-NPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGS--NFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELT-----KKAFEEMDEMVMFKKPLLYCHFAQGIGEPK--------------YMPVERSEDLSKILKEALESYNEV--NAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTG--MIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQE--VELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLM--ATNGKVPKDR------SWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASE 10074
            F  +S+LW+   EE + +F+                          PT+ +F  Q+  Y +  ++++ +     +     +     K A +   + W   F   L    + S  E+  F +     L +     D E +   M  L  ++  +   +    P+++   +L  Y+    D    +++ L   W N    +V V+ T+  LQ    A++    A F     +F+  +    P                C   ++DL RK    SG E+          LF + V ++ +L++ R+EL LL+ L+   N V  S++ + + LW D+++E+++ +   F    R L K ++ W A+  ++ +I N   +   +  + N A+  RHW ++   T   FD+ ++   L+++++  L  F+D++  I   A KE  ++  LK + S WS   F        G  LLK S+  E +  +E+  + L ++M+++Y   F   +  W + LS   ++I+ W  VQ  W +LE++F+G D I KQLP++++RF  ID  + K +    E    VV   G   L + L  +  +L +C+K+L  YLE KRL FPRF+FVS   LL+IL   + P  +  HL  LFD++ ++ F ++    N +  +++ +++GE V             G VETWL  LL  +R+T+  V+ ++ + +E+ +     F+  FPAQV L + Q+ W   +EV L+ A+ +     A    N+K +  LN LI +   +L+K +R K  T+ TI VH +D+   L+   I ++  F WL Q R  + +    C I I D  F Y +EYLG T RLVITPLTDRCYITL+Q+L ++M GAPAGPAGTGKTETTKD+G+ LG  V VFNCS+QMDY+ +G IYKGLAQSG+WGCFDEFNRI + VLSV A Q+  +    KNKR +F F  G+ + +D   GIF+TMNPGYAGR ELPENLK  FR  AM+VPD  +I  + L + GF   +IL+RKF TLY+LC+E LSKQ HYD+GLR I SVL   GA+KRS+P+ PE  V+MR LRD N+ K+V +D P+FM LI DLFP + + +   PE E+ +   T    L     +VLK++QL E   VRH +  LG +G GK+     L+K  ++  +    + +NPKA+T  ++FG ++ +T +W DG+FS + R           WI+LDG +D +WIE+LN+V+DDNK LTLA+ +RIP+ P  +++FE  ++  A+PATVSR G+++++   L W+P V +W+  + + +EQA   +L+     V  + +   F  + P ++I     +   +E+L  L+PE           +   VF  +W+ G+ +     ++ R     +       + LP      ++F+Y +  ++  +E W  R+ +F    D      A+LVP  +  R  + +  ++++ + V+L+G  GT KTV+++  +N    + ++  ++ F+  TT  M QR +E  ++K+ G  YGP   +K+  FIDD+NMP ++++     + ++RQ ++ + +Y+  K      I + Q++A M +P  G   I  RL+R FC+F  + P   S+  I+ T           F   + +    LV              LPT  KFHY+FNLRDLS I+QG+L    +  +    L+ L+ HE  RV  D+     D + +     ++        A   M+  V F        F +   EP               Y P+     L++ L+  L  YNE    A M+LV F DA+ H+++I+RI+ +PRG ALLVGVGGSGKQSL+RLA+FI+    FQITL + Y +++L  DL  LY K G +  GV F+ TD +I DE FL  +N++LASGE+ +LF  DE++ I   +   +K        + EN + +F+++VR+ L +VLCFSPVG   R RA KFPA+++  ++DWF  WP DAL +V+  FL E  VE  PE  K      M+     V +  + Y +  RR  Y TPKS+L  I  Y ++  +K + +     R+  GL KL+   + V  L  +L  +E EL   +  A+E+L +V +  +   S K+     ++K   I  E++  +   E+ L  A+PAL+ A+ AL T+   ++  ++    PP  ++ +    + L     +  VP+        SW  A+   +     FL++L+ ++KD I E  +     Y +  ++N E  ++     AGLCSW   ++T++ I  +V P +  L      L  A  +L   Q ++ + + +L  +Q  ++ A  +KQ   D+A+   + +  A  L+ GL  E
Sbjct: 1111 FSCFSSLWSQEPEEMVKEFMTTD-----------------------PTMSEFNAQMVYYAQLEQQVQDLPAHFAVGPVLAM-TEPLKLALVQECRTWKRAFGAALNRKASASTDEVLAFSEAMAKHLARPIC--DLEDVRAAMAALAELRAAEIQMESAIGPVEEAFAMLAKYDLTFRDSSADRVDGLAYCWKNLMTQSVQVQNTLVILQPTMKADLLTGVAEFHKDLSSFQLDYDTQGPGEAGIAPQEASDRLQMCQMQFDDLWRKFTTYSGGEE----------LFGLPVTDYPELQRIRRELALLQKLYGLYNTVIESVDGYYEILWSDLDIEKINNELLDFQNKCRKLPKALKEWQAFEDLKKKIDNFNETCPLLEMMANKAMMSRHWERITNVTGHTFDIESDHFALKNIMEAPLLTFKDDIEDICISATKERDIDAKLKAVVSEWSSQCFTFAPFKSRGELLLKGSDTAEKVALMEDSLMVLASLMSNRYNVPFKPTIQQWVQKLSNTTEIIENWMMVQNLWIYLEAVFVGGD-IAKQLPQEAKRFQNIDKSWQKIMQRAHEIPGIVVCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDPHTIQAHLLGLFDNVNQVGFHEK----NYEQILSIESQEGESVTLVEPVMAQRGWQGNVETWLGSLLTGVRSTVHAVIRQAAAIIEDGAFKLHEFQTSFPAQVGLLA-QMIWTRDSEVALNNAKNDRKIMPAT---NQKFLDLLNELIDMTTRDLTKRERVKYETLITIHVHQKDIFDDLVRMNIKSTADFEWLKQSRFYFVEETDKCLIQITDVDFHYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKRTQFVFTDGDIVEMDREFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPEEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPELEEAILAQTKAAGLVHHPPWVLKIIQLYETQRVRHGMMALGPSGAGKTCCIHMLMKAMTDCGEPHREMRMNPKAITAPQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWILLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPIVQAWL--QGLPTEQAQ--VLWSTMDSVFQDLINFVFTAVNPKMDILECMYIKQAIELLKGLLPEADERRLEHSHLQRLLVFSLMWSVGALL----ELEDRARMEAFLRAHPSHLDLPGSANDDSIFEYVVG-DSGGWEHWNTRVPEFAYPRDTVPEYSAILVPNVDNVRTDFLMQCIMKQEKAVLLIGEQGTAKTVMIKGYMNKYDAELHLTKSLNFSSATTPNMFQRTVESYVDKRMGTTYGPPAGRKMTIFIDDINMPIINEWGDQITNEIVRQLMENNGFYNLEKPGEFTTIVDVQFVAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNASIDKIFRTFAEGHFCPERGFPEEVNQLAVALVPTTRRLWQATKVKMLPTPAKFHYIFNLRDLSRIWQGMLIMNSEVCRSSDMLLALFGHECVRVIADRFTAQQDKDWFNGTMSKIMLDDHGTAAAASMEAEVYF------VDFMRDAPEPTGEEPDDADLEAPKVYEPIPSFPQLAERLQAFLVQYNESVRGANMDLVFFADAMVHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYSSFQITLSRTYNMSNLMEDLKQLYRKTGQQGKGVTFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEITQELIPVLKKEHPRRPPTNENLYDYFLSRVRANLHVVLCFSPVGEKFRARALKFPALISGCTMDWFQSWPRDALTAVAGHFLAEYRVECTPE-VKRGVVDAMAVFQDMVAERCVEYFERFRRQTYVTPKSYLSFIGGYKSIYSEKLSNVALLSERMRTGLSKLQEAEKSVSQLSRELEVKEKELAVASRRADEVLCEVTSKAQAAESVKQQVQKVKDKAQAIVDEIAADKAVAEKKLEAAKPALEEAEAALQTIKPADIGTVRKLSKPPHLIMRIMDCVLLLFRRRVDTVVPEPERPCMRPSWSEAQK--LMNFAGFLNSLLTFSKDTINEEMVDLLMPYMEMEDYNLETARNVCGNVAGLCSWTKAMVTFFGINKEVLPLKANLIIQESRLAVAQGELDRAQAQLDEKQRELDAVQAMYDTAVREKQILVDDAEACRRKMNNATALIDGLGGE 3467          

HSP 2 Score: 125.561 bits (314), Expect = 2.856e-28
Identity = 153/723 (21.16%), Postives = 316/723 (43.71%), Query Frame = 1
Query:  292 SKACFFTKKAKESISRDAAFNKVLIFGDISYTP---LDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKG-KTLLPLPVGSEKVSEGDINSFGEVPRSIIYAIETVVIE--------WAHQIDDVLSKQSSEQLMA-GLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYL--DPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIF----GGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLR 2403
            +  C+F  +  E     A   + + FG +       L    SF+  +++P L   K+QE+W  + S +            +  +    G +  +   V   +   G I     +P   +    T ++E        W  QI+ VL +  SEQ+     N  P  EL YWK R+     + E+L S +V+K+  LL+   S     +K +   +     E+++   YL  L      + +     ++  I+ L   + ++    + Y   E +  L  +++N +I  C +YL     +I+  + +  L+++   +++  +++  F     + K++ +    P +++F+ N IFG+ +SF  R+  +  +L        L+ V I GI           +F  ++ +      +TYD LD  +++F  DY +F +  + L + L T V   F D    + + +L+  F    GG       +L+  ++Y  ++     +M+  +  Y       ++ P I +N+P V+G++ W +++  +I  P+   ++      +T+E  + V+ ++++  +L + E+ Y+  W   VD   +  LS  LL+R        VNFD  +  +L E K+L  L   ++P++  ++  K   ++ +   L   ++ Y     +   + QPL+   +  +++ +   +T + W S  +D     YIE+++  V  L+
Sbjct:  113 AGTCYFFLRTTEKAISTANMAQEINFGVLECPEGDILQGVESFLSSLMIPAL---KSQETWGVIKSGENDPAVEVFLDSVNYFMQSLSGVRQNIQQKVQLMEADLGTITYLCCIPHCPVTVGNTEMVERLEAALRVWMKQIEQVLVE--SEQIRKEADNVGPSAELVYWKKRTSRFNSLLEELKSERVQKVTGLLQAARSRSLKHWKELDSRITEEASEAKDNVKYLYSLEKFFGPLAKYSPVSIKSGIEGLMSNIRMVHTISRYYNSSEHMTSLFVKVTNQMIATCKAYLHQGGGKIWDHDWDNLLQRMSECIRLNEEYQHCFH----ETKQHLRQSNNPRQFEFSENYIFGKFDSFCMRLRKLSDMLQTMQSLAGLQHVRIEGID---------KIFLRYQALATNTKAKTYDVLDHRKSEFDIDYKEFCSQTEGLYQSLQTFVDSWFGDALKTEKMLELLGKFERIAGG-------RLQLMEKYQLVLHRYARDMDMVRRTY----QKQKQNPPIPRNIPPVSGKIMWARQLFRKIDIPMKFLNN-KRDVLQTSEGKITVRNYNKMAAVLLEFELLYHRAWSRAVDLVRNSLLSS-LLVRYPKKKEFFVNFDLAIFELLMEAKHLHKLG-FQVPEAVINLCQKEQQIKHHHTRLLEALQEYTQAVSSIPPILQPLMTPCVALVEDAILPGLTIISWTSLNIDT----YIEEIQAAVVQLK 799          
BLAST of DNAHb-1 vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 387.497 bits (994), Expect = 1.043e-107
Identity = 297/1047 (28.37%), Postives = 536/1047 (51.19%), Query Frame = 1
Query: 3799 ISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSL-RAVNELQNPAIRDRHWAQL---MAATKVKFDMNEST--TLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGG--QVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIF-EFPAQVALSSSQIAWGTEVYLSFARLEEGYE-NALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWL-CQLRHRWADTDKD---CYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPE----DQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAV-DLNPKAVTNDELFGIINPSTREWKDGLFSVIMR----DLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYIN 6870
            I+ L+K M  +  +A +  + V    QL    +E++   ++W  I  +   ++   +T W  ++V  +  D  +F +    L + ++ ++ Y  +  Q+ NM+TS+ + + EL++ A++ RHW  +   +   +++ ++ +    +L+D++ LNL   E  +  I+E+A KE  +EK L  +   W + ++E  +HS +G+ L++  + L +  +ED  +L +M  S Y   F  +    +  L+   ++   W EVQ  W  L  I   + DI+  LP ++ +F  + +++K + T   +    ++    P     L++    L + + +L+ +LE +R  FPRFYF+ + DLL I+ +G   + V K + K+F S+  + FL++           + + +GE++      +L    Q + WLN L  E++ ++ T   + +  +++ +  + +  ++  Q  L S+Q+ W TE+      +E+  + N    + K+   ++  L+  L  + S + ++K+  +    +H  +V+ +L            W   Q  ++  DT  D    +I+      +Y  EY+G   RL+ TPL    + TLT SLH    G   GPAGTGKTET K  G+ LG +V VFNC +  DY+ +  +  G+ Q G+WGCFDEFNR+  +VLS V+  ++ IQ+ ++  +     L EE  L     +FIT+NPGY GR+ELPENLK  FR  +M  P    I E++L   GF  ++ LA K +   +L     S  +HY +GLR +K      G L+   P   E    ++ ++ +L+   +P +   D  VF   +  +F +   P        + ++ A         E F+ K +Q   +   + ++ ++G AG GK+  WKT+I   +        V  ++ K +T + L+G +  +T EW+DGLF+ I+R    D+     +   W+V D D+DP ++E++N+V+DDNK+LTL + ER+P+ P  R+LFE  +L   TPAT++R G+L+ +
Sbjct: 1194 ITKLKKKMHSVAAAAKMLLIPVVLNDQLTHVVEEVKTYDLVWRSIKNLWEDVQRTFETPWCRVDVLLLQSDLANFLRRADELPRAVKQFEMYKSLFSQV-NMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWKEAQYEVIEHS-SGLKLVREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLEDFI-------TGVRSVEGEVLNLNEKIELKDSIQAQEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVVVSKYIFQAILLSAQVMW-TEL------VEKCLQTNQFSKYWKEVDMKIKGLLDKL-NKSSDNVKKKIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLK------GVLRNCSPLISEFGEGEKTVVESLKRVILPSLGDTDELVFKDELSKIFDSAGTPLNSKA-IVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFS 2216          

HSP 2 Score: 336.265 bits (861), Expect = 3.647e-92
Identity = 310/1352 (22.93%), Postives = 626/1352 (46.30%), Query Frame = 1
Query: 7354 VLVPTSETTRF-RYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKP---LEKKAGRNYGP-SGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAK---LTLKEIHNTQYLACMNPT-AGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSE--KLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFA---GPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTG-MIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKD----STAKFMSF------VHKAVNKVSISYLQN-----ERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKV-----ATDTKKVSSE--KRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLK--AAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDP--LKMLVDDAIIASWNNEGLPSDRMSIENATILTNAE-RWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGR--AIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKA-IDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQM 11274
            +++PT +T +  + F DLL   +R ++L G  G+GKT+++ + L +    Y V  + F+  TT+E +   L +    +    G    P S  K L+ F D++N+P++DKY +      +RQ ++   ++   +   +T++ IH     AC  PT  G   +S R  RH  +  L +P  +SL  IY        KL   F +            +++ +N+  + +  T ++ HY+F+ R+L+ + +G+  A   GP   +    L+RLW +E  R++ D+L+   +  ++++L  E   K     D                G+    +  V ++ DL   ++E  +++ +    + +V+ E  V HILRI+R L+  +G+ +L+G   +GK  L+R  A+++ L + Q  + +   ++D  + L        +K      ++ ++ I +  FL  +N LLA+ +I DLF  +E + +++++RN+ +S G ++D+ +  + +F+ ++   L +V       +         PA+ N   I+W  +W    +  V++     V+++P ++ D       K + F      +  AV  + I + +N     +   N  +P  F++ +     ++  K+ +LQ     +  GL+KL  +  +V++L   L+ +  EL +K   A   L+K+      ++ K+ ++E  K+I  V+EE + K K  V K  QD E       P +  AQ  +  + K  LTE++S   PP  V  V  A   ++          +W+  +  I  + D F+ N+++Y+     +P ++    +E+  DPNF  E I   S A   L  WV   I + ++  +V P R  ++    E  +    L   +   + LE  ++  + ++     D +  + E       ++ +  LV  L  E  RW    +Q+    + L G+ +++  + +Y G   +  R  +     L  L  L     +  +++   +  LV       W   GL  +   +EN +I+ N++   P ++DP    I  I   +G    ++   ++G++  +E A+  G VV+I++  E  DP++  L+ R     G    +++GD E + + +F+L + +   +      ++++  +++F   ++ +E ++    + +E ++++  + DL K   ++K+ LK LE  LL  L+ ++GN L +  L+  L N K+ A+ IE+K+ +++      +   E Y      +  ++ +L    + +  Y  S+  F   F++  I ++  +   + RV+ ++  +   VY   S  L +K K+I    M
Sbjct: 2390 IVIPTIDTIKHEKIFYDLL-NSKRGIILCGPPGSGKTMIMNNALRN-SSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPENKWVTIERIHIVG--ACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEIYYKAIFKLVPEFRS----YTEPFARASVHLYNECKARY-STGLQSHYLFSPRELTRLVRGVYTAINTGPR--QTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQD----LGNISSTSLLFSGLLSLDFKEVNKT-DLVNFIEERFKTFCDEELEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNM---VDVIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKRKEVVMKSIQDIE-------PTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQFS-----NWRDIQQFI--RKDDFIHNIVHYDTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADM-----LVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTVLLSFLEEGFVKRLENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTALDKKFKMIMAMTM 3702          

HSP 3 Score: 67.781 bits (164), Expect = 4.985e-11
Identity = 65/253 (25.69%), Postives = 114/253 (45.06%), Query Frame = 1
Query: 11731 KDVETLGKKLGFSGDNK-NFRNISLGQGQEI-VAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXR--VFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANS--KVPWEDLRYLFGEIMYGGHITDDWD----RKLCKTYLEEYLQPEMLDGELNIVPGFKVP 12459
            +DV+   K +  +  +K + + I LG  + +  A++ +     EG W++LQNI +   W+     K  E  + + E  +  +F++   +G      +P  +L+   +   E   G+L  + K L      T ++    + + T  F L +FHA+++ R +  P G+++ Y FN  D   +   L N L  NS   +PW  +R     I+YGG I ++ D     KLC                L IVPG ++P
Sbjct: 3792 RDVDGTFKLIELAKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDK----LPAPLLQRTDRFVYEDIPGILDTV-KDLWGSQFFTGKISGVWSVYCT--FLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVVAKLCAHVF-------CGSDNLQIVPGVRIP 4030          
BLAST of DNAHb-1 vs. Ensembl Nematostella
Match: EDO47920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK0])

HSP 1 Score: 5929.36 bits (15381), Expect = 0.000e+0
Identity = 2965/4472 (66.30%), Postives = 3606/4472 (80.64%), Query Frame = 1
Query:   73 LELNDKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKACFFTKKAKE-SISRDAAFNKVLIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEG-DINSFGEV-PRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYD--IHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPL-TLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQE---EIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQ--IEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQV-KLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLG-SNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLK-----LDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            +E +D R + I DYVLK++K K+DK+ KL   +E +Q++LDFFEK +   L V+       L    EFPTN K+K+ ++ KK K  +I +D  F   L +GD+S +PL+Q S  V+E+++P+LSN +N E WP+V+S DV+RH + LK    V+ GQ KGKTLLPLPVGSE+VSE  +    GE   RS++++IE+V+I+W+HQI  VL + S++ L+ G NP P VELD+WK R+ NLECI+EQL  PKV++MA LLE   S+Y P FK IFK VVAAL E+++I L+L PLR QLE++EQ +FSE+  ++  + HV  L+WA+ K Y    RI+VL QE+ N+II    +YLDP EIFK E EEA EKV+++++    F+++FE +R+ + ++F +G E   W+FAS ++F RL+ F+ R+ +V+ +    +EF KLEKVEI+GIKG+ LS  +V++FEEF  +F  F+  TYD L+    +F+ D+++F+  + DLDRRLA+ V QAF DC   ++  KL+D  G LLDRP++  +F+ +Y  L++M ++E++  K++YD  +  +  E    I+KNMP V G L+W  E++ERI  P+  L   L+H   +T E  ++  K+DE+ +LL  H+ K Y +W  GV      NL +PL++R+ +T  I VNFD KL +VLREVKYL++   E    IP+SAT I ++N+T  K+  NLDL V WYN +R+  L VE PL+E++L  ID QLE+A  +L WNSD    G W+YIE+ RD+VH+L  RV  +K+NI+ +  +M+ W ++PLFERKE K + LLNL++RE   NKRY  IT++GE++H L+K N EL +AD+ ++ W+ YVD+IDDM+++ F   I+ SL Y+++   ++ + + LFE  ++L   ++VF PSLD      F +LV+ +V+DI+K AS VKRLA  +  E Y  D+E+  +L + R ++ +R      KA  Y++ FD YS LW D+R EFM QFL Y   ++AEE+EAH E+ +    E PPTL+QFK QID YEK + E+++++G NI D WFR+D R FKQA LN IKRWS MFKQHLIDHVTNSL +LA FIK+ + GL +   EGD+ GLV +MGHL  VK+RQ ATDEMFEPLKQTI+LLKTY QEMP+EVH QL+ELPE+WNN+KK+AVTVKQ VAPLQ  EVA IRRKC  FD+KQH FRE FRK  PF F+  + Y+ LD+ + EI  +E+ M  L+ESA LFEV  P++KQL+ CR+E+ LLK LWD I VV +SIE WK T W +I+VE M+ +CK F K IRSLDKEMR+WD +TG++  +KNM+TSLRAV ELQNPAIR+RHW QLM ATKVKF M++ TTL DLL LNLHNFEDEVR IV+KA KE+ MEKVLKEL  TWSQMEFEHE+H RT I LLK+SEELIETLE++QV +LQN+MTSKYI HF +EV SWQK LSTAD VI IWFEVQRTWSHLESIFIGS+DIR QLPEDS+RFD ID DFK L  E  +  NVV+   +P L+E+LE +Q  L LCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGN P  V +HL+KLFD++A+LKF ++     TK  V MY+K+GE VEF + CD  GQVE WLNR+++ MR T+R   SESV S EEK R+QW+F+FPAQVAL  +QI W TEV ++F RLEEGYENA+KD+ KKQ++QL+ LI +LIG+LSK DRQK+MTICTIDVH RDVV KLI QK+D++Q+F WL QLRHRW D    C+ NICDAQF+Y++EYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKS GNIYKGL+Q+G+WGCFDEFNRISVEVLSV+AVQVK IQDAI++K++RF F GE+I L   +G+FITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFL+AR LARKFITLY LCKELLSKQDHYDWGLRAIKSVLVVAG+LKRSD  RPEDQVLMRALRDFNIPKIVTDD PVFMGLIGDLFPALDVPRKRDP+FE  V+++  DLKLQ E++F+LK+VQL+EL AVRHSVFVLG AGTGK+ V ++L KTY N K+KP+  DLNPKAVT DELFG INP+TREWKDGLFS IMRDL+N+ SD PKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNER+PLTP+MRLLFEI HLKTATPATVSRAGIL++N  D+GW P+V+SWI TRE+QSE+ANL ILFDKYVPVCL+ L++RFKKITPI +I+ V  LC+LLE LL P NTP DC KE YELYFVF A+WAFG  MFQDQLVD+R EF+KWWVTEFKTIK P+ GTVFDYYID+ETKKF PWT ++ KFE+D E PLQAVLV T+ETTR R+F+DLL+E RRPVMLVGGAGTGKTVL+ D   S+  D  +V NVPFN+YTTS MLQ+VLEKPLEKKAGRNYGP G+KKLIYFIDDMNMP VD Y TVQPHTLIRQH+DYSHW+DR KLTLK+I NTQY+ACMNPTAGSFTI+PRLQRHF VFA+SFPG ++LK IY +IL+  +   NF++++ K    + D AL  + K+ STFLPTAIKFHYVFNLRDLSNIFQGILFA  +CIK P D  RLWMHE  RVY DKLIDD D+E + ++Q ++TKK FEE+DE  M+ KP ++ HF+ GIGEPKY+ V   E LSK+L EALE+YNEVNA MNLVLFEDA+ H+ RINRILESPRG ALLVGVGGSGKQSL+RLAAFIS+L+VFQITLRKGYGI D+KLDLA L  KAG+KNIG VFLLTDAQ+ +E FLVL+NDLLASGEI  L+PDDE+ENIIS +RNEVK  G+ D+RENCW FFI +VR  L++VLCFSPVG+TLRVR+RKFPAV NCT+IDWFHEWP++AL+SVS RF++++E L  +YK   A+FMS+VH +VN+ S  YL NERRYNYTTPKSFLEQI LY N+LKKK  EL  K  RLENGL KL+STAQQVDDLKAKLA+QEVEL+QKN  A++L++KV  +T+KVS EK IAD EE+KV  I  +VS+KQ+ CE DLAKAEPAL AAQEALNTLNK NLTE+KSFG+PP AV++V +A M L+A   K+PKDRSWKAAK  +MGK+DAFLD LINY+K+NI E +LKA + Y  +P F P+ IK KSLAA G+C+WVINI+ +Y IFCDV+PKR ALEAAN EL  A EKLS I+ KI++L++ L +L   FE+A S+K +CQ EA+ T KTIELANRLVGGLASENVRWG+ V+ +K +EKTLPGDVL+T AF+SY GCFT+ YR  L++  WL FLA+  P IPIT+ LDPL +L D+A IA+WNNE LP+DRMS ENATILTN ERWPL+IDPQLQG+KWIKTR G DL++VRLGQKGYLD IE+AVS G+ VLIEN+ E++DPVLD L+GRNTIKKGRAIK+GDKE EY+ +FR+IL TKLANPHYKPEMQAQTT+INFTVTR+GLEDQLLA VV+KER DLE  K       LT+QQN F I LKELEDSLL RLSAA GNFLGDYALVENLE  KRTA EIE +V +AK TE+ IN+ RE YRPAAARAS+LYFILNDLNKINPMYQFSLKAF VVF+KAI+RAEP+EE+K RV NLID IT+SV++YT+RGLFEKDK+IFTAQ++FQ+LL  KEI P ELDFLLRFP V N+TSP+DFLSN SWGGIKALS +EEF+NLDRDIEGSAKRWKKF ESE PEKEKFPQEWKNKT+LQ+LCMMRALRPDRMTYAV++FV+EKLGHKYVE     F+ SFEESGPATPIFFILSPGVDPLKDVE  GKK+GF+ D KNF N+SLGQGQEIVAE+ +DL AKEGHWV+LQN+HLV  WL  LEKKLE ++E S+  YRV+ISAEP+G+P++HIIPQGILE +IKITNEPPTGM+ANLHK+LNNFNQ+T+EMCA+ENEFK+ILF+LCYFHAVV+ERRKFGPQGWNRSYPFNTGDL ISV+VLYNYLEAN+KVPW DLRYLFGEIMYGGHITDDWDR+LCKTYLEEY++PEML+GELN+ PGF +PPN+D+KGYH YIDE LP ESPYLYGLHPNAEI FLT+ SD LF+T+ EMQPRD+ G      +REE++KQ+LDDI EKLP++FN+ E+ A+V  E+R PY VVAFQECERMNMLT+E++ SLK+LDLGLKGELTIT++ME LSN+L++D +PESW++RAYPS++GLA W+ DLLLRIKELE WT+DF LP+V+WL G FNPQSFLTAI Q MARKNEWPLD+MALQ DVTKKNKED   PPR+GAYVHGLFMEGARWDTQ+GMIA++KLK+L P+MPV+FI+AIPVD+QD +NVY CPVYKT++RGPT+VW F LKT+E PSKW
Sbjct:    1 MEFSDVRFDHISDYVLKTMKLKADKWAKLQGNEEYRQIILDFFEKHDHNSL-VITLSSAAQLVPSYEFPTNTKNKSVYYIKKEKGLNIGKDN-FKNALSYGDLSASPLEQLSVLVEEILVPLLSNPRNHEQWPAVVSQDVMRHVHQLKSNVYVIAGQVKGKTLLPLPVGSEQVSEACEAEERGETFDRSLVHSIESVIIDWSHQIQTVLKRSSAQPLLEGTNPGPLVELDFWKARAANLECIFEQLHDPKVRRMAELLEKTQSSYFPAFKKIFKDVVAALDEARDITLHLKPLRRQLEDMEQYDFSELHKILPAILHVCGLLWANSKFYCSAPRIIVLLQELCNMIIEMARTYLDPAEIFKSEIEEAYEKVKKAIENCMLFRDTFEENRKTISKFFAEGTEVKPWEFASEIVFTRLDKFVERLRVVEDVFATAMEFGKLEKVEIAGIKGKMLSHQVVEIFEEFNELFAVFSNSTYDALEATNKEFVDDFNQFRERVADLDRRLASIVCQAFDDCASTESALKLLDCLGSLLDRPLIHADFEHKYPILLRMFEKELDQAKVIYDQQMECAQAEGAAPINKNMPNVAGSLKWSSELKERITKPMQALKLSLNHGTLETAEAMIIFNKYDEMNKLLDSHDEKIYQSWTEGVGNIAQQNLDKPLIVRDPNTKLIKVNFDPKLVSVLREVKYLEVASNETLEAIPESATAIFARNETFHKFCANLDLTVAWYNKVRETLLDVEFPLVESQLVAIDTQLEQAEKSLNWNSD----GVWEYIEKTRDMVHDLEKRVQAAKDNIEAMNQLMTKWSEAPLFERKEAKKEGLLNLEERETITNKRYAMITQSGEKIHKLLKNNLELFQADADTDMWRAYVDSIDDMVLDGFFNCIHCSLNYLLEHTDLKHNANALFEAKLELHQPDMVFIPSLDFGVTAGFYDLVEGIVSDIYKMASLVKRLAEHNESEHYEADVEDMLDLSEMRQDLMDRVNGIMNKANEYRSSFDSYSYLWLDDRNEFMRQFLLYNHVLTAEEIEAHTEEGVP---ESPPTLEQFKDQIDTYEKLYTEVDEVDGTNIFDTWFRVDARPFKQALLNIIKRWSYMFKQHLIDHVTNSLNDLAGFIKVADVGLTQTVEEGDYNGLVAVMGHLMAVKDRQSATDEMFEPLKQTIELLKTYGQEMPEEVHTQLQELPEQWNNSKKIAVTVKQQVAPLQASEVAIIRRKCGQFDIKQHEFREDFRKTAPFAFNSEDVYDRLDKSNREICAMEEEMNALSESAGLFEVNFPDYKQLRACRREVILLKQLWDMIFVVLTSIEEWKFTPWAEIDVENMEMECKRFVKEIRSLDKEMRAWDGFTGLDSTVKNMVTSLRAVGELQNPAIRERHWQQLMQATKVKFVMDDDTTLADLLALNLHNFEDEVRGIVDKATKELGMEKVLKELDVTWSQMEFEHEEHVRTHIPLLKSSEELIETLEDNQVVQLQNLMTSKYIGHFLEEVTSWQKKLSTADSVITIWFEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDVDFKELTNEGAKIPNVVECCNRPGLFEKLENLQERLSLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNQPVEVARHLSKLFDNMARLKFKEDDAGNVTKDAVGMYSKEGEYVEFDSVCDCDGQVEIWLNRVMDRMRATVRKEQSESVVSYEEKPREQWLFDFPAQVALCGTQIWWTTEVGIAFGRLEEGYENAIKDYYKKQVSQLSTLINMLIGDLSKGDRQKIMTICTIDVHARDVVAKLIQQKVDSAQAFLWLSQLRHRWDDQQSHCFANICDAQFKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLSQTGAWGCFDEFNRISVEVLSVIAVQVKSIQDAIRDKKERFIFQGEDICLVPTVGLFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLEARALARKFITLYSLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRSDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRDPDFEALVKKSVTDLKLQPEDSFILKIVQLEELLAVRHSVFVLGPAGTGKTQVIRSLNKTYMNQKRKPMMFDLNPKAVTADELFGFINPATREWKDGLFSTIMRDLSNIASDSPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERVPLTPSMRLLFEIGHLKTATPATVSRAGILFLNFADVGWNPYVSSWIDTREVQSEKANLQILFDKYVPVCLDLLRVRFKKITPIPDITMVTTLCYLLECLLTPANTPPDCNKELYELYFVFAAVWAFGGAMFQDQLVDYRTEFSKWWVTEFKTIKFPSAGTVFDYYIDSETKKFVPWTDKVQKFELDPEVPLQAVLVHTAETTRVRFFMDLLMENRRPVMLVGGAGTGKTVLVNDYFQSLDPDVSMVGNVPFNYYTTSAMLQQVLEKPLEKKAGRNYGPPGNKKLIYFIDDMNMPMVDTYGTVQPHTLIRQHLDYSHWFDRTKLTLKDIRNTQYIACMNPTAGSFTINPRLQRHFAVFAISFPGLDALKTIYLSILNGHMKVHNFASAVSKFTEKVTDAALAMNQKVTSTFLPTAIKFHYVFNLRDLSNIFQGILFATHECIKTPVDFARLWMHECNRVYRDKLIDDKDMEVFDKIQIDMTKKFFEELDEEAMYAKPNMFSHFSSGIGEPKYLAVPDWEVLSKLLTEALENYNEVNAVMNLVLFEDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLAAFISALEVFQITLRKGYGIPDMKLDLANLCTKAGLKNIGTVFLLTDAQVPEENFLVLINDLLASGEIPGLYPDDEVENIISGVRNEVKGAGLQDTRENCWMFFIERVRRNLKVVLCFSPVGATLRVRSRKFPAVTNCTAIDWFHEWPQEALVSVSRRFIEDLEQLEAEYKPPVAEFMSYVHTSVNEESQMYLANERRYNYTTPKSFLEQINLYRNLLKKKSKELTQKTERLENGLLKLQSTAQQVDDLKAKLASQEVELKQKNEDADKLIQKVGVETEKVSKEKAIADDEEKKVQVIAKDVSEKQRSCEEDLAKAEPALLAAQEALNTLNKGNLTELKSFGSPPGAVVNVCSAVMVLLAPANKIPKDRSWKAAKI-MMGKVDAFLDQLINYDKENIHESNLKAVQPYLDNPEFEPDFIKGKSLAAGGICAWVINIVQFYYIFCDVEPKRKALEAANAELAAAEEKLSKIKAKIQELDENLAELTANFERATSEKLKCQQEAESTAKTIELANRLVGGLASENVRWGESVKSFKEQEKTLPGDVLLTTAFVSYHGCFTRRYRDNLLNDKWLVFLASQNPKIPITEGLDPLSLLTDNATIATWNNENLPADRMSTENATILTNCERWPLMIDPQLQGVKWIKTREGNDLRIVRLGQKGYLDTIERAVSNGECVLIENMGENVDPVLDALIGRNTIKKGRAIKMGDKEVEYHADFRMILHTKLANPHYKPEMQAQTTLINFTVTREGLEDQLLADVVSKERPDLEETKASDRIFPLTQQQNAFTIKLKELEDSLLARLSAAGGNFLGDYALVENLEITKRTAAEIEVQVTEAKQTEIKINDAREAYRPAAARASLLYFILNDLNKINPMYQFSLKAFSVVFQKAIERAEPAEEVKARVVNLIDCITYSVFIYTTRGLFEKDKIIFTAQVAFQVLLMKKEIIPHELDFLLRFPAVMNVTSPVDFLSNLSWGGIKALSNMEEFRNLDRDIEGSAKRWKKFAESECPEKEKFPQEWKNKTALQKLCMMRALRPDRMTYAVSNFVEEKLGHKYVEDAPTPFAMSFEESGPATPIFFILSPGVDPLKDVEAHGKKIGFTFDAKNFHNVSLGQGQEIVAEQCLDLAAKEGHWVILQNVHLVKNWLPKLEKKLEAFSEGSNPDYRVYISAEPAGTPDAHIIPQGILETSIKITNEPPTGMMANLHKALNNFNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVDVLYNYLEANAKVPWTDLRYLFGEIMYGGHITDDWDRRLCKTYLEEYMKPEMLEGELNLAPGFPLPPNSDFKGYHLYIDETLPPESPYLYGLHPNAEIGFLTTTSDNLFRTLLEMQPRDAGGGEGASQTREEKVKQVLDDIFEKLPEEFNVPEMMARV--EDRTPYTVVAFQECERMNMLTNEMKTSLKQLDLGLKGELTITSEMEDLSNALFLDDVPESWTRRAYPSMFGLAAWFVDLLLRIKELEQWTSDFCLPNVVWLSGFFNPQSFLTAIEQSMARKNEWPLDKMALQVDVTKKNKEDFNSPPREGAYVHGLFMEGARWDTQTGMIADSKLKDLTPAMPVMFIRAIPVDKQDTKNVYECPVYKTRQRGPTYVWNFFLKTRENPSKW 4460          
BLAST of DNAHb-1 vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 2155.56 bits (5584), Expect = 0.000e+0
Identity = 1432/4439 (32.26%), Postives = 2354/4439 (53.03%), Query Frame = 1
Query:  439 SNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQ-VEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHK----FKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXY----YNNWLTGVDETCSFNLSQPLLIRNMDTMFIS-----VNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDRE-------------DRCNKRYKEITEAGERVHGLVKENS--ELLKADSVSEHWKQYV-DNIDDMIVENFQETINYSLQYMIDQIEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSME---------------DYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSC-LEHYEDLDRK-HIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMN-ESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEF---EHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMR-TXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGP-KWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEAL---------KLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQ------DQLVDHRVEFTKWWVTEFKTI---KLP-AQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAK-LTLKEIHNTQYLACMN-PTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGE-PK-YMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWI-KTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKK-GRA-IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTS---PIDFLSNNSWGGIKALSAL--EEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTS-LQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYL-----EANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDG------ELNIVPGFKVPPNTDYK------GYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTK-KNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKER----GPTFVWTFNLKTKEKPSKW 13431
            S A  +     ++  + + +        +  + Q +G   L +P   + V   DI    + P  I+  +E  +  W   I   L  Q  +         P  E+D+W+ R+  L  I EQL  P VKK+  +L  V+S     F++    +     E+++   +L+ L    + +     F+ +   I  + + L ++W   + Y   ER+V L + I+  +       ++ + I K       +K   +   L  +KES+   R K++   +D      W+F    +F R +   S  E ++ +     EF  +   E+  + G    + I D+ +    + K      +D   P     L  +      F   ++ ++      +  +F      +  F ++  F  +  R  +  +  K++            ND LV      G E       N P V G + W + +  RIK  +     L  Q  +    N   K+  +    + +   +Y    Y  W   V+      L + LL +   +   +     V+F  +L  ++ E KYL+ L  + +P+ A ++  + +   KY++ L LM+E Y+ +  +    E  L+++ + ++   L+     L WNS  + +    Y+ +    +    S V + ++N   I   +   + + LF+    K + ++  D +E             +   ++Y+ I     ++ GLV   +     K       W+  V + +  M+  N Q   N  LQ        SK PLF++   L   EIV  P      A+   +LV   V D+ +      R   G+ +E                + TD+  +  + +    +S+  +        Y  ++  Y  LW  ++                          +  F  + PT   +  ++  Y     E+        ++ + R++            + W     + L +   ++L  L   I+   + L +  A    E L  ++  + ++++     +     +K+    LK Y  E+ D     +  + + W++    +  V  ++  ++ +     + + + F      F+E F    P +    L+   +L +K   E +  EK  +EL  +  LF +++  + +L+Q  KEL+ L+ ++        + + W  TLW +++V  +      + K ++ L +E+++      +E+++K    S+   ++L+N A+R+RHW +LM  T +KFD+N E+ TL+++  + LHNF D +  I   A KE+ +EK + E+  TW+ M+F   ++ K ++    +L   +E+++ L+++ + LQ+M  S+++  F + V  W+K+LS   +V+++W  VQR W +LESIFIG D IR QLPE++ +FD ID  FK ++ +  +   V++A   P   ++L+ + + L  C+K+L +YL++KR AFPRF+F+S  +LL IL + + P  V +H+ K+FD++A L+F + + +E   +  AM + +GE ++F       G+VE W+  +L+EMR T R        +   + +R +W+ ++   VAL+ +Q+ W  EV   F ++++G +  +K++ +K   Q++ L+  +   LSK+DR+K  T+  I+VH RD++   +   I +S+ F W  QLR  W     +  I  C  +F Y +EY+G   RLVITPLTDR Y+T+TQ+L + + GAPAGPAGTGKTETTKDL +ALG++  V NC E MD+KSIG I+ GLAQ G+WGCFDEFNRI V VLSVV+ Q+K +Q+++ +  KR  F G EI+LD+ +GIFITMNPGYAGRTELPE++KALFRP   +VPD + ICEIML +EGFL A++LA+K   LY+L    LSKQ HYD+GLRA+K+VLV+AG LKR  P+  ED VLMRALRD N+PK V +D P+F+GLI DLFP LD PR R P F   V  +  D K     +   KVVQ+ E    RH+  ++G  G GK++V  TL    + L        +N KA T  EL+G ++P TR+W DGL S I R++   T     K+IV DGD+D +W+E++N+VMDDNK+LTLA+ ERI L     LLFE++ L+ A+PATVSR G++Y++P++LG++P+   W + R    E+  L  LF+KYVP  ++ +           + K I P+  ++ V+ L H+L+ LL P  +      +  E  F+   IW+ G+ + +      DQL+  R+        E   +   +LP AQ T+++YY D++   + PW   + ++  + +     +LVPT +T R  + L L++   RPV+LVG  GT KT    + L  +  D  ++ N+ F+  TTS  +Q  LE  +EK+    YGP   K+L+ F+DDMNMP+VD+Y T QP  L++  ++    YDR K L  K + +  ++A M  P  G   + PR    F VF ++FP +ESL+ IYS+IL+  L   F  ++   V ++    L  +  I     PT  KFHY+FNLRDLS ++QG+    PD    P+  VR+W +E  RV+ D+L ++ D ET       L  + F E  ++ M + P L+  +   + E P+ Y  V   +    I +E LE YN  +A MNLVLF+DA+ H+ RI+R++   +G+ALLVGVGGSGKQSL++LAAF +   VF+ITL +GY  N  + DL  LY   G++N  +VFL TDA +A E FL L+N++L SG +  L+PDDE E II  +R+E    G+  +RE+ W +F+NK  + L +VL  SPVG  LR R R FP + +                            +P+ Y+++    + FVH+ V   S S+LQ  RR NYTTPK++L+ I+ Y+ +L+ K   +  +  RLE GL KL + ++Q+ +L  KLA Q++ + +K+ +  +LL ++   T++ + +K +A  +++++++    +  ++ + E  LA A PAL+ A+ AL  L+K+++TE++SF  PP AV  VS    C++A  G   K+ SWK+AKA  M     FL +L   + D I    +K  ++  K+ N   EE+K  S A AGL  +VI ++ Y  +  ++KPKR+ +         +  +L  I+ ++K LE++L++L  +++ A  +K   Q+EA++  + +  A++L+ GL SE +RW K ++  K +   L GD L+  AFLSY+G FT  +R  ++   W   +      IP+++      +L +D  ++ W +EGLP D +SIEN  + T A R+PL IDPQ Q + WI K     +LKVV      +L  +E A+  G  +L ++++E +DPV+D++L +N   + GR  + LGDKE +Y+P FRL L TKL+NP Y P   ++  ++N+TVT  GLEDQLL+ +V  ER +LE  +  L ++ ++ K  LK+LED+LL  L+ ++GN L +  LV+ LE+ K  A+E+ EK++    T + I++ R+ YRPAA   ++L+F+L++++ +N MYQ+SL ++  VF+ ++ ++ P   L  R++N++D++T +VY Y   GLFE+ KL+F+ QM+ +I+    ++   ELDF L+  I    +S   P  ++ +  W  +  L  +  E F +L  DIE + K W+++ + + PE   FP +++   S  QRL ++R  R DR+  A+  FV  ++G KYV    + F    E+S P +P+ FILSPG DP  D+  L ++ GF G+   F  +++GQGQE +A + ++     G W++LQN HL+ KW     +K+ E   + H  +R++++ +P  +PE    P GIL+ ++K+  EPP G+  NL  + +  + + +  C  ++ F  ++F L +FHAVV ERRK+G  GWN +Y FN  D  + + +L  YL       + K+PW  L+YL GE+MYGG + DD+DR++ KTY++EY+   + D         N    + +P N + K       Y +YI+E   A +P ++GLHPNAEI + T+ +  ++  + E+QP+ +  +G  GISREE I +I  DI  KLP  F++  ++  +   E  P  VV  QE +R N+L   +  SL  L   L GE+ ++++++ +S SL+  +IP  W K A  +L  L  W      R+ +   W  D + P+VIWL GL  P S+LTA++Q   RK+ WPLDR  L   VTK  N +++      G +V GL++EGA WD     +   K K L   +PV+ +  I   R  L+N +  PVY T +R    G   V+  +L T E  S W
Sbjct:    6 SQATEESRSKVILRDEFLMNIQKFSSNINRTIHQLEGDIRLEMP---DLVLGDDITELSKDP-EIVNTLEETLHNWEVTISSALEMQLKKTPQGS---GPLAEIDFWRERNATLSAIAEQLKLPTVKKIVAVLTKVNSENLANFEYHRAELNKYYTEAKDNVRFLSTLERHFKNLAHGASFNIVLETIPSMMNALRMVWIISRHYNRDERMVPLMERIAWELSERVAKTVNIRTILKEPPYVVKQKTSEARDTLRTWKESYFDVRAKIESSGRDA----RWEFDRKRLFERTDYMASICEDLQEVAQVMEEFYNIFGPELKAVTGD--PKRIEDVLKRVHELVKPIENVAFD---PFSLRHLASWRNVMDWFHREVNAIENEAKHFIDNSFKSLRSAEGAFDMLLNFRHIRSREAINSQMMKKF------------NDILVQ----FGKE-------NQPPVAGAISWERSLFYRIKRTI-----LRFQEMEDMLNNEHGKQASKKYLSVARLMKEYEDKKYEAWREQVEANLLIYLKKNLLTKPSTSSATTHRSYVVDFAPELAEIITETKYLEQLGFQ-VPELARNVALQEEKYLKYVDGLKLMLERYHTVTGSLDVAETQLLDDNIKELKRVLKPGSKRLNWNSLGISD----YVTRCGQAIGKFESLVNQIQKNAKDIYSRLEMIEITELFKTPPPKTNGIMP-DAKEYFDFLEKGRSQELEVLARKYRAIGPLLTKMEGLVAHTNTGRAPKLQPYYAFWENAVYEALTKMVTRNLQ-VFNTKLQ--------SKLPLFQIETALSAPEIVLSPP-----ANEIYKLVMQSVRDMVEGTKLFVRWMNGTCIETPPQHAEGEDEPVVFSFFTDISASPAIIELVTTVSKSVQNTLGTLNKYLNRWKRYRLLWKLDKSNM-----------------------VMKFAAKNPTCIAYDEKLQFYSNLVLEVGTQPMSRDVE-FVRLNLDPLATTIQANARAWVKELGKMLNESAKDNLMTLKGEIETLCTDLKR--APDTLEDLKFVLRVIADIRDMSLDVELRTADIKERYRTLKMYEIEVSDNETELVNGIDQLWDDLFVESRRVDYSLVSVKMKFTEITQDQVSNFTSDISKFKESFINEGPSSIGTDLDAGVELLKKFQEEYNTFEKERQELTNAERLFGLSITMYPELQQMEKELKGLEQVFGIYEKQKEARDEWANTLWANLDVSVLSDGIDGYIKQLKRLPREVKALPLCHVLEEKMKEFKNSIPLFSDLKNEALRERHWKKLMDMTGMKFDLNPETFTLQNMFAMELHNFSDVIADITASATKELGIEKGIAEVSDTWNAMKFTVAKYMKGTQERGFVLGTVDEILQILDDNAMNLQSMSASRFVGPFLETVNKWEKSLSHIGEVVEVWMVVQRKWMYLESIFIGGD-IRAQLPEEARKFDDIDKTFKKIMADTAKNPKVLEACHAPNRLDQLQFIVNGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGS-HDPTCVQEHMIKMFDNIASLRFQEGSNKET--LATAMISSEGESMDFRQAVPAEGRVEDWMTSVLKEMRRTNRLITKEAIYNYCNQITRIEWMMQYQGMVALAGNQVWWTWEVEDVFRKVKKGDKMGMKNYARKCHRQIDDLVVKVRSNLSKNDRKKFNTVLIIEVHARDIIDSFVRDSIMDSREFEWESQLRFYWDQAPDELMIRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTITQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDFKSIGKIFSGLAQCGAWGCFDEFNRIDVSVLSVVSTQIKTLQNSLSSGLKRLQFEGTEIALDARMGIFITMNPGYAGRTELPESVKALFRPVVCIVPDLQQICEIMLFSEGFLYAKVLAKKMTVLYKLASGQLSKQSHYDFGLRALKAVLVMAGELKRGSPELSEDVVLMRALRDMNLPKFVFEDVPLFLGLIADLFPGLDCPRVRYPNFNDAVESSLTDNKYILLPHQADKVVQMYETMLTRHTTMIVGPTGGGKTVVINTLAMAQTRLGMHTKLYVMNAKACTVIELYGTLDPVTRDWTDGLLSNIFREINKPTDKNERKYIVFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCALLFEVADLRYASPATVSRCGMVYVDPKNLGYRPYWQKWCNARSNAKEREELDRLFEKYVPASVDLILEGILDGKQGKKLKTIIPLTNLNMVEQLSHMLDALLPPAESSNFLGPDVTEAIFISSLIWSTGAGLLEDGRIVYDQLI-KRLAGIPANPAEGTVVGPGELPSAQPTLYEYYFDSKKLLWVPWLDVVPEYVHNPDLKYNEILVPTVDTVRTTWLLQLMVNIHRPVLLVGETGTSKTATTANYLRGMDQDTTLLLNINFSSRTTSINVQHNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPQVDEYGTQQPIALLKLLLEKGGMYDRGKELIWKNVRDIGFVAAMGKPGGGRNEVDPRFISLFSVFNVTFPSEESLRRIYSSILTGHL-QPFPKNIQDLVEHITTSTLELYTNIIRDLPPTPSKFHYIFNLRDLSRVYQGLCLTTPDRFDSPAKFVRVWRNECMRVFCDRLTNEADRETVSGYISSLVDQNFSEHTDIAM-RDPCLFGDYRNTLTEDPRLYEDVVDYDATKAIFEEILEEYNMDHAPMNLVLFDDALEHLTRIHRVIRMDQGHALLVGVGGSGKQSLTKLAAFSAGCGVFEITLTRGYDENSFREDLKELYNSLGLENKKMVFLFTDAHVAQEGFLELINNMLTSGMVPALYPDDEKEGIIGQVRDEANKAGVPPARESIWQYFVNKCANNLHIVLAMSPVGDILRTRCRNFPGLNDK---------------------------IPDQYRETVVDHVVFVHQTVGTYSQSFLQKLRRVNYTTPKNYLDFISTYNRLLEIKDKYVLEQCHRLEGGLGKLLAASEQLAELNEKLAVQKIAVTEKSEACEKLLVEIQRATQQANEKKEMAIGKKKEIAEQNKVIVVEKTEAEEALAAALPALEEAKLALQDLDKSDVTEIRSFAKPPRAVQMVSE---CIVALRGY--KEISWKSAKA--MMSEGNFLKSLTEMDVDGITTGQVKKCRDMLKEMNTTVEEMKEVSKAGAGLFKFVIAVMGYCSVAREIKPKREKVARLERNFHLSKRELEKIEKELKALEEELERLGKQYDDAMREKSSLQEEAEIMERRLIAADKLISGLGSEKIRWTKDLQDLKDQRVRLLGDCLLGAAFLSYLGAFTWDFRRDMLRKQWENDVIQRE--IPLSKPFKVDVLLTNDVEVSKWTSEGLPPDDLSIENGILTTQASRYPLCIDPQQQALNWIKKKEEKNNLKVVTFNDHDFLKQLELAIKYGFPILFKDVDEYIDPVIDNVLDKNIKGEPGREFVVLGDKEVDYDPSFRLYLNTKLSNPKYTPAHFSRCMVVNYTVTMKGLEDQLLSVIVGVERKELEEQRERLIQETSENKRLLKDLEDTLLRELATSQGNMLDNVELVQTLEDTKTKAVEVSEKLKLGAKTAIDIDKLRDGYRPAAKLGAVLFFVLSEMSVVNSMYQYSLNSYLEVFDLSLRKSLPDTILSKRLKNIMDTLTMNVYNYACTGLFERHKLLFSFQMTIKIMEADGKLKQEELDFFLKGNIALEKSSRQKPYSWMPDQGWEDVIRLCQVTPEVFGSLADDIERNEKGWREWSDLDAPESHPFPGKYEESLSDFQRLLLLRCFRVDRVYLAITHFVTGRMGEKYVTPPVLSFESILEQSTPFSPVIFILSPGSDPASDLMKLAERSGFGGNKLKF--LAMGQGQEKLALQLLETAISRGQWLMLQNCHLLVKW-LRTLEKVLERISKPHPDFRLWLTTDP--TPE---FPIGILQRSLKVVTEPPNGLKLNLRSTYHKISNQMLADCPHQS-FSPLVFVLGFFHAVVQERRKYGKIGWNIAYDFNESDFRVCMTLLNTYLTKSLQNTDVKIPWASLKYLIGEVMYGGRVIDDFDRRVVKTYMDEYMGDFIFDTFQPFHFYNNEEVDYCIPKNGENKYDPGRDVYVDYIEELPLANTPDVFGLHPNAEIGYYTNAAKDMWLHLVELQPQTAGDSG--GISREEFITKIASDIQGKLPPLFDVDRVRKNL--SEITPTAVVLLQELDRFNVLIRRMSTSLINLQRALAGEVGMSSELDEVSRSLFNGMIPNIWRKLAPATLKSLGNWMEHFQKRLDQYNKWVNDGE-PAVIWLSGLHIPDSYLTALVQATCRKHGWPLDRSTLYTTVTKYHNADEVTERAHSGCFVSGLYLEGASWDLAESCLRRPKPKVLVEELPVLKVIPIESHRLKLQNTFRTPVYTTSQRRNAMGVGLVFEADLATTEHTSHW 4297          
BLAST of DNAHb-1 vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 2038.08 bits (5279), Expect = 0.000e+0
Identity = 1294/3811 (33.95%), Postives = 2058/3811 (54.00%), Query Frame = 1
Query: 1336 IVKWILNATLEFNKLEKVEIS------GIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAF---KTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTM-FISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDN----GAWQYIEQVRDLVHNLR-SRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADS--VSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSK----DPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLA-----IGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAE----GDFEGLVEMMGH-LGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFS--CLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMR--SWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFD-MNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXX--XXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEE-GYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKP-------LAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWY----ELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRM-TKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGS-FTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFE-EMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNA--AMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDC-------ERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHG-ADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRA--IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPID-----FLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTS-LQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWX-XXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDG---ELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLH 12540
            I++ +    + F ++   E S      G++G  + +N++++   F+   +         LD   T +  D+++F+A + DL+  +   ++ AF      +   +++DIF  L  R  ++   DK+  E+ ++ +EE+   K  +      N K   +    PK  G   W + ++ RI   + + S    +AF   +    + +  ++ +L + L +   K +N W   VD+ C   L  PL+ R+ +    + +NFD  L  +  E+ Y + L   E P   ++++ K + LR    N+ L+V  YN +       E+ L    +  +D+++   +T L W S  + +           +V+ +V + + + +V SK  I    +++       +++  E + +   ++   + R    + EI        G +K   E+ K D   V  HW +Y + +D M+ E F+  + +SLQ +   I G      +PL  V + L+G+++ F P+L +      + ++D++ + +       KRL        S  E     +E +EE +K +  I           + Y + +D Y  +W   ++ F+ ++ R                         P +  F   I +Y +     +K      ID +  +DC   K A L+    W   F   L +  +  L EL  F+K     L+         GD   L+E + + L N++ +       F PL Q   +L+ Y   +P+EV   L+ L  +W   ++  +     +   + +    +      F    +   + F+   PF+ S    E  E + + H ++  L+     L     +F++     K L+   K+L  L+ +W          + WK   + ++    M+   +   K +  + +E++  +W+    ++ +I+    ++  + +L+N A+RDRHW+Q+    +  FD   +  TLE +++L L  F +++  I   A KE+S+E+ +  + S W Q+  +   +   G   LK ++E+ + LE++QV L  M  S+Y+  F  EV  W++TLS   +V+++   VQR W +LE+IF+G +DIRKQLP +S  FD ++ ++K ++  + +  N ++ T  P L E L  + ++L   +K+L  YLETKR  FPRFYF+S+ DLL+IL    +PE V  HL K FD++  LK  +     +    V MY+ +GE VEF ++  L G VE WL  +   MR T++ +L             RD+W+ E+P Q+ ++SSQ+ W ++   + +  +E G + ALK   KKQ++ LN    ++ G L+K  R K++ + TI+VH RDV++KLI    ++  +F WL QLR  W     DC +   + QF+Y +EYLGN+ RLVITPLTDRCY+TLT +LHL   G+P GPAGTGKTET KDLG+ALG  V V NCSE +D+KS+G +Y GLAQ+G+WGCFDEFNRI++EVLSVVA Q+  I  A+     RF F G EI+L  + GIFITMNPGYAGRTELP+NLK++FRP +M VPD  +I EI+L AEGF   ++LA+K  TLY L  + LSKQDHYD+GLRA+ SVL  AG  KR++PD  ++++L+ +++D N+ K+ T D P+F G++ DLFP ++ P     +    +     D   Q   N +LK++QL E    RHS  V+G  G+GKS+ W+ L    + LK+             +NPKAV+  EL+G  + +T EW DG+ S +MR   +      KWI+ D  +D +WIES+N+VMDDNKVLTL + ERI +   + LLFE+  L  A+PATVSR G++Y + +DLGWQP+V+SW+  R  +    +L  LF+K+VP  LE  K   K+  P  E++ V  LC L + L   EN       E Y    EL+F+FC IW+   C   D+  D R +   + + E +  + PA+ TV++Y++D + K +  W  ++ + +  +   P   +++PT +T R+ + +  LI+ +RPV+L G  GTGKT + Q  L  +    Y +  +  +  T+S  +Q ++E  +EK+    Y P G K++I F+DD NMP  D + +  P  LIR  IDY  WYDR K T+K + +   LA M P  G    IS RLQ  F +  ++FP +  +K I+ T++++KL  +F   +      +    +  +N I +  LPT  + HY+FNLRD+S IFQG+L A  D     + + RLW+HE  RV++D+LID+ D E++  L  +     F+     +   K+  ++ +F +   +  Y  +   + + + +++ +E YN      A+NLVLF DA+ H+ RI R++  PRG  LLVG+GGSG+QSL+RLA++I    VFQI + K Y   + + DL  LY +AGV N   VFL  D Q  +E FL  VN++L+SGE+ +L+  DE E + +++ +      + D+ E+ + FFI +VRS L +VLC SPVG   R R R +PA VNCT+IDWF EWP DAL+ V+ R+L+ +EL  E+ K + A+    VH++V  +S   L   +R+NY TP ++LE ++ Y ++L +K  EL    S+L NGL K       +DD +AK+    VELE       E  ++       +  +KR AD +++ V     +++ ++  C       + DL +A PALQ A +AL +LNK ++TE+KS+G PP  V  V  A M L  +      + +W  AK  +      F+  L+NY+KDN+ +  LK    YC  P+F PE I   SLAA  LC WV  +  Y  I+  V+PK+  L  A  +L E    L+  + K+K++ D++++L+ ++++  + K+  + +A+L    ++ A +LV GLA E  RW   V   +     L GD L+  AF+SY G F   YR  L+   WL  +  L   +    N      L     +  WN +GLPSD  S EN  ++T   RWPL+IDPQ Q +KWIK   G + LK++ L Q  YL  +E AV  G  VL++N++E +DP L  +L ++ +K G    IKLGDKE EY+P+FR  + TKL+NPHY PE+  +TTI+NF V   GLE QLL  VV +ER +LE  K  L       K  L+ELED +L  L  A+G+ L D  LV  L ++K T+ E+ E++  ++ TE+ I+  RE YRP A RAS+L+F+LND+ +I+PMYQFSL A+  +F  +I++++ S  L  R++NL +  T++VY YT RGLFE+ KL+F+ QM  +IL    ++N  E +F LR  +V +    +D     +L++ SW  +  L  L  F  +    E   + W ++  S  PE    P EW+N  + LQR+ ++R+LRPDR+++    F+   LG K+VE   ++ S   ++S   TP+ F+LSPGVDP   +  L +  G S     F  +SLGQGQ  +A + +  G K+G+WV L N HL   W+    +   +   E+ H  +R+++S+ P   PE    P  IL+  IK+T EPP G+ AN+ +      ++    C K++++K +LF LC+FH+V+ ERRKF   GWN  Y FN  D  +S N+L  YL+   + PW+ L+YL   + YGGH+TDD+DR+L  +Y+ E    + +     +L+ +P + VP +     Y   +   +  ++  L+  H
Sbjct:  213 ILRKVCEGQMHFARMYNGEQSPLPCFHGVRGPEIVRNLLEIEATFEKNIQILKAVKKTILDVKATTWHDDFNRFRAGVKDLEVMVQNLIASAFETVTTVEEGVEILDIFQHLSTREAIRRTIDKKTVEVYQLFNEELNLVKKEF------NTKTVDLPPLYPKYAGSASWARMLKRRIDKSMNVLS----KAFFLPQIGSGDEIRTQYQQLAQALDEFVRKTFNEWTATVDKDCGRLLEIPLMRRSAERAGTLDLNFDKVLLKLFNEIHYWEKL-MLETPHYVSEVYQKKEDLRILRENVLLVVRDYNRIIAVLSPEERGLFRERIRSLDKKIHPGLTKLSWASKGISDYFIGECRNNCSKVQGIVDDYKNANLVISKNCIKISEMLLVKIDSKRVYDNLEFEEEQKKHMGLVQTRLQVAHVEIV-------GTMKNTYEVFKNDGQEVQAHWLRYTEKMDRMVEEAFRLNVKWSLQELSRAINGDGKSIPNPLLRVKVVLEGDKVEFSPTLTK-----LASMMDNIASTLTTCLQIFKRLPDLLTRKKSIKEPVHLVIERDEETKKIQTSIKAGMSANASHLQSYLSTWDGYREIWEIQKDAFIRRYQRLN-----------------------PPVSSFDADIARYTEIANNFQKEETVLNID-FVLLDCSPLKFALLSHCNEWQNKFTTLLREMASQKLTELNNFLKGNAKKLSAPPETLDELGDSLSLLEQLQNDLPNIEAK-------FAPLHQQFAILEKYEVAIPEEVQGMLDALSGEWLLFQQCLIDSDVMLKKSKEKFKTGLIHSSEEFKKTVNGLFDDFQSKGPFSSSIGVKEALEQVTQYHEQVVNLKSQETSLRRGLNIFKIEQALSKDLQNLEKDLEHLEQVWTVTKEWEELWDTWKVGKFVELVTTDMETQAQLLFKRLNKIIREVKDKNWEICDSIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFTLEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKDRGHFRLKQTDEVFQQLEDNQVTLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLG-EDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFDKTEAVGMYSAEGEYVEFGHSVLLEGPVEAWLCDVERSMRWTLKELLKHCRLGLKKSLSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSKERGDKKALKSLKKKQVSMLNKFSEMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVFEGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMSDEEILLLSMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDGEPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRVDKQSVEHLQRLFEKFVPKVLEFRKHHCKEPVPTSELNSVVSLCVLFDALATEENGVRMSNGESYARMLELWFLFCLIWSV--CASVDE--DSRKKMDNF-LRELEG-QFPAKDTVYEYHVDIKQKTWASWEDKLRSGWRYNPSVPFYKIMIPTVDTVRYDFLVYNLIQAKRPVLLTGPVGTGKTSVAQKVLQKLDPKTYGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDYGFWYDRMKQTVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIFGTMINQKL-QDFEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSDKLGSMFDLTFHNLCPNKQSPIFGNFMKD--DTMYEDLVDFKAIKRYMEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDEFEEVRTALSDIAAKEDVQDTPESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLENIELGDEETKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDK-------IDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIAIEEDKCRVMAENAQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQS------EPTWAEAKRQLGD--GNFIKQLVNYDKDNMTDRILKKIGTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLG--VACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELDKLPNFHGIVTSFEQYPRDWNQWYTSSEPENTPLPGEWENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLAENCGMSN---RFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQVEDPHPDFRLWLSSSP--HPE---FPISILQVGIKMTTEPPKGLKANMKRLYQLITEQQFSRCHKQDKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLDEYEETPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINEMFNDQAIQTPYYKLSSLPTYYVPKDGPLSTYRVSVILLMYIQASPLFARH 3934          

HSP 2 Score: 96.2857 bits (238), Expect = 3.073e-19
Identity = 58/232 (25.00%), Postives = 110/232 (47.41%), Query Frame = 1
Query:  457 ESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLPVGSEKVSEGDINSFGEVPRSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGE 1152
            +SWP  I +D + H +           + +GKT+L +P  S  ++    +   E     +  +E  +I W  QI +VLS Q +       N  P  E+++W++R  +L  I EQL  P VK++   LE   S+Y  PF  + K +     ++Q+   +L+ L+   EE+ Q +  ++  M+  + H + ++W + + YR  ER+  + +++       C   +    ++ GE
Sbjct:   13 QSWPDSIKNDFLAHLHKFMANLTDTRYKMQGKTVLYVPSESTTINIEQASKNKE----FVQRLEAAMIHWTRQIKEVLSSQDT--FETAENSGPLEEIEFWRSRCADLSGISEQLDKPGVKRIQATLELSKSSYVTPFLKLSKLIQDGSSQAQSNLKFLSTLKGPCEELAQAQPKDVPAMLPRILHTIRMVWMNSEHYRSRERLTGILRKV-------CEGQMHFARMYNGE 231          
BLAST of DNAHb-1 vs. Ensembl Nematostella
Match: EDO35603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ5])

HSP 1 Score: 1841.63 bits (4769), Expect = 0.000e+0
Identity = 1192/3613 (32.99%), Postives = 1951/3613 (54.00%), Query Frame = 1
Query: 2875 ASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAK--FDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEE--IEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPF--NFSCLE----------HYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNEST-TLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKA--SEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDF-KALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRD--QWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNA----LITLLI----GELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFL-GEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQG---TVFDYYIDTETKKFEPWTKRMTK--FEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIG-DNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLT-LKEIHNTQYLACM-NPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLAL-------NFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGE-------------PK-YMPVERSEDLSKILKEALESYNEV--NAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENI----ISSMRNEVKS---TGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELL-PEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVE--EEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATN-GKVPKD-------RSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRH-GADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRA--IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTS----PIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNK-TSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYL---EANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPP-EERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNE-WPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGP-TFVWTFNLKTKEKPSKW 13431
            AS V  + I     +Y  ++ EN+E+ K  + +S  T V ++K ++  A   F++YS++W  +R+                         ISAF +  P L +F+ QI  Y K+ E+  +++   +++      +   K K +     K W + F ++        ++E+  F++     L++     D + +   M  L  ++ ++   D    P++++  +L  Y+  +  E   +++ L   W   + +A   +  +  +Q+     +  +  TF +   +F   +    P   N    E           ++ L RK+I  SG E+          LF + V E+ +L Q ++EL LL+ L+   N V  ++  +   LW+D+N+E+++Q+   F    R L + ++ W A+  ++  I +   S   +  + N A++ RHW ++   T   FD+   T +L ++++  L   ++++  +   AVKE  +E  +K + + WS  +         G  LL+   + E++  +E+  + L ++M+++Y + F   +  W + LS    +I+ W  VQ  W +LE++F+G D I KQLP++++RF  ID  + K +    E    V    G   L + L  +  +L LC+K+L  YLE KRL FPRF+FVS   LL+IL   +    +  HL  +FD++  +KF ++    +    +A+ + +GE VE        G VE WL  LL   R ++  V+ ++  ++ + S +  +++  FPAQV L   Q+ W  +         E   NA   ++KK + Q NA    L+ +LI     EL++  R K  T+ TI VH RD+   L    I     F WL Q+R  + D    C +NI D  F Y +E+LG T RLVITPLTDRCYITL Q+L ++M GAPAGPAGTGKTETTKD+G+ALG  V VFNCS+QMDY+ +G I+KGLAQSGSWGCFDEFNRI + VLSV A Q+  I    K ++K+F F  G+ + ++   GIF+TMNPGYAGR ELPENLK  FR  AM+VPD ++I  + L + GF+    L+RKF TLY+LC+E LSKQ HYD+GLR I SVL   GA KR++P   E+  +MR LRD N+ K++ +D P+F+ LI DLFP + + +   PE E+ +     ++ L     + LK++QL E   VRH + VLG +G GK+     L+K  ++       + +NPKA+T  ++FG ++ +T +W DG+FS + R           WIVLDG +D +WIE+LN+V+DDNK LTLA+ +RIP++P  +++FE  ++  A+PATVSR G++Y++   L W+P V +WI+ R I  E   L   F+K     L  L+        I++ +++     LL+ L+  ++       +  E  +VF  +W+ G+ +     +D R +   +    F  + LP       +F++ ++ +  ++  W  R+ +  +  D      ++LVP  +     Y ++ + ++ +  +L+G  GT KTV+++  ++    + ++  +  F+  +T  + QR +E  ++K+ G  YGP   KK+  F+DD+NMP ++++     + ++RQ ++   +Y+  K      I + Q+L+ M +P  G   I  RL+R F +F  + P   S+  I+S I     G  +       ++++ D AL                 LPT  KFHY+FNLRDLS I+QGIL    + I     LV LW HE +RV +D+  +  D + +++  K +      E D   M      +  F +   E             PK Y P+   + L + L   ++ YN+    A M+LV F DA+ H++R++RI+ +PRG ALLVGVGGSGKQSL+RL++FI+    FQITL + Y  ++L  DL  LY  AG    G+ F+ TD +I DE FL  +N++L+SGE+ +LF  DE++ I    I  M+ E      TG     EN + +F+ + +  L +VLCFSPVG   R R+ KFP +++  ++DWF  WP+DALI+V+  FL   +++   + K      M  +H  V      Y Q  RR  + TPKS+L  I  Y ++  +K  E+     R+  GL KL   +  V  L  +LA +E EL   +  A+++L++V+   K  ++EK  A V+  ++K   I  E++  +   E  L KA+PAL+ A+ AL T+   +++ ++    PP  ++ +    + LM      V  D        SW +    +M K D FL+NL+N++KD+I + +++    Y +  ++N E  K      AGLCSW   + T++ I  +V P +  L      L  A   L+  Q ++ + + +L + Q  +E A  +KQ   D+A+   + +  A+ L+ GL  E  RW +Q +++  +   L GDVLV   FLSY G F + +R  LM + W   + +    IP T NL+   M+VD A +  WN +GLP+D +S++N  I+T A R+PL++DPQ QG  WIK R    ++++  L  K +   +E A+S G  +LIE++ E +DP LD++L +N IK G    +K+GDKE +    F L + TKL NP Y PE+ A+T+II+FTVT  GLEDQLL  V+  E+++LE+ +  L +  +  K  +KELED+LL+RL++ +G+ + D +L+E L   K TA E+ +K+  A  TE+ IN  RE +RP A R S+LYF++ +++ +N MYQ SLK F  +F ++++R+ PS     R+ N+ID +T  V+ Y+ RGLFE  K +FT  ++F+I L  K I   E   L++     +L +       ++++ +W  +  LS L +F ++   I  + K+WK + + + PE+ + P  + N   + ++L ++R+  PDR       ++ E +G +Y E   +E  +++EES   TP+   LS G DP   +E L KK  +     + R IS+GQGQE+ A K ++   + G W +LQN HL  ++           +E  HE +R++++ E     E    P G+L+ +IK TNEPP G+ A L ++ N  +Q+ +++ +   +++ +L+++ + H+ V ERRK+GP GWN  Y FN  D   SV  + N+L   +    V W  +RY+ GE+ YGG +TDD+D++L  T+ + +    M     N   G+ +P  T  + +  +ID     +SP ++GLHPNA+I + ++++     T+  +QP+DSS  G  G +RE  + ++ DD++EKLP+D+   E++A++      +P  +   QE +RM  + + +R +L +L L + G + ++  +    + +Y   IP  W K ++ S   +  W+ +L+ R  +   W  D + P+V W+ G FNPQ FLTA+ Q++ R ++ W LD + L  DVT+  K+D+  PP +G YVHGLF++GA WD +   + E   K L   +PVI I AI         +Y CP+YK   R   T++   +LKT + P  W
Sbjct: 1085 ASTVVSMPIFPQKMNYFKNVSENKEVAKLLSMLS--TVVNSQKKEVITALELFNKYSSVWQGDRD-----------------------HTISAFLQNDPKLSEFEAQILHY-KEMEQTIVQEPESYSVGS--IALMTEKLKSSLCAETKAWCISFSRYCNQKYRMEMEEIFTFVEDMTKRLSRPIK--DLDDIRLAMNALKEIRSQEIKIDMNIGPIEESYQMLARYDMPIAREESERVDTLRYSWEKLQSLATESQDHLIGIQSNFKGGLIDEVQTFILDVGSFAGDYNSTGPMVPNVPPREASDRLIIFQNRFDTLWRKYITYSGGEE----------LFGLPVTEYPELMQIKRELNLLQKLYGLYNDVIDTVNGYYDILWQDVNIEKINQELLDFQNRCRKLPRALKDWQAFLDLKKTIDDFNESCPLLELMANKAMKQRHWDRIANLTGHTFDIESDTFSLRNIMEAPLLKHKEDIEDVCIAAVKEKDIEAKMKMVIADWSTKDLTFANFKNRGELLLRGDNTSEIVSLMEDSLMVLGSLMSNRYNAPFKKNIQLWVQKLSNTTDIIENWMTVQNLWIYLEAVFVGGD-IAKQLPKEAKRFQNIDKQWVKIMTRAHENCNVVQCCVGDETLGQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNVFDNIKSVKFHEK----DYDRIMAVISSEGETVEMVKPVMAQGNVEIWLGTLLTMSRQSLHNVIRQAYVAINDSSFNLLEFLNTFPAQVGLLGIQMIWTRDA-------TEALTNA--KYDKKVMQQTNAAFQELLNVLIEQTTKELTRVVRTKFETLITIHVHQRDIFDDLCRMHIRTPSDFEWLKQIRFYFNDDTDVCSVNITDVTFIYQNEFLGCTERLVITPLTDRCYITLAQALFMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIYIILTGKKERKKQFIFSDGDVVDMNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFIDNITLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRNNPGDSENTTVMRVLRDMNLSKLIDEDEPLFLSLINDLFPGIVLDKAGYPELEQAIATEAEEIGLINHPPWRLKLIQLFETQRVRHGMMVLGPSGAGKTKCIHVLMKAMTDCGTPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEKIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKIVFEPHNIDNASPATVSRNGMVYMSSSGLDWRPVVQAWINKRPI-PEGEILNGFFEKSYEELLTFLRESLVSKMDILDHNYIIQTLTLLDGLIPKKDDGGQFSSQHLEHLYVFSLMWSIGALL----ELDDRAKMETFMRENFD-LDLPQVSENENIFEFMVN-DAGEWAHWNTRVEEYVYPKDHVPDFLSILVPNVDNVCMDYLIETVSKQSKAALLIGEQGTAKTVMIKGYMSKYDPEKHLSKSFNFSSASTPLLFQRTIESFVDKRMGSTYGPPAGKKMTVFVDDINMPIINEWGDQVTNEIVRQLMETKGFYNLEKPGDFTNIADIQFLSAMIHPGGGRNDIPQRLKRQFLIFNCTLPSNASIDKIFSVI-----GGGYFCKERGFINDVQDFALKLVPCTRKLWQLTKVKMLPTPAKFHYIFNLRDLSRIWQGILNTIAEVINSERALVSLWKHECQRVVSDRFTNQQDKDWFEKTMKRVIVDELGE-DYQPMIDATAYFVDFLRDAPEATGDEPEDADFETPKIYEPIPSFDGLEERLAMYMDLYNDSIRGAGMDLVFFRDAMIHLMRVSRIIRTPRGNALLVGVGGSGKQSLTRLSSFIAGYKTFQITLTRSYNSSNLMEDLKYLYRTAGQNGQGITFIFTDNEIKDEGFLEYLNNVLSSGEVSNLFARDEIDEICGELIPVMKKEFPRRPPTG-----ENLYEYFLTRAKHNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVADHFLSSFDIVCTAEIKTQVVHSMGVIHDGVANCCTDYFQRFRRATHVTPKSYLSFINGYKSIYTEKRGEIGELAQRMHTGLDKLMEASDSVAQLSKELAVKEKELAVASEKADKVLKEVS--IKAQAAEKVKAQVQKVKDKAQAIVDEIAVDKAVAEGKLEKAKPALEEAEAALQTIKPAHISTVRKLAKPPHLIMRIMDCVLLLMVKKVDPVVHDPERNMLKPSW-SESLKLMSKSD-FLNNLLNFDKDSINDETVELLAAYLEADDYNMETAKRVCGDVAGLCSWTRAMSTFFGINKEVLPLKANLAVQEARLGVAQGDLNKAQAQLDEKQAELDEAQAMYENAVKEKQDLLDDAEACRRKMLAASALISGLGGEKERWTEQSKEFAEQIGRLVGDVLVCTGFLSYSGPFNQEFRELLM-SNWQKEMKSRK--IPFTSNLNVTGMMVDGATVGEWNLQGLPNDELSVQNGIIVTKATRFPLLVDPQGQGKAWIKNREKDNEMQITSLNHKYFRTHLEDALSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTLKVKVGDKEVDVMKGFVLYVTTKLPNPAYTPEISARTSIIDFTVTIKGLEDQLLGLVILTEKAELESERTKLLEDVSSNKRKMKELEDNLLYRLTSTQGSLVDDESLIEVLSVTKTTAEEVSQKLLVAADTEIKINGAREEFRPVATRGSILYFLIVEMSYVNCMYQTSLKQFLGLFSQSMERSHPSPITSKRINNIIDYLTHEVWRYSCRGLFENHKFLFTLLLAFKIDLQNKRIKHNEFMTLIKGGASLDLKACPPKTCRWITDMTWLNLVELSKLSQFSDILNQISRNEKQWKNWFDKDAPEEAEIPDGYANSLDTFRKLLLIRSWCPDRTISQARKYISESMGAQYGETVILELEKTWEESDNRTPLINFLSMGSDPTGMIEALAKKHKY-----DCRAISMGQGQEVHARKLLNSFMQTGGWALLQNCHLGLEF-MLELIDTVVESEHIHEDFRLWMTTE-----EHVQFPIGLLQMSIKFTNEPPQGLRAGLKRTYNGISQDQLDV-SNLPQWRPMLYSVAFLHSTVQERRKYGPLGWNIPYEFNQADFTASVQFVQNHLDDMDIKKGVSWNTVRYMLGEVQYGGRVTDDFDKRLLNTFAKVWFSEGMFHPSFNFYKGYVIPKGTSVQQFLEHIDGLKLVDSPEVFGLHPNADITYQSNLAKDCLDTILSIQPKDSSSGG--GETRESIVHKMADDMLEKLPEDYIQHEVKARLQKMGPLSPMNIFLRQEIDRMQRVITAVRITLTDLKLAIDGTIIMSETLRDSLDCMYDARIPTHWKKVSWES-STIGFWFTELIERNAQFRTWCFDGR-PNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLHNDVTRFFKDDITTPPAEGVYVHGLFLDGAGWDRRGCKLVEPPAKVLFTPVPVIHIYAINSTGGRDNRLYQCPIYKKPRRTDLTYIACVDLKTNQNPDHW 4602          

HSP 2 Score: 144.436 bits (363), Expect = 8.897e-34
Identity = 131/584 (22.43%), Postives = 272/584 (46.58%), Query Frame = 1
Query:  643 IETVVIEWAHQIDDVLSKQSSEQLMAGLNPT-PFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDP---KEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGL-LDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQV 2379
            IE VV  W  QI+ VL++  SEQ+    +   P  ELD+WK R      + +Q+     K +  +L    S     ++ +   +     E+++   +L  L    + +   +   M   I  L + + +I ++ + Y   ER+  L  +++N +I  C +Y+     K +++    E +EK+   +++  +++  F    +K K+  +   +  +++F+   IFG++N+F  R+  +  ++N   +F  L +  I G++          M+ + + I     ++ YD LD  + +F  D+ +FK  I +L  +L   +   F          +LI  F  L LD   L+    ++Y  ++     ++E  + +Y  H +     P + +++P + G++ W ++M  RI+ P+ +         +T++   ++K +++L ++L + E+ Y+  W+  V E     L   LL+R+ D   + VNFD ++  ++RE + +  L   +IP SA  +  K  +L+K  + L L++     +        +PL+   L +++  ++  +T L W S  LD     Y++ V
Sbjct:  222 IEAVVSAWIKQIEQVLAE--SEQMRKEADDVGPKAELDHWKKRMAKFNSLLDQIKGSDCKAVVGVLHAAKSKLLKTWRELDIRITDYANEAKDNVKFLYTLEKFCDPLYNSDPVGMMDGIPGLINAIRMINSYSRYYNTSERMTALFVKVTNQMITACKNYITEHGYKNVWEYTHSELIEKLGNCIRLNEEYQRCF----QKTKQRLEQNPDERQFEFSEMYIFGKINTFSRRLNKIIEMMNTMQKFMTLGESRIEGLE---------QMWNKVQLIMTTMKKKPYDLLDYRKMEFDADFEEFKRQISELQAQLQNFMDICFEKIPSTQRALRLIRKFESLGLDS--LRDTIQEKYERILIYFGRDIETIQKIYQRHKTD----PPVARDLPPIAGKIAWARQMYRRIQEPMIMFQKYP-SILQTSDARKIIKNYNKLSKVLLEFELLYHQAWVKQV-EVIKSGLQASLLVRHPDNKKLFVNFDPQIMTLIRETECMVRLGL-DIPFSAHALLQKQSSLKKNSDTLQLLLNERERVLGKIPQTFRPLMAPHLAKVEAAIDPGLTMLNWTSLNLDT----YVDSV 777          
BLAST of DNAHb-1 vs. Ensembl Nematostella
Match: EDO45806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR2])

HSP 1 Score: 1769.21 bits (4581), Expect = 0.000e+0
Identity = 1141/3252 (35.09%), Postives = 1755/3252 (53.97%), Query Frame = 1
Query: 3961 WKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRA----VNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQ-VKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMV---EFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLA-------VDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWIST--REIQSEQANLTI-LFDKYVPVCLEAL-KLRFKKITPIVEI----SHVQMLCHLLEVLLVPENTPADCPKE---WYELYFVFCAIWAFGSCMFQ------DQLVDHRVEF-------TKWWVTEFK-------TIKLPAQGTVFDY-YIDTETKKFEPWTKRMTKF-EMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQD-KLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFT-ISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-----FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKK----AFEEMDEMVMFK----------KPLLYCHFAQGIGEPK-YMPVERSEDLSKILKEALESYNEVN-AAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSM----RNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAV-IDVSAACMCLMATNGKVP-------KDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKE-YCKDPNFNPEEIKSKSLAAAGLCSWVINIITY--YEIFCDVKPKRDXXXXXXXXXXXXXXK----LSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGA-DLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRA--IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIV---PNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTS-LQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXX-RVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCA----KENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEML-DGELNIVPG--FKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDL--RNVYACPVYKTKERGPTFVWT 13395
            W +  W  I+ ++++ +  ++ +S+  L+K++        +  ++K  +   +     V  + NP +RDRHW Q+          +E   L  + ++NL  +  +  +I E A KE S+EK ++++   W  +EF    +  TG  +L + ++ I+TL +DQ VK Q M  S +I  F +E+  W+  L    ++I  W +VQ TW +LE IF  S DI  Q+PE+  RF  +D +++  +       +V+   G  ++  +L+     L L  K L EYLE KRL FPRF+F+S+ +LL+ILS    P  V  HL K F+ +A L+F       +T     M + +GE+V   +  +     GQVE WL  L E+M  ++R V+ E++ +  ++ R +W+ ++P Q  L  +Q  W  EV+ +      G +  L  + ++  +Q++ ++TL+ G+LSK +R  +  +  +DVH RDV+ KL    I +   F WL QLR+ + +  ++    +  A   Y +EYLGN+ RLVITPLTDRCY TL  +L L + GAP GPAGTGKTETTKDL +A+     VFNCS+ +DY ++G  +KGLA  G+W CFDEFNRI +EVLSVVA Q+  IQ  IK+      F G EI LD    +FITMNPGYAGR+ELP+NLKALFR  AM+VP++ +I EI L + GF+ AR LA K +T Y LC E LS Q HYD+G+RA+KSVL  AG LK   PD  ED +++R++ D N+PK +  D P+F G+  DLFP + +P+           +    + LQ  + F+ K++Q+ E+  VRH   ++G    GK+  ++ L K  S++ +K L        V +NPK++T  +L+G  +P + EW DG+ +V  R  A+ T+   KW++ DG +D +WIE++NTV+DDNK L L S E I L  T  L+FE   L+ A+PATVSR G++Y+ P  LGW+P + SW+ T  + +  E   L   LFD+     L+ + K  FK+++P  +     SH+ M+  L++     +       +E   W E  ++F  +W+ G+ +        D+L+   VE        +K+ + E             P++ TV+DY +I     K+E WT+ +     +  +     +++PT +T R+ Y ++ L+   +P + VG  GTGK+V + +  L  + + Y    + F+  TT++  Q ++   L+K+    YGP   KK + F+DD+NMP  + Y    P  L+RQ +D+  WYD    +   + + Q LA M P  G    I+PR  RHF   +++     ++  I+S I++  L +N     FS         LV+  L  +       LPT  K HY+FNLRD + + QG L + PD I +   L RLW HE  RV+ D+L+D  D +      +E+ K      F+ + + + F           + L++C F     +PK Y+ VE  + L  +++  L+ +N ++   M LVLF  A+ H+ RI+R+++ PRG+ LLVGVGGSG+QSL+RLAA ++  D+FQ+ + KGY   + + D+ A+  K        VFL TD QI +E FL  +N+LL +GE+ +LFP DE + I   M    R   KS     S    + +FI +VR  L +VL  SP+G   R R RKFP++VNC +IDWF  WP DAL  V+ RFL+E E +  D K+   +     H +   +S+ Y    +R+NY TP S+LE I+ +  +L KK  E+     R E GL+KL S   QV  ++ +L A + +L Q     ++++  +  D+ +V+  ++I   +E   ++        + +C++DL +A P L++A  ALNTL   ++T +K+  +PP  V + + A C+       ++P       K   + A    I+G +  FL  L  Y+KDNIP P++K  ++ Y  +P F+P++IK  S AA GLC WVI + +Y  Y+         D L  +     +   K    L  +Q+K+        +LQ+++E     K   + + DL  K ++ A +L+GGL  E  RW +      +    L GDVLV+   ++Y+G FT  +R      Y     ++   ++   + L  + ++     I  W   GLP+D  SIEN  I+ NA RWPL+IDPQ Q  KWIK      +L V++L    Y+  +E  +  G  VL+EN+ E +DP+L+ LL + T K+G +  IK+GD   EY+ +FR  + TKL NPHY PE   + T++NF +T +GLEDQLL  VV +ER +LE  K  L  Q  + K  LKE+ED +L  LS++EGN L D   +  L ++K  A EI EK   A+ TE  I++TR  Y P A  +++L+F + DL  I PMYQ+SL  F  +F  +ID +E SEEL  R+ENL +  T+S+Y    R LFEKDKL+F+  +   IL+   E+   E  FLL   +    P+ ++P  +L + SW  I  L  + +FK   +    + + WKK  +S  P+    P EW+ K    Q++ ++R LRPD++T  V +FV  KLG KY+E    +  ++F +S    P+ F+LSPG DP   +       GFSG   +  ++  GQG   +A + ++   K+G WVVLQN HL + W+  LEK  EE   ++     R+++++ PS +      P  +L+N +K+TNEPP G+ AN+ +S         E       K  +FK +LF LC+FHA+V ERR+FGP GWN  Y FN  DL ISV  L+ ++    +V +E L+YL GE  YGG +TDD DR+   T L ++  P ++ D      P   +  P + DY+ Y  Y         P ++ +H N    F    S +    +              G S +E +  + +DI+ K+P +F+      K P         V  QE  R N L   +R SL  +   +KG + +++++E + + +    IP  W K++YPSL  L  +  DLL R+K L+ W  D   PSV W+ G F  Q+FLT   Q  ARK   P+D +    +V +  K +   PP DG YV+GLFMEGARWD  +  I E++ K L  S+PV+++   P   +D+  R  Y  PVYKT ER  T   T
Sbjct:  702 WMEGPWGTIDPDKVESETGNYWRSLYKLEKQLTEVPLAQRIAGRMKTKVEEFKEYLPLVQVVFNPGLRDRHWEQMSEILGFPLKPDEDMNLAKMAEMNLEPYLAQFETISEAASKEFSLEKAMEKMVGEWDAVEFVMIPYRETGTHILSSIDD-IQTLLDDQIVKTQTMRGSPFIKPFENEIKEWEGKLILTQEIIDEWLKVQATWLYLEPIF-SSPDIMAQMPEEGRRFSTVDKNWRETMKVAVLDKHVLTVIGIEKMLGKLKKSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLQFT------DTLDITHMKSSEGELVLLKDVISTSKARGQVEKWLLELQEDMVASVRKVIMEAMEAYLKEERVKWVRDWPGQTVLCVTQYYWTAEVHKAI----RGGQKQLDQYLQQNNSQIDDIVTLVRGKLSKQNRATLGALVVLDVHARDVLTKLCELGISSEDDFEWLAQLRYYFEE--ENVMTRMISAHLAYGYEYLGNSGRLVITPLTDRCYRTLFGALQLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQMGIKSGGDTLLFEGTEIKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPNYAMIAEISLYSYGFVNARSLAVKIVTTYTLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPDENEDILMLRSINDVNLPKFLAHDLPLFAGITSDLFPGVQLPKPDYTVLTAAAAEVCKSMNLQMVDEFLTKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAKALSDVAEKGLMEENKVQIVVINPKSITMGQLYGQFDPVSHEWSDGVLAVNYRAFASSTTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLNSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWKPLLTSWLHTLPKTLNEENKELIKDLFDRMEEALLQFIRKGGFKELSPTNDTNLVNSHMNMMDTLMDEFHDEQRFKELNEREVAAWLECIYLFSCVWSLGATLDGEGRKSFDKLLREIVEGPLSLESKSKYHILEIVDPPPRPFLCPFPSKATVYDYRFIKEGMGKWELWTEEIKDAPPIPKDMAFNEIIIPTVDTVRYTYLMEQLVTHGKPSLFVGPTGTGKSVYITNFLLKKLEETYKPLLINFSAQTTAKQTQDIIMSKLDKRRKGVYGPPLGKKTVVFVDDLNMPAREVYGAQPPIELLRQWLDHWQWYDLKDTSPIHLVDIQILAAMGPPGGGRNPITPRFLRHFNTISITKFDDGTMVKIFSRIMNWHLTTNASCRGFSKDFGPIGDMLVNGTLEIYRNAIVNLLPTPAKSHYLFNLRDFARVIQGTLLSAPDRITEHDMLKRLWSHEVFRVFYDRLVDGGDRDWLYNNLREVCKSHLNVEFDTLFQRLDFDGDGKVKEDDLRSLVFCDFTDAKADPKPYVEVEDLDKLRGVVENYLDEFNNMSKKPMTLVLFRFAIEHVSRISRVIKQPRGHCLLVGVGGSGRQSLTRLAAHMADFDLFQVEIGKGYTSTEWREDIKAILRKTAEGETNGVFLFTDTQIKEESFLEDINNLLNAGEVPNLFPLDEKQEICEKMRQFDRQRDKSKQTDGSPVALFNYFIERVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPADALQVVAQRFLEECE-IEADVKEGCVEMCKSFHTSTRDLSLRYQSELKRHNYVTPTSYLELISTFKALLNKKQQEVVKAKRRYEVGLEKLNSAQSQVASMQEELEALQPQLIQAGKEVDDIMVIIERDSIEVAKTEKIVKADEAVANEQAMAAKAIKDECDKDLGEAIPILESALAALNTLTPADITVVKTMKSPPAGVKLVMEAICILKGVKPDRIPDPSGSGKKIEDFWAPSKRILGDM-KFLQGLQTYDKDNIPAPAIKQIRQKYTSNPEFDPDKIKVASTAAEGLCRWVIAMDSYEKYDHLTTTFKSIDLLLMSVLCDFQGLNKKRAALKEVQDKL-------ARLQEKYEANVKKKSDLEKQVDLCSKKLDRAEKLIGGLGGEKTRWTEVANALGVRYTNLIGDVLVSSGVVAYLGAFTAAFRQGTCRAY-----SSSGRLVEYGRVL--VALIAQPVKIRDWTIFGLPTDSFSIENGIIINNANRWPLMIDPQGQANKWIKNMEKKNNLHVIKLTDADYVRTLENCIQFGTPVLLENVGEELDPLLEPLLLKQTFKQGGSICIKVGDSVIEYSKDFRFYITTKLRNPHYLPETAVKVTLLNFMITPEGLEDQLLGIVVARERPELEEEKNALILQSAENKRQLKEIEDKILEVLSSSEGNILEDETAINVLSSSKVLANEISEKQAIAEETEEKIDKTRMGYTPIAVHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSEKSEELDKRLENLRNHFTYSLYCNVCRSLFEKDKLLFSFLLCVNILMHDGEVCRDEWRFLLTGGVGLDNPH-SNPASWLPSRSWDEICRLDDMSKFKGFRQKFPRTLEGWKKIYDSNEPQTMPLPGEWEEKFDFFQKMVLLRCLRPDKITPCVQNFVTVKLGKKYIEPPPFDLGKAFADSNSCAPLIFVLSPGSDPTAALLKFADDQGFSGSKLSSLSLGQGQGP--IALRMIEKAVKDGTWVVLQNCHLATSWMPTLEKLCEELNPDTTHPDFRLWLTSYPSPN-----FPVTVLQNGVKMTNEPPKGIRANIIRSYLGDPISDPEFFTGTGQKSPQFKKMLFGLCFFHALVQERRQFGPLGWNIPYEFNETDLRISVQQLHMFMNKYDEVQYEALKYLTGECNYGGRVTDDRDRRTLLTILNKFYTPGVIKDDRYKFSPSGNYYAPDDGDYETYIEYARSLPLINHPEIFDMHANV---FSLRTSMRHISVLTHQTCTQCVLLSGGGRSDDEIVASVSEDILSKMPQEFDTDAALRKFPTTYTQSMNTVLVQEMVRFNRLIKVVRSSLVNIQKAIKGLVVMSSELEEVVSGILKGKIPGLWMKKSYPSLKPLGSYVNDLLARLKFLQDW-YDNGAPSVFWISGFFFTQAFLTGSKQNFARKYTIPIDLLTFDFEVLEDKKYET--PPEDGVYVNGLFMEGARWDRDTKAIGESQAKVLFDSLPVMWL--CPCKTEDIKKRPHYVTPVYKTSERRGTLSTT 3907          
BLAST of DNAHb-1 vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1786.54 bits (4626), Expect = 0.000e+0
Identity = 1119/3265 (34.27%), Postives = 1810/3265 (55.44%), Query Frame = 1
Query: 3835 ESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDM-NESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLK--ASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDF-KALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRD--QWIFEFPAQVALSSSQIAWG--TEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFL-GEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTR---EIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPA--QGTVFDYYIDTETKKFEPWTKRMTK--FEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVAN-VPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLT-LKEIHNTQYLACM-NPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGS--NFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETY-QRLQKELTKKAFEEMDEMVMFKKPLLYCHF----AQGIGE---------PK-YMPVERSEDLSKILKEALESYNEV--NAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKS--TGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQ--EVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVE--EEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKD---------RSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGA-DLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRA--IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTS----PIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYL---EANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPA-ESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNE-WPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGP-TFVWTFNLKTKEKPSKW 13431
            + A LF +TV +  QL + R EL LL+ L+   N V  ++  +   LW +IN+E+++ +   F    R L + ++ W A+  ++  I         +  + + A+  RHW ++   T    D+ +E+  L ++++ +   +++E+  I   AVKE  +E+ LKE+ + W    F        G  LL+  ++ ELI +LE+  + L ++M+++Y + F  ++  W + LS    +I+ W  VQ  W +LE++F+G D I KQLP++++ F  ID  + K +    E    V    G   + + L  +  +L  C+K+L  YLE KRL FPRF+FVS   LL+IL   +    +  HL  +FD++  ++F ++  +      +A+ +++ E +E        G VE WLN LL+E + ++  V+ ++  +++ +  +   ++  F AQV L   Q+ W   +E  L+ A  + G    +   N+  +  LN LI +   +L   +R K  T+ TI VH RD+   L    IDN   F WL Q R  + +      INI D  F Y +E+LG T RLVITPLTDRCYITL Q+L + M GAPAGPAGTGKTET KD+GR LG  V VFNCS+QMD++ +G I+KGLAQSGSWGCFDEFNRI + VLSV A Q+  +    K++ K F F  G+ + ++   GIF+TMNPGYAGR ELPENLK  FR  +M+VPD ++I  + L + GF+    LA KF TLY+LC+E LSKQ HYD+GLR I SVL   GA KR++P   E  ++ R L+D N+ K++ +D  +F+ LI DLFP +++ ++  PE E  + +   +  L     + LKV+Q+ E   VRH +  LG +G+GK+   + L+K  +   +    + +NPKA+T  ++FG ++ +T +W DG+FS + R           WIVLDG +D +WIE+LN+V+DDN+ LTLA+ +RIP+ P  +++FE  ++  A+PATVSR G+++++   LGW P +  W+  R   E +  +   +  F +     +++L+ +   +   V +  + ML  L+ +    +    + P+E  E  ++F  +W+ G+ +  +      + F    V      ++P   + T+FDYY+  E   +  W+ R+ +  +  D+     ++LVP  +  R  + +D + ++ + V+L+G  GT KTV+++  ++       +   + F+  TT  M QR +E  ++K+ G  YGP   KK+   IDD+NMP V+++     + ++RQ ++   +Y+  K      I + Q+LA M +P  G   I  RL+R F +F  + P   S+  I+  I      +   F   + +T+  LV L            LPT  KFHY+FNLRDLS I+QG+L    + I     L+ LW HE +RV  D+    +D+E + Q L K + ++  EE  ++V       +  F     +  GE         PK Y P+E  E L   L   L  YN+      M++V F+DA+ H+++++RI+ +P G ALLVGVGGSGKQSL+RLA+FI+   +FQITL + Y   +L  DL +LY  AG +  G+ F+ TD +I +E FL  +N++L+SGE+ +LF  +EM+ I+S +   +K        + EN + +F+++VR  L +VLCFSPVG   R RA KFPA+++  ++DWF  WP+DAL+ VSH FL   +++  P+  K    + M      V +  + Y    RR  + TPKS+L  I  Y  +  +K  E+      +  GLQKL+  ++ V  L  +L  +E EL+  N  A+ +L++V    K  +SE    +V+  ++K   I   ++  +   E  L  A PAL+ A+ AL T+  +++  +++   PPP ++  +  C+ L+      P +          SW+ +   +M    +FL  L  + KD I E +++  + Y   PN+N E  ++ S   AGL SW   + +++ I  +V P +  L      L  A   L   Q ++   + +L  ++ E+E+A ++K    ++A    + +++A+ L+ GLA E  RW +Q +++  + K L GDVL+  AFLSY G F + +R  L++  W   L   +  IP   NLD  ++L+D + ++ WN +GLP+D +SI N  I+T A R+PL+IDPQ QG  WIK +    +L++  L  K + + +E+++S G  +LIE++ E +DPVLD++L +N IK G    +K+GDKE +    F+L + TKL NP Y PE+ A+T+II+FTVT  GLEDQLL  V+  E+ ++E  + DL +     K  +KELED+LL+RL++ +G+ + D +L+  L N K+TA E+ +K++ A  T++ IN  RE YRP A R S+LYF++ +++ +N MYQ SL  F  +F+ ++ R+  S     R++++I+ +TF VY Y +RGL+E+ K +FT  ++ +I +  K +   E   L++     +L +    P +++ + SW  +  LS L +F  +   I    K WK + + E PE+E  P  +++    +RL ++R   PDR       ++ + +G KY EG  ++   ++EES P TP+   LS G DP   +  LGKKL         R +S+GQGQE+ A K +      G W +LQN HL   +            E  ++S+R++I+ E   +      P  +L+ +IK TNEPP G+ A L ++    NQ+ +++ +  N++K +L+ + + H+ V ERRKFGP GWN  Y FN  D   +V  + N+L   +    V W  ++Y+ GEI YGG +TDD+D++L  T+ + +    M + + N   G+ +P  +    Y  YI + LPA ++P ++GLHPNA+I F +  +  +  T+  +QP+DSS  G  G +RE  + ++ DD++EKLP D+   E++         P  +   QE +RM  +   +R +L +L L + G + ++ ++    + +Y   IP  W K    S  G   W+ +LL R ++ + W    + P+  W+ G FNPQ FLTA+ Q++AR N+ W LDRM L  +VTK  K+D+  PP  G YV+GL++EGA WD  +  + E+K K L   MPVI++ A     +D R +Y+CP+YK   R     + +  LKT + P  W
Sbjct:  884 DGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDFQTRCRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGD-IAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRI----LAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRG---IMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPL----KEQCGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAE-GHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQ-VKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEV------MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVT--VKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQ-TMDCVLLLLRRRVNPVEINAETNFITSSWQES-LNLMTS-GSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNE-WQCELKQRS--IPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQISHHEKLWKSWFDKEAPEEEVLPNSYQSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIET-----RYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNF-MDELMDTVIETECINDSFRLWITTEVHKN-----FPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDV-SNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYI-QGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGG--GETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKSWASSTLG--FWFTELLERNRQFQTWLFKGR-PNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNVVKDPR-LYSCPIYKKPTRTDINCIASVGLKTTQPPEHW 4101          

HSP 2 Score: 89.3521 bits (220), Expect = 1.081e-16
Identity = 114/499 (22.85%), Postives = 219/499 (43.89%), Query Frame = 1
Query:  736 PFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPK---EIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKF-KASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKV-PKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMV 2217
            P  EL+YWK R      + EQL SP V+ +  +L    S     +  I + +  A  E++N   Y+  L    E + + +     P    L + +  I    + Y   E+I  L   ++N +++ C +Y+       I+    +E + K++ ++  LNQ  +  E  +  ++  F          F+   IF + ++F SR+E +  + N    ++ L+  +I G++          +   FK I      ++Y  LD   T+F  D+ +F K + + L++ +  T+ +   D        + +D+        I  L  D +Y +++    +++E    V DI     EK+ P   +++P + G + W + +  RI  P+            T E   ++K  + + E+L ++E  +++NW+T V +     L   LL+R  +T  + VNFD +L   + E   +  ++  +IP  A  +  K  TL+K  NN  + V
Sbjct:  120 PRAELNYWKKRMSRFSYLLEQLKSPHVRTILRVLGLAKSKLIESWIEIDRRITVASNEAKNNVKYVYSLETFYEPLYKCDPVRKIP---SLINAIRTIHNVSRYYNDSEKITTLFLLVTNQMVSSCKAYITNNGCDSIWDQPRQEIIRKIKAAIH-LNQVLKPRELEQAPLERQF---------DFSEAYIFWKFDAFQSRMEKILKMFNIISTYSVLQDSKIEGLE---------TIATRFKPILMSMKNKSYSFLDHSATNFETDFEQFCKRTSEQLEKFMNDTI-ENIQDTQ------RALDVLHQFERLGIPDLGTDTKYQDILLKYGQDIE---WVSDIF--EKEKLDPPFERDLPPMAGRIMWARILSRRITDPMNFFQQ-QPGVLSTQEAKNIIKNFNRMTEILLEYEKLHHHNWMTKVTD-ARLGLEATLLVRLGETGELFVNFDPELLIQIMETNCMARMNL-KIPPFAAVLQQKEYTLKK--NNSQMQV 579          
BLAST of DNAHb-1 vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 1706.42 bits (4418), Expect = 0.000e+0
Identity = 1138/3220 (35.34%), Postives = 1767/3220 (54.88%), Query Frame = 1
Query: 4081 VEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNN---CDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNL-------KKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWIST--REIQSEQANLTI--LFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLL-VPENTPAD--CPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVT-EFKTIKLP-----------AQGTVFDYYID-TETKKFEPWTKRMTKFEM-DLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKL--NSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHW--YDRAKLTLKEIHNTQYLACMNPTAGSF-TISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAF--------------EEMDEMVMFKKPLLYCHFA----QGIGEPKYMPVERSEDLSKILKEALESYNEVNA-AMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMK-AGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMR--NEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNK-NNLTEMKSFGTPPPAVIDVSAACMCLM-----------ATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAK-EYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKT-RHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKG-RAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEK--VEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPI-VPNLTSPID--FLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNK-TSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXX-XXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSL--------NNFNQETMEMCA-KENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDG---ELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIM-EKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPT---------FVWTFNLKTKEKPSKW 13431
            V +QI+     +  V+ L NP +R RHW ++          N  T+L  LL+L L  F +E  +I   A KE S+EK ++ +   W  + F H+ H  TG+++  A +++   L++  VK Q MM S ++  F  E+  W++ L    + I  W ++Q  W +LE IF  S DI +Q+PE+   F  +D +++ ++    + + V++AT  P L ERL+   + L    K L  YLE KRL FP                                                     MY+ +GE VE   N    +  G VE WL +L + M +++R ++  S +  +   R+QW+ E+P QV L +SQI W  EV+ +           LK + ++   QLN ++ L+ GEL K  R  +  + TIDVH RDVV+ LI +K+ +   F WL QLR+ W + +   +I  CD   +YA+EYLGN+PRLVITPLTDRCY TL  + HL + GAP GPAGTGKTETTKDL +AL +   VFNCS+ +DY ++G  +KGLA SG+W CFDEFNRI +EVLSVVA QV CIQ AI +K + FDF G  + L+    + ITMNPGYAGR+ELP+NLK LFR  AM+VP++ LI EI L + GFL A+ L+ K +  Y+LC E LS Q HYD+G+RA+K+VL+ AG LK   P+  ED +L+R+++D N PK ++ D P+F G+  DLFP + +P      F +   +      +Q  + F  K++Q  E+  VRH + V G +  GK+ V   L  T S +       ++K +   LNPK++T  +LFG  +  + EW DG+ +   R+ A   +   KW+V DG ID +WIES+NTV+DDNK L L S E I ++  M L+FE + L  A+PATVSR G++Y+ P  LGW+P V SWI+T    +QS      I  LF   +P  L+ L+   +++ P      V  LC L +++L  P  T  D    + W    F    +W+ G C   D       +F +  V+ + K   +P            +G V+DY+ +  E  ++  W   +    + ++    Q ++VPT +T R+ Y +DL I  + P++ VG  GTGK+V ++DKL  N   D Y+   + F+ +T++   Q ++   ++K+    +GP   K+ + F+DD+NMP  +++    P  L+RQ +D+ H+   D +K++L ++   Q++A M P  G    ++ R  RH  + +++    +++  I+S+I++  +  N FS   +   + +V   +  + K  +  LPT  K HY FNLRD S + QG L      ++    L+RL++HE  RVY+D+L+DD D     +L   + K  F              ++++E  M  + LL+  +     +G  E  Y  V   E  ++++K  LE YN+++   MNLV+F   + H+ RI+R+L+ P G ALLVGVGGSG+QS++RLA  ++ + +FQ  + K YG+ + + DL  + ++ AGVK    VFL+TD QI DE FL  ++ +L +GE+ +LF  DE + II ++R   +     +  S    +AFF+ + +  L +V+ FSP+G   R R R+FP+++NC +IDWF  WPE+AL  V++ FL+ +E + E+ +          H + N++S  +     RYNY TP S+LE IA +  ++ +K   +     R  NGL +L     +V  +K +L   + +LEQ      +++E +  ++ +V ++ R+  V+EE  +    E    + +CE DLA+A PAL+AA  AL+TL + ++++ +K+   PP  V  V AA +C+M           A  GK   D  W  +K  ++G ++ FL +L  Y+KDNIP P ++  + E+  +P+F+P ++ + S AA GLC W+  +  Y ++   V PK+  L  A E L      L   + ++K++ED+L  LQ  FE+   +K R + + +   + +E A +L+GGL+ E + W K  +  +     L GDVL++   ++Y+G FT  +R       W     +    IP + +    K L +   I +WN  GLP+D  SI+N  I+ N+ R PL+IDPQ Q  KW+K      +L V++L    Y+  +E  +  G  +L+EN+ E +DP L+ LL + T K+G  +IKLG++  EY+ +FR  + T+L NPHY PE+  + +++NF +T +GLEDQLL  VV KE  +LE  +  L  Q    K  LKE+EDS+L  L +++GN L D + ++ L++ K  + EI +K  ++ A+ TE+ I E+RE YR  A  +S+L+F + DL  I+PMYQ+SL  F  ++  +I   + S+ LK R+E L D  T+++Y    R LFEKDKL+F+  +    LL  KEI   +L FLL   I + N  +  D  +L + SW  I   S L  F+ L+  I+ + + +K   +S  P     P  W  K T LQ++ + R LRPD M  AV  FV   LG K+V+    + ++SF +S    P+ F+LSPG DP+  ++    K     D   F++ISLGQGQ  +A K +    + G WV LQN HL   W+S LEK  E+      H+ +R+++++ PS        P GIL+N +K+TNE PTG+  NL +S         N FN      C  K+  ++ +LF LC+FHA+V ER+KFGP GWN  Y FN  DL IS+  L  ++    KVP+E + YL GE  YGG +TDDWDR+L  T L ++   +++      L+    +  PP + Y+ Y  +I+    ++ P ++GLH N +I      +  LF ++   Q   + G  ++G   +  +  I ++I+ ++LP  F+   +  K P         V  QE ER N L S I  SL+ L   LKG + + +++EA++ +L +  +PE W+K +YPSL  L  +  D L R+K L++W  + Q P V WL G F  Q+FLT +MQ  ARK + P+D +    +V   +K +   PP DG YV+GLF++GARWD + G++ E   + L  SMP+I++K    +     ++Y CP+YKT ER  T         FV    L TK++P  W
Sbjct:  563 VIEQIQKFKDYIPVVSILCNPGLRGRHWEKMSQIAGFDLTPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTGVSIFTALDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIF-SSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKIMKGLNAYLEKKRLFFP-----------------------------------------------------MYSSEGERVELIQNISTSEANGAVEKWLLQLEDGMISSVRDIIDRSRAYEKTA-RNQWVKEWPGQVVLCTSQIFWTLEVHKALG---------LKKYYQQLQNQLNEIVELVRGELPKQTRTTLGALVTIDVHARDVVKDLI-EKVSDETDFEWLAQLRYYWMNDNVRVHIINCDV--KYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDFEGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAAEECCKIHNVQPTKVFTDKLIQTYEMMIVRHFMLV-GESFAGKTKVLHVLADTLSLMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRSLILDLFHWLIPPSLQMLRRHCREVVPTTNSHTVVALCRLFKMILDEPVKTGPDDESIRTWIMAAFASSLVWSVGGCCDTDSREKFN-DFIRQTVSGKNKEHPIPETIERWECPINEKGLVYDYFYEFKEKGRWIHWNDTIENINLGEINTKGQEIIVPTIDTVRYTYLMDLCI-SQGPLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLDHGHYDLKDTSKISLVDV---QFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSIVAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFNVPFDQVFGQLKQGDKLEEKDM--QNLLFGDYMNPDLEG-DERLYTEVPSIETFAEVVKSCLEEYNQMHKNRMNLVIFY-LLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLTLFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLE-MSENERQEVITICKTFHTSANQLS-DFQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRVVHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAA-VCVMKNVKPDRIPDPAGTGKKILDY-WGPSKK-LLGDMN-FLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEKI-WSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTK-LWTTLCQSKN--IPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIVRNSRR-PLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFKQGVESIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAKE-PELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSIQDIK-SKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCN-LLARKEIEHSDLMFLLTGGIGLQNTVANPDPSWLQDKSWDEICRASELPGFQGLEAFIK-NPEDFKLIYDSREPCSIDLPAPWCEKLTDLQKMIIFRCLRPD-MVPAVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADPMALLKFASDK---KMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTTCHQDFRLWLTSYPSPK-----FPVGILQNGVKMTNEQPTGLRLNLLQSYLTDPVSDPNFFNG-----CPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYDKVPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFAPPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSG--GDNTLYDIANNILTQQLPPTFDREAVLLKYPVLYEESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQ-PKVFWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTFDFEVLPIDKSET--PPEDGVYVNGLFLDGARWDKE-GVLTEQHPRILFDSMPIIWVKPEKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHW 3669          
BLAST of DNAHb-1 vs. Ensembl Medaka
Match: ENSORLT00000032470.1 (pep primary_assembly:ASM223467v1:16:15865272:15882071:-1 gene:ENSORLG00000029580.1 transcript:ENSORLT00000032470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1654.8 bits (4284), Expect = 0.000e+0
Identity = 835/1574 (53.05%), Postives = 1132/1574 (71.92%), Query Frame = 1
Query: 8719 LFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKE-YCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSK-VPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXX-XXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            LF D+E+E+I+S ++ EV+  G++D++ENCW FF ++V+    ++LCFSP+GS LRVRAR+ PA+ +CT+IDWFH W  +AL SVSHRF+Q++E +    ++S + FM++VH +VN+ S  YL NE+RYNYTTPKSFL+QI+LY N+L+K  ++LQ KM+RLENGLQKL +TA QV+DLK KLA+QE EL  KN +  +L+ ++   T+KV  +K  ADVE +KV+ ++AE++ KQ++CE DL KAEP+L AA  AL+TLNK NLTE+K+F  PP AV +V+AA M L++  G+VPKDRSW+AA+A  MGK+D FL  L++Y+K++IP+  L   K+ Y ++P+F P+ + +KS AAAGLC+W INI+ YYE++C+V PKRDAL  AN EL  AT KL+ +Q  +  L+  LQ L   FE+A ++K  CQ E   T +TI+LAN+LV GL                                                  + P    L PI          ++L DDA +A+W N+GLP+DRMS ENA ILT +ERWPLIIDPQ Q +KWI+   G+ L+VV+L QK YLDVI+QA+  G++VLIEN+ E +DPVL+ LLGR TIK+GR I++G+KECEYN  FRL+L TKLANPH+ PE+QAQTT+INFTVT  GLE+QLL  VV  ER +LE  K+ LTKQQN FKI LK  ED LL RLSAA+GNFLGD +LVE LEN K  A  I+ KV +A   E  INE RELYRPAA RAS+L+FI+NDL+KINP+YQFSLKAF  +F KA++ A+  E+++  V  L ++IT+SV+LYTS+GLFE+DKL F + + FQILL    I+  E  FLL FP+     S + FLS  +W  IK +S+++ F  LDRDIE S K W+K VES  PE E+ PQ+WKNK+S Q+L ++RALRPDRMTYA+  FV E +G +YV    ++F + +E+ GP+TP+FFILSPG             LGFS D     N+SLGQGQE VAEK +   +++GHWV+LQN+HLV+ WL +L+  LE  AE  H SYRVF++ EP+  PE H+IP+G+LE+AIKITNEPPTGM A+LH +L+NF+QET+++C +E EF ++ F+LC+FH+ V+ER+KFGPQGWN +YPF+ GDL IS  VL+NYLEAN+K VPWEDL YLFGEIMYGGHITD+WDR+LC TYL++++ P+M +  + + PGF  P   DY GYH+YIDE LP ESP LYGLHPNAE+  LT  SD LF+ + E+QP  S+       S EE++  ++ DI++KLP+D+NM ++  +    ER+PY VV  QECERMN+L +EIRRSL +L+L   +GEL+ ++ ME L   L+ + +P+SW++ AYPS   LA   +D++L  +EL+ WT DF LP+V+WL GLF+PQSFLT ++Q +ARKN+WPLD+M L  DVTKK ++D G PPR+G+Y+HGLFME ARWD+++G I+EA L++L P+MPV++++A+P +  DLRN + CPVY+TK+RG ++V  F+L+TK+  +KW
Sbjct:    1 LFSDEEVESIVSGVKAEVRGLGLLDTKENCWRFFTDRVQQQFTVILCFSPLGSALRVRARQLPALFSCTTIDWFHPWTNEALQSVSHRFIQDIEGIEPAAQESISLFMAYVHTSVNQASEKYLLNEKRYNYTTPKSFLQQISLYRNLLEKSRSQLQHKMNRLENGLQKLHTTAAQVEDLKCKLASQEAELSFKNQNIEDLITRIGLQTEKVRKKKEAADVEAQKVAVMQAEIAAKQKECESDLVKAEPSLTAALAALDTLNKVNLTELKAFPNPPDAVRNVAAAVMVLLSPRGRVPKDRSWRAARA-FMGKVDDFLQALVSYDKEHIPDSCLAVVKQDYLRNPDFQPDLVYTKSSAAAGLCAWTINIVRYYEVYCEVIPKRDALSRANVELEMATGKLTAVQKNLADLDASLQNLTTHFERATAEKLGCQKEVTQTTQTIQLANQLVKGL------------------------------------------------MVFAPLTDGLDPI----------RLLTDDATVAAWQNQGLPNDRMSTENAAILTISERWPLIIDPQQQALKWIRNWFGSKLRVVQLRQK-YLDVIQQALVCGEIVLIENLPEKVDPVLEPLLGRKTIKRGRYIRVGEKECEYNSSFRLVLHTKLANPHFPPELQAQTTLINFTVTPVGLEEQLLGQVVFYERPELEASKMQLTKQQNDFKIELKRCEDDLLSRLSAAQGNFLGDISLVEQLENTKSMAACIQSKVLEAIENETKINEARELYRPAAERASLLFFIINDLSKINPIYQFSLKAFYSMFNKAMEHAKRDEDVRTTVHTLTEAITYSVFLYTSQGLFERDKLTFLSHIVFQILLKQGLIDLQEFYFLLHFPVEAGKFSSVSFLSPQAWEAIKGISSMDCFSGLDRDIESSPKPWRKIVESSYPENERLPQDWKNKSSFQKLIILRALRPDRMTYAL-KFVAENMGSEYVNTPRLDFEKLYEDCGPSTPVFFILSPG-------------LGFSTDKGTLHNVSLGQGQETVAEKLLRNASQQGHWVILQNVHLVAHWLPSLDALLETTAENCHPSYRVFLTGEPAPRPEQHVIPRGMLESAIKITNEPPTGMSASLHAALSNFSQETLDVCTREREFNSLFFSLCFFHSCVTERQKFGPQGWNHNYPFSKGDLIISTTVLFNYLEANTKQVPWEDLCYLFGEIMYGGHITDEWDRRLCMTYLQQFMHPKMFESGIYLCPGFPAPSFLDYSGYHSYIDEHLPTESPILYGLHPNAELGCLTVTSDNLFRALLELQPHGSAREEGVFESTEEKVMTVIQDILKKLPEDYNMEKMLME--RTERSPYTVVCLQECERMNLLLAEIRRSLTDLELGLKQGELSFSSSMETLQFELFNNFVPQSWTRLAYPSTKTLA-QMSDVMLSCQELDSWTHDFTLPAVVWLPGLFSPQSFLT-VLQSIARKNQWPLDKMTLTVDVTKKLRDDFGHPPREGSYIHGLFME-ARWDSEAGSISEAVLRDLTPAMPVLYVRAVPSEELDLRNTFRCPVYRTKQRGSSYVSAFHLRTKQPAAKW 1495          
BLAST of DNAHb-1 vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1542.71 bits (3993), Expect = 0.000e+0
Identity = 1200/4095 (29.30%), Postives = 2005/4095 (48.96%), Query Frame = 1
Query: 1450 FKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKV-PKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVE-----------WYN-----YLRKNTLTVEQPLIENELN-----QIDEQL-EKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKE-ITEAGER--VHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVT--DIFKQASKVKRLAIGSSMEDYRTDLEE-NEELQKKRNEISERTEVAT-EKAKLYQA-KFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQ-TIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRK-MDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLK--ASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDF-KALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRD--QWIFEFPAQVALSSSQIAWG--TEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFL-GEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTR---EIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPA--QGTVFDYYIDTETKKFEPWTKRMTK--FEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVAN-VPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLT-LKEIHNTQYLACM-NPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEK---LGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETY-QRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGE------------PK-YMPVERSEDLSKILKEALESYNEV--NAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKS--TGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQ--EVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVE--EEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKD---------RSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRA--IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTS---PIDFLSNNSWGGIKALSALEEFKN-LDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVA-DFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYL---EANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPA-ESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYV---VVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNE-WPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGP-TFVWTFNLKTKEKPSKW 13431
            FK I      ++Y  LD   T+F  D+ +F     +L R+L   ++    +         ++  F  L    I  L  D +Y +++    +++E    V DI     EK+ P   +++P + G + W + +  RI  P+                                       N+   V +     L   LL+R  +T  + VNFD +L   + E   +  ++ + IP  A  +  K  TL+K  NN  + V+           W +     YLR     ++  L+ N +N     +ID  L E ++  LC   +  DN          +LVH  R    K  +N+           KS L E+   +   +L +D+ +   +   K  + ++G       LVK   ++   D + E  ++ + + +   ++   +    +L+ +      +   +F V + L   +IV  P+L++   +  +++V+ +V+      Q SK  RL++G   E     LE+ N E   +    + R+   +   A + QA  F  Y    ++N+E            +    + +        F +  P L +F+ QI  Y+    +I      N    +  +         + T++ W   ++          L+++   I      LN+     D + +   M  +  +++ Q + +    P++Q +  +L  Y   +  E   ++E L   W+                ++ EV       +  +  Q  F+++    M      C   Y+D D+ +              + A LF +TV +  QL + R EL LL+ L+   N V  ++  +   LW +IN+E+++ +   F ++ R L + ++ W A+  ++  I         +  + + A+  RHW ++                                 I   AVKE  +E+ LKE+ + W    F        G  LL+  ++ ELI +LE+  + L ++M S Y + F  ++  W + LS    +I+ W  VQ  W +LE++F+G D I KQLP++++ F  ID  + K +    E    V    G   + + L  +  +L  C+K+L  YLE KRL FPRF+FVS   LL+IL   +    +  HL  +FD++  ++F ++ +       +A+ +++ E +E        G VE WLN LL+E + ++  V+ ++  +++ +  +   ++  F AQV L   Q+ W   +E  L+ A  + G    +   N+  +  LN LI +   +L   +R K  T+ TI VH RD+   L    IDN   F WL Q R  + +      INI D  F Y +E+LG T RLVITPLTD                            T KD+GR LG  V VFNCS+QMD++ +G I+K LAQSGSWGCFDEFNRI + VLSV A Q+  +    K++ K F F  G+ + ++   GIF+TMNPGYAGR ELPENLK  FR  +M+VPD ++I  + L + GF+    LA KF TLY+LC+E LSKQ HYD+GLR I SVL   GA KR++P   E  ++ R L+D N+ K++ +D  +F+ LI DLFP +++ ++  PE E  + +   +  L     + LKV+Q+ E   VRH +  LG +G+GK+   + L+K  +   +    + +NPKA+T  ++FG ++ +T +W DG+FS + R       +   WIVLDG +D +WIE+LN+V+DDN+ LTLA+ +RIP+ P  +++FE  ++  A+PATVSR G+++++   LGW P +  W+  R   E +  +   +  F +     +++L+ +   +   V +  + ML  L+ +    +    + P+E  E  ++F  +W+ G+ +  +      + F    V      ++P   + T+FDYY+  E   +  W+ R+ +  +  D+     ++LVP  +  R  + +D + ++ + V+L+G  GT KTV+++  ++       +   + F+  TT  M QR +E  ++K+ G  YGP   KK+   IDD+NMP V+++     + ++RQ ++   +Y+  K      I + Q+LA M +P  G   I  RL+R F +F  + P   S+  I+  ++ E        F   + +T+  LV L            LPT  KFHY+FNLRDLS I+QG+L    + I     L+ LW HE +RV  D+    +D+E + Q L K + ++  EE  ++V       +  F +   E            PK Y P+E  E L   L   L  YN+      M++V F+DA+ H+++++RI+ +P G ALLVGVGGSGKQSL+RLA+FI+   +FQITL   Y   +L  DL +LY  AG +  G+ F+ TD +I +E FL  +N++L+SGE+ +LF  +EM+ I+S +   +K        + EN + +F+++VR  L +VLCFSPVG   R RA KFPA+++  ++DWF  WP+DAL+  SH FL   +++  P+  K    + M      V +  + Y  N                                       GLQKL+  ++ V  L  +L  +E EL+  N  A+ +L++V    K  +SE    +V+  ++K   I   ++  +   E  L  A PAL+ A+ AL T+  +++  +++   PPP ++  +  C+ L+      P +          SW+ +   +M    +FL  L  + KD I E +++  + Y   PN+N E  ++ S   AGL SW   + +++ I  +V P +  L      L  A   L   Q ++   + +L  ++ E+E+A ++K    ++A    + +++A+ L+ GLA E  RW +Q +++  + K L  DVL+  AFLSY G F + +R  L++  W   L   +  IP   NLD  ++L+D + ++ WN                                            L++  L  K + + +E+++S G  +LIE++ E +DPVLD++L +N IK G    +K+GDKE +    F+L + TKL NP Y PE+ A+T+II+FTVT  GLEDQLL  V+  E+  L                                    + D +L+  L N K+TA E+ +K++ A  T++ IN  RE YRP A R S+LYF++ +++ +N MYQ SL  F  +F+ ++  ++ S     R++++I+ +TF VY Y +RGL+E+ K +FT  ++ +I +  K +   E   L++   +   T    P +++ + SW  +  LS L +F   LD+ I    K WK + + E PE+E  P  +++    +RL ++R   PDR     A  ++ + +G KY EG  ++   ++EES P TP+   LS G DP   +  LGKKL         R +S+GQGQE+ A K +      G W +LQN HL   +            E  ++S+R++I+ E   +      P  +L+ +IK TNEPP G+ A L ++    NQ+ +++ +  N++K +L+ + + H+ V ERRKFGP GWN  Y FN  D   +V  + N+L   +    V W  ++Y+ GEI YGG +TDD+D++L  T+ + +    M + + N   G+ +P  +    Y  YI + LPA ++P ++GLHPNA+I F +  +  +  T+  +QP+DSS  G  G +RE  + ++ DD++EKLP D+   EIQ +   ++  P     +   QE +RM  +   +R +L +L L + G + ++ ++    + +Y   IP  W K+   +   L  W+ +LL R ++ + W    + P+  W+ G FNPQ FLTA+ Q++AR N+ W LDRM L  +VTK  K+D+  PP  G YV+GL++EGA WD  +  + E+K K L   MPVI++ A   + +D R +Y+CP+YK   R     + +  LKT + P  W
Sbjct:  405 FKPILMSMKNKSYSFLDHSATNFETDFEQFCKRTSELHRQLEKFMNDTIENIQDTQRALDVLHQFERL---GIPDLGTDTKYQDILLKYGQDIE---WVSDIF--EKEKLDPPFERDLPPMAGRIMWARILSRRITDPM---------------------------------------NFFQQVTD-ARLGLEATLLVRLGETGELFVNFDPELLIQIMETNCMARMNLK-IPPFAAVLQQKEYTLKK--NNSQMQVDEAIQPGLTYLTWTSLNIDKYLRDTKKALDLELLMNRVNDLVEYRIDTILQEMSMVTLCVLPE--DNPV-----TCEELVHTTRELCKKQAQNLH---------YKSMLVEKAANELINML-MDEHQSEGHLISKTTLPQSGSTGPSPSLVKRKKKMDLKDVMEEEAQKLLSHFNHRNLDALLKMTRNTLEMLRKHFSQA---VFRVDVVLSIPDIVINPALEK-VQEALNQIVECVVSVSKGVGQWSK-DRLSLGKMDERCMISLEQDNSESAAEDVATTHRSLAGSISSASVIQAFPFRNYYKNVSENKE-----------VLKLVSILSSSITSTKKFNQTNPLLSKFESQIVYYQDLETKI------NSEPDYINVGALALFTLTVETMQ-WMNDYQMCCNKKYQQELEQILAIIDEAGKKLNRPIK--DLDDIRIAMAAIDKIRKDQISIELQIGPIEQESYAMLNKYKFPVQKEEGEKVETLRLYWDKLM------------FRSTEVQ------SELETLQPKFKKELESNMIVLQEECQNFYQDYDKVYTTYC----------DGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDF-QTCRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRI------------------------------TEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLM-SNYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGD-IAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLT-YLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKYDRI-----LAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRG---IMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDE---------------------------TIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMT-CGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKEHI-WIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPL----KEQCGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAE--HWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF--VIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTL-YNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVE-SHHFLSAFDIDCSPQ-VKSEVVQCMGSFQDCVAEKCVDYFMN--------------------------------------TGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVT--VKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQ-TMDCVLLLLRRRVNPVEINAETNFITSSWQES-LNLMTS-GSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRSLLLNE-WQCELKQRS--IPFGNNLDITELLIDASTVSEWN--------------------------------------------LQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKRSL------------------------------------VDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRP-ATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLASSK-SSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQQISHHEKLWKSWFDKEAPEEEVLPNSYQSLDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIET-----RYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNF-MDELMDTVIETECINDSFRLWITTEVHKN-----FPITLLQMSIKFTNEPPQGLKAGLKRTY-GINQDLLDV-SNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYI-QGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGG--GETREAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGR-PNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA-ENNVKDPR-LYSCPIYKKPTRTDINCIASVGLKTTQPPEHW 4147          
BLAST of DNAHb-1 vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1506.5 bits (3899), Expect = 0.000e+0
Identity = 938/2699 (34.75%), Postives = 1503/2699 (55.69%), Query Frame = 1
Query: 5542 TPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFL-GEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTR---EIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPA--QGTVFDYYIDTETKKFEPWTKRMTK--FEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVAN-VPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKL-TLKEIHNTQYLACM-NPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGS--NFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSD------LVRLWMHEGERVYNDKLIDDNDIETY-QRLQKELTKKAFEEMDEMVMFKKPLLYCHF----AQGIGE---------PK-YMPVERSEDLSKILKEALESYNEV--NAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKST--GMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQ--EVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKD---------RSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGA-DLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRA--IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTS----PIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYL---EANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPA-ESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNE-WPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRN-------VYACPVYKTKERGP-TFVWTFNLKTKEKPSKW 13431
            T L   CYITL Q+L + M GAPAGPAGTGKTET KD+GR LG  V VFNCS+QMD++ +G I+KGLAQSGSWGCFDEFNRI + VLSV A Q+  +    K++ K F F  G+ + ++   GIF+TMNPGYAGR ELPENLK  FR  +M+VPD ++I  + L + GF+    LA KF TLY+LC+E LSKQ HYD+GLR I SVL   GA KR++P   E  ++ R L+D N+ K++ +D  +F+ LI DLFP +++ ++  PE E  + +   +  L     + LKV+Q+ E   VRH +  LG +G+GK+   + L+K  +   +    + +NPKA+T  ++FG ++ +T +W DG+FS + R           WIVLDG +D +WIE+LN+V+DDN+ LTLA+ +RIP+ P  +++FE  ++  A+PATVSR G+++++   LGW P +  W+  R   E +  +   +  F +     +++L+ +   +   V +  + ML       L+P        +    LY +F  +W+ G+ +  +      + F    V      ++P   + T+FDYY+  E   +  W+ R+ +  +  D+     ++LVP  +  R  + +D + ++ + V+L+G  GT KTV+++  ++       +   + F+  TT  M QR +E  ++K+ G  YGP   KK+   IDD+NMP V+++     + ++RQ ++   +Y+  K      I + Q+LA M +P  G   I  RL+R F +F  + P   S+  I+  I      +   F   + +T+  LV L            LPT  KFHY+FNLRDLS I+QG+L     C    S       L+ LW HE +RV  D+    +D+E + Q L K + ++  EE  ++V       +  F     +  GE         PK Y P+E  E L   L   L  YN+      M++V F+DA+ H+++++RI+ +P G ALLVGVGGSGKQSL+RLA+FI+   +FQITL +   +  L   L +LY  AG +  G+ F+ TD +I +E FL  +N++L+SGE+ +LF  +EM+ I+S +   +K        + EN + +F+++VR  L +VLCFSPVG   R RA KFPA+++  ++DWF  WP+DAL+ VSH FL   +++  P+  K    + M      V +  + Y    RR  + TPKS+L  I  Y  +  +K  E+Q   +R+  GLQKL+  ++ V  L  +L  +E EL+  N  A+ +L++V    +     K      ++K   I   ++  +   E  L  A PAL+ A+ AL T+  +++  +++   PPP ++  +  C+ L+      P +          SW+ +   +M    +FL  L  + KD I E +++  + Y   PN+N E  ++ S   AGL SW   + +++ I  +V P +  L      L  A   L   Q ++   + +L  ++ E+E+A ++K    ++A    + +++A+ L+ GLA E  RW +Q +++  + K L GDVL+  AFLSY G F + +R  L++  W   L   +  IP   NLD  ++L+D + ++ WN +GLP+D +SI N  I+T A R+PL+IDPQ QG  WIK +    +L++  L  K + + +E+++S G  +LIE++ E +DPVLD++L +N IK G    +K+GDKE +    F+L + TKL NP Y PE+ A+T+II+FTVT  GLEDQLL  V+  E+ ++E  + DL +     K  +KELED+LL+RL++ +G+ + D +L+  L N K+TA E+ +K++ A  T++ IN  RE YRP A R S+LYF++ +++ +N MYQ SL  F  +F+ ++ R+  S     R++++I+ +TF VY Y +RGL+E+ K +FT  ++ +I +  K +   E   L++     +L +    P +++ + SW  +  LS L +F  +   +    K WK + + E PE+E  P  +++    +RL ++R   PDR       ++ + +G KY EG  ++   ++EES P TP+   LS G DP   +  LGKKL         R +S+GQGQE+ A K +      G W +LQN HL   +            E  ++S+R++I+ E   +      P  +L+ +IK TNEPP G+ A L ++    NQ+ +++ +  N++K +L+ + + H+ V ERRKFGP GWN  Y FN  D   +V  + N+L   +    V W  ++Y+ GEI YGG +TDD+D++L  T+ + +    M + + N   G+ +P  +    Y  YI + LPA ++P ++GLHPNA+I F +  +  +  T+  +QP+DSS  G  G +RE  + ++ DD++EKLP D+   E++         P  +   QE +RM  +   +R +L +L L + G + ++ ++    + +Y   IP  W K ++ S   L  W+ +LL R ++ + W    + P+  W+ G FNPQ FLTA+ Q++AR N+ W LDRM L  +VTK  K+D+  PP  G YV+GL++EGA WD  +  + E+K K L   MPVI++ A      + +        +Y+CP+YK   R     + +  LKT + P  W
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQG-----LIPLKVRLKLNQHLERLY-IFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAE-GHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGML-----CTNHSSRNIIFQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQ-VKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQ-TMDCVLLLLRRRVNPVEINAETNFITSSWQES-LNLMTS-GSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNE-WQCELKQRS--IPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPNSYQSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIET-----RYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNF-MDELMDTVIETECINDSFRLWITTEVHKN-----FPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDV-SNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYI-QGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGG--GETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWAS-STLGFWFTELLERNRQFQTWLFKGR-PNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRTDINCIASVGLKTTQPPEHW 2675          
BLAST of DNAHb-1 vs. Planmine SMEST
Match: SMESG000072113.1 (SMESG000072113.1)

HSP 1 Score: 5854.25 bits (15186), Expect = 0.000e+0
Identity = 2976/2982 (99.80%), Postives = 2976/2982 (99.80%), Query Frame = 1
Query: 1798 MPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDG 10743
            MPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNLVVKKHDELLELLKKHEMKYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSD    GAW YIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNTKKVAVTVKQTVAPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEV VPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALVTEVEETTNVVKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSLAKLKFLKEAEEENTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTVLSESVSSVEEKSRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISVEVLSVVAVQVKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDLAKAEPALQAAQEALNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDALEAANEELREATEKLSGIQNKIKQLEDQLQKLQDEFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDG
Sbjct:    1 MPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNLVVKKHDELLELLKKHEMKYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSD----GAWHYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNTKKVAVTVKQTVAPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVNVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALVTEVEETTNVVKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSLAKLKFLKEAEEENTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTVLSESVSSVEEKSRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISVEVLSVVAVQVKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDLAKAEPALQAAQEALNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDALEAANEELREATEKLSGIQNKIKQLEDQLQKLQDEFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDG 2978          
BLAST of DNAHb-1 vs. Planmine SMEST
Match: SMESG000050247.1 (SMESG000050247.1)

HSP 1 Score: 5257.57 bits (13637), Expect = 0.000e+0
Identity = 2680/4528 (59.19%), Postives = 3432/4528 (75.80%), Query Frame = 1
Query:   46 LPYLIMASELEL-NDKRGEFIGDYVLKSLKQKSDKFLKLWNTDETKQMMLDFFEKPEIQHLFVLQAPGGGALNLQNEFPTNLKSKA-CFFTKK--AKESISRDAAFNKV---LIFGDISYTPLDQFSSFVDEVILPVLSNAKNQESWPSVISSDVIRHTNSLKHQTDVVLGQSKGKTLLPLP-VGSEKVSEG-DINSFGEVP--RSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIEQVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYF-KDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLETDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYD---IHVS--GNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFISVNFDTKLQAVLREVKYLKILD--------QEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEGKYDTLLNLDDREDRCNKRYKEITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEG--SKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSLVTDIFKQASKVKRLAIGSSME--DYRTDLEENEELQKKRNEI-SERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEEIEKMNGFN-IIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLDRKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGITLLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXN----TKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXXXXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIK-----------NKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPEN--TPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSI---GDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTIL-----SEKLGSNFSASL--LKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKA----FEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALE--EFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXX--XXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            +P    A E E+  DKR  F  + ++K+   + DK+ K   T++ ++ +L  F+K  +  +F L +   G +++  +FP NLKS   CF+  K  + + I  DA+  ++     +G+     L +   F+++V + +L+N KN E W +   +D+ ++   L+ +  + LG+S+ + +LP P V  EK  E   ++     P  R ++Y  ET+VIEW HQID  LS  S++ L++  +  P+ E+++WK +   L+ IY+QL   KVKKMA +LE  +S Y   FK +F  VV  L ES  I L + P++NQLE  +Q +F      IDP+FHV+CL WA+CK YR+PERI+VL +EI NLII  C +YL P+EIFK E E++LEK+++SLKILN FKE +  ++E +++   K  A+P  W+F S LIF + N+ +  I  ++ ILN    F+KLEK+E SG++G  LSQ + ++ + F   +K F E TY+ ++P+E  F  DY KF   +D   + L T    A  DC+  +   KL+++F  L D   +    +  +F+L+K++D E++  K +Y+   IH+   G+ +V    KN+P+++G + W +++R+++     +   L  + F++    +V +K +E L+LL++ ++  Y  W   VD     +L  PLLIR +D  FIS+NFD+KL+A L++ KY++I +        ++ IP     I+S+ND  RKY+ +L   VE YN +  + +  E  LIEN+L +ID +LE + T + WN+    +  W YI +V   V  L ++++KSK N+ +I  +M++  +  L+ RKE K++T+LNL+DR +R  K Y EI + G ++  LV+EN ELL+ + + E W  Y++ I++++V+     +   L Y++++ E   +  P F   M+LQ  E+ F PSL  + ++N  +L DS++ DIF+Q   +KR  I   M   DY+ +LE  E L + R+ + ++        A  Y+ KF  YS LWT + +EF+ QFL YG+ +S EEL       +   EE PP+L+Q+K QI+ +E+ FE +      N I + W ++D R FK+A LNT+KRWSLMFK+HL+D V NSL +L  FIK T+ GL+ E  E D+ GLV +MG++    ERQ   D+MFEPL++ ID+LKTYNQ++P  V++Q+EELPEKWNNTKK++VTV+Q + PL+  EV+ IR +   F+ KQ   +E  + M+ F ++C   Y  +D+ H  +  LE     L E+  LF+  + EFKQLK  R++L LLK LWD I+ +  SI  W+ T WK ++V++MD +CK FAK +R+++  +R W+A+ G E ++KNMM+SL AV  L +P IRDRHWAQLM AT V F MNE+ TL DLL L LH FEDEV +I+E+A KE  ME  L  L  TWS ME EHE HSRT I LLK +EE++E LE++Q +LQN++ SK+ ++F  EV  W   LSTADQV+ ++ EV R+W+ LESIFIG++DIR QLPE S+RFD ID DFK L+ +V  T NVV+AT    L ERLE +QS+L  CEKAL +Y+ETKRL FPRFYFVS  DLLDILS+GN PEIVMKHLTKLFDS+AKLKF    + EN     K  + MY+KDGE V+F     L G+VE WL RLL+  R+TMR  LSE+V+  EEK RDQW+FEFPAQVALS+SQI W +E  L+F RLEEG+ENALKDFNKKQI  LNALIT+L+ +LS +DRQK+MTICTIDVHNRDVV KLI QK++N+++FTWL QLRHRW DT KDC +NICDA+F Y HEYLGNTPRLVITPLTDRCYITLTQSLHL MSGAPAGPAGTGKTETTKDLGRALG+MVYV+NCSEQMDYKSIGNIYKGLAQ G+WGCFDEFNRISVEVLSVVAVQVKCIQDA+K           ++   F FLGE IS+   +GIFITMNPGYAGRTELPENLKALFRPCAMVVPDF+LICEIMLVAEGFL+AR+LARKFITLY LC+ELLSKQDHYDWGLRAIKSVLVVAG LKR+D +RPEDQVLMRALRDFN PKIVTDD P+FMGLIGDLFPALDVPRKR+ EFE  ++QA L+  LQ E+NF+LKVVQLQELF VRHSVF++GNAGTGK+ VW+TL +TY    +KP+A+D+NPKAVTNDELFGIINP+TREWKDGLFSV+MRDLAN+  DGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTP+MRLLFEISHLKTATPATVSRAGILYINP DLGWQPFV SWI+ RE Q+EQANLT+LFDKYVP+CL+A+K +F+KITP+ EIS V+MLC LL+ LL P+N     D  KE YELYFVFC +WAFG C FQDQL+DHR+EF++W+ TEFK +K P    VFD +ID  +KKFEPW K++ +FE++ E PLQ+ LV T+ET R +YFLDLLI K+ PVMLVG AGTGKTVL+QDKL S+    D+Y+VANVPFNFYTTS MLQRVLEKPLEKKAG+NYGP G+++LIYF+DD+NMPEVDKYFTVQPHTL+RQH+DY+HWYDR KLT KE+HNT Y+ACMNPTAGSF+++PRLQRHFC+FA+SFPG+E+L+ IY++IL     SE+ G  FS  L  +     LV  AL    +I S FLPTAIKFHY FNLRDLSNIFQGILF+ PDC+K    L RLW+HE ERVY DK +DD+D+  YQ++ KE  KK     +   DE  ++K+PLLYCH+A+ IG+ +YM VE  + + KIL EALE+YNE NAAMNLVLF+DA+ H+LRI+RILESPRG ALL+GVGGSGKQSLSRL+A++SSL+VFQ+TLRKGYGI +LK DL  LY+K G KNIG VFLLTDAQIADEKFLVLVNDLLASGEI DLFPDD++ENI +S+RNEVK+ G+ D++ENCW FF+ +V+ TL+++LCFSPVG TLRVRARKFPA+V CT+IDWFHEWPE ALISVS RFL++  LL ++ KDST++F++F  K+VN++S +YL N+RRYNYTTPKSFLEQI+LY N+L++K+TEL  K+ RLENGL KLESTA+QVD LK+KLA QE E+E++ + A++LL  ++ D ++V  EK  AD E+EKVSKI+ EV+KK+ DC  DLAKAEPAL AAQ ALNTLNK+NLTEMKSF  PPP V+ V  A MCLMA  GK+P+DR WKAAK   MGK+D FLD LINY+KDNI + SLK  KEY   P+F P+ +++KS AAAGLC+WVIN++ Y E++ +VKPKRDAL AA  EL+ A++KL+ I+ K+  LE  L  L  ++  A++  Q+ Q EAD T KTIELANRLV GLASEN RW  QV + KI+ KTLPGDVLV  AF+SYVG FTK YR+ L++ +W PF++N    IPI++NLDP+ +LVDDAIIA W+NEGLP+DRMSIENA I+   ERWPL++DPQLQ +KWIK ++G  LK VRL +K YLD IE++++AGD++LIENI ES+DPVLD LLGR TIKKGRAIK+GDKE ++NP+F+LILQTKLANPHYKPEMQAQTT+INFTVTRDGLEDQLLA+VV KE+ +LE +K +L + QNQFKITL ELED+LL +LS+AEGNFLG+Y LVENLE NK TA++IE+KV++ K  E+ IN TR  +R  A RAS+++FI+NDL KINPMYQFSLKAF VVFE AIDRA+ SE+ K RV N++DS+T+ +Y+YT+RGLFEKDKLIFT QM+ QILL   +++  ELDFLLR P++PNLTSP+DF+++  WGGIKAL A+E  EFKNLD DI GSAKRWKKFVESE PEKEKFPQ+WKNK+++Q+LCMMR LRPDRM YA+ DF+ E LG KY EG  VEF +SFEE+  +TPIFFILSPGVDPLK VE+LGKKLGF+  N NF NISLGQGQE+VAE+A+ L ++ GHW+VLQN+HLVSKWL+ LE+ +E  +E   +++  R+FISAEP+G PE+HIIPQGILE ++KITNEPPTGM AN+HK+L NF+QET+E C+K+ EF+ ILFALCYFHAVV +R KFG  GWNRSYPFN GDL IS++VLYNYLEANSKVPW DLRYLFGEIMYGGHITDDWDR+LC+++LEEY+QPE ++G+L + PGFK+PP  D+ GY NYIDE LP ESP LYGLHPNAEIEFL +   +LF+ VFEMQPRD+SG  + G  +EE++K ILD+ MEK+P+ FNMVE+ AKVPPEER P+VVVA QECER N+L SE++RSLKELDLGLKGELT ++++E+LS SL++D +P SWS +AYPSL  L LWY DL  R+++LEIW +DF LP+ +WL GLFNPQSFLTA+MQQMARKNEWPLDRM +Q DVTKK +E++GG PR+GA++HGLFM+GA+WD+QSG IAEA+L +L P+MPVIFIKAIPVDRQDLR+ YACPVYKTK+RGPTFVWTFN+KTKE+P +W
Sbjct:    1 MPQTSAAPEEEVVKDKRLSFFENLIIKTFGIREDKWEKFLLTEDNRKNLLKLFDKASLNQVFFLLS-STGTISISVDFPQNLKSIVKCFYFLKNNSDDVILPDASVKEIKNAFGYGEFDGNCLIELPVFLEKVAINLLTNEKNCEDWSTSTMNDIKKNITKLERELKIFLGKSQNQIVLPFPEVIDEKSHETFTLHELRSNPNLRRLVYNFETIVIEWTHQIDKQLSTSSADILISNPDALPYEEIEFWKNKQKRLQKIYDQLYQSKVKKMAEVLEITNSVYYDSFKKLFTDVVRDLIESDEITLNIEPIKNQLETYQQQDFDLSVNYIDPIFHVVCLFWANCKYYRIPERIIVLMREICNLIIEQCQAYLVPEEIFKSEVEDSLEKIKKSLKILNLFKEKYFIYKENLEKLCSKTKAKPDRWEFDSELIFSKFNAVIKNINKIEEILNIVTTFSKLEKIEFSGVRGGILSQEVQNISKRFNENYKIFVESTYNPMNPIEEQFFADYGKFMTEVDTFHKELKTIYLFAIEDCNNLECGLKLLNLFMVLNDNEEISNAIESSHFDLLKLMDSEIDLSKSIYEYQKIHLKKFGHYEV---GKNLPQISGSIHWSEQLRKKLTKLYNMILFLCPKFFESQNGAIVHRKLNEFLKLLQEFDLNIYKGWSKTVDNNSKQSLENPLLIR-LDNNFISINFDSKLEAALKDTKYIQIHNDSIDDSNRKQTIPSDIVHIYSENDKWRKYLVSLLNTVEQYNKIISSVIYFEFGLIENDLIKIDNKLENSFTIMKWNT----SDVWNYINEVGIEVERLYNKLMKSKANLLSIIDLMNDLGRQRLYSRKESKHETMLNLEDRTERIAKSYSEIEQVGLKIEQLVQENCELLQGNQMKESWDIYLERINEIVVDGLNRLVEKDLNYLLEETENKETNPPFFICRMELQLPEVKFVPSLQMEQSENLYDLFDSILADIFRQGKYIKRF-IPDEMNSADYQAELEVLENLNELRSRLLNDHIAPTMVLAGQYKDKFASYSYLWTHDTDEFLRQFLTYGRQVSVEEL-------VEGIEENPPSLEQYKEQINSFEQLFETLSSETDSNAIFNSWLKLDVRPFKEALLNTVKRWSLMFKKHLVDQVINSLNDLENFIKTTDKGLSYELKENDYHGLVLVMGYIQAQNERQSMYDQMFEPLQKIIDILKTYNQDIPPNVYVQMEELPEKWNNTKKISVTVRQAIEPLKTSEVSRIRTQSTEFESKQLEIKESMKAMNAFEYNCPNPYNQIDKFHKHLYELELEASGLLEAGKLFDFKISEFKQLKLARRDLSLLKNLWDIIHSIKFSITDWQTTPWKQVDVDKMDMNCKKFAKDLRAMESIVRQWNAFIGSELEVKNMMSSLHAVAMLSDPTIRDRHWAQLMRATGVHFQMNENVTLADLLSLKLHRFEDEVSNILEQANKEKVMEDTLNTLQVTWSTMELEHEVHSRTQIILLKINEEIMENLEDNQSQLQNLLMSKHNAYFLTEVKDWLNKLSTADQVLSMYMEVSRSWTSLESIFIGTEDIRVQLPESSQRFDGIDKDFKLLLNDVTGTKNVVEATSVNGLSERLETIQSQLGECEKALMDYMETKRLGFPRFYFVSHNDLLDILSHGNEPEIVMKHLTKLFDSMAKLKFSDHDKPENKKDKIKTAITMYSKDGEKVDFHEPVLLEGRVEQWLTRLLKNKRSTMRHRLSEAVAVYEEKPRDQWLFEFPAQVALSNSQIGWASETQLAFQRLEEGFENALKDFNKKQINNLNALITMLVKDLSGEDRQKIMTICTIDVHNRDVVAKLINQKVENAEAFTWLSQLRHRWDDTKKDCLVNICDAEFLYYHEYLGNTPRLVITPLTDRCYITLTQSLHLFMSGAPAGPAGTGKTETTKDLGRALGMMVYVYNCSEQMDYKSIGNIYKGLAQCGAWGCFDEFNRISVEVLSVVAVQVKCIQDALKGLTHEQMQGSDDEYTTFKFLGETISIAPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFDLICEIMLVAEGFLEARLLARKFITLYNLCRELLSKQDHYDWGLRAIKSVLVVAGGLKRNDRERPEDQVLMRALRDFNTPKIVTDDLPIFMGLIGDLFPALDVPRKRNSEFEAEIKQAVLENHLQPEDNFILKVVQLQELFDVRHSVFIVGNAGTGKTNVWRTLNRTYKRANRKPIAIDINPKAVTNDELFGIINPATREWKDGLFSVVMRDLANIPHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPSMRLLFEISHLKTATPATVSRAGILYINPTDLGWQPFVTSWINKREAQTEQANLTVLFDKYVPMCLDAMKSKFQKITPVPEISQVEMLCRLLDCLLTPDNGIVANDASKELYELYFVFCIVWAFGGCTFQDQLIDHRLEFSRWFTTEFKFVKFPKDALVFDVFIDPASKKFEPWQKKVPQFELNSEIPLQSTLVYTNETVRLKYFLDLLIAKKHPVMLVGNAGTGKTVLMQDKLRSLVETTDSYMVANVPFNFYTTSAMLQRVLEKPLEKKAGKNYGPPGNRQLIYFVDDLNMPEVDKYFTVQPHTLMRQHLDYNHWYDRTKLTPKEVHNTLYVACMNPTAGSFSVNPRLQRHFCLFAMSFPGEEALETIYASILNQHLLSEQSGQEFSVELKRMHVAKELVSCALTLQQRITSNFLPTAIKFHYTFNLRDLSNIFQGILFSTPDCVKNKQALARLWLHECERVYCDKFVDDDDLVKYQQIVKETAKKHLSDWYSNGDEE-LWKQPLLYCHYARHIGDERYMAVESLDGIKKILTEALETYNETNAAMNLVLFQDAIQHVLRISRILESPRGNALLIGVGGSGKQSLSRLSAYLSSLEVFQVTLRKGYGIAELKQDLGQLYIKTGQKNIGTVFLLTDAQIADEKFLVLVNDLLASGEITDLFPDDDVENICNSLRNEVKAQGIQDTKENCWRFFLERVQKTLKVILCFSPVGMTLRVRARKFPALVTCTNIDWFHEWPEQALISVSRRFLEDFRLLDDNLKDSTSEFLAFAQKSVNEMSATYLTNDRRYNYTTPKSFLEQISLYENLLEQKNTELLAKIERLENGLTKLESTAEQVDALKSKLADQEEEVEKRKSDASKLLVTLSQDAERVQKEKEFADQEDEKVSKIQVEVNKKRNDCAADLAKAEPALLAAQAALNTLNKDNLTEMKSFAQPPPIVVTVMGAVMCLMAPGGKLPRDRGWKAAKVA-MGKVDQFLDALINYDKDNIHDNSLKGTKEYLSKPDFEPDNVRTKSAAAAGLCAWVINVVLYNEVYKEVKPKRDALLAAETELKAASDKLAVIREKVADLEKALDLLNAQYTDAQNKMQQVQQEADQTVKTIELANRLVNGLASENDRWNLQVAEMKIQAKTLPGDVLVAAAFISYVGYFTKQYRIDLLEKHWFPFMSNQKVKIPISENLDPIVILVDDAIIAGWSNEGLPTDRMSIENAAIMERCERWPLLVDPQLQAMKWIKKKYGDHLKTVRLDRKRYLDTIEESITAGDILLIENIGESIDPVLDPLLGRMTIKKGRAIKIGDKEIDFNPKFKLILQTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLASVVQKEKPELEEIKSELMRSQNQFKITLTELEDALLEKLSSAEGNFLGNYVLVENLETNKATALDIEKKVKEGKEAEIMINATRNQFRVCATRASLVFFIMNDLYKINPMYQFSLKAFTVVFESAIDRADYSEDEKERVMNILDSVTYMLYVYTTRGLFEKDKLIFTTQMTLQILLNASQVDISELDFLLRLPVIPNLTSPVDFITHVGWGGIKALVAMESNEFKNLDNDIVGSAKRWKKFVESEAPEKEKFPQDWKNKSAIQKLCMMRVLRPDRMIYAIKDFISENLGAKYAEGRQVEFVKSFEEATSSTPIFFILSPGVDPLKSVESLGKKLGFTTANSNFHNISLGQGQEVVAEEALKLSSENGHWIVLQNVHLVSKWLATLERIIESISEDPNTNQQCRIFISAEPAGIPENHIIPQGILEASVKITNEPPTGMYANIHKALANFDQETLEKCSKQVEFQAILFALCYFHAVVCQRSKFGAIGWNRSYPFNNGDLTISIDVLYNYLEANSKVPWVDLRYLFGEIMYGGHITDDWDRRLCRSFLEEYMQPETVEGDLFLAPGFKIPPTLDFSGYQNYIDEMLPTESPTLYGLHPNAEIEFLNATGQELFRIVFEMQPRDTSGGQSAGTPKEEKVKSILDEFMEKMPELFNMVELLAKVPPEERTPFVVVAIQECERWNILLSEMKRSLKELDLGLKGELTFSSELESLSQSLFLDQVPTSWSNKAYPSLNPLGLWYGDLQTRVRDLEIWVSDFHLPNCVWLAGLFNPQSFLTAVMQQMARKNEWPLDRMCIQVDVTKKQREEIGGAPREGAFIHGLFMDGAQWDSQSGGIAEARLMQLCPAMPVIFIKAIPVDRQDLRSTYACPVYKTKQRGPTFVWTFNMKTKERPIRW 4509          
BLAST of DNAHb-1 vs. Planmine SMEST
Match: SMESG000069008.1 (SMESG000069008.1)

HSP 1 Score: 3317.32 bits (8600), Expect = 0.000e+0
Identity = 1624/2421 (67.08%), Postives = 1983/2421 (81.91%), Query Frame = 1
Query: 6202 EDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTRE------IQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPEN---TPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRD-SSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            ED VLMRALRDFN PKIVTDDTPVF+GLIGDLFP L+ PR+R+ +FE  VR AT DL LQ E++F+LKVVQLQELF VRHSVF++GNAGTGKS VWK+L  TY   K KP+AVDL+PKAVTNDELFGIINPSTREWKDGLFSVIMRDLANL  D PKWIVLDGDIDPMWIESLNTVMDDNK+LTLASNERIPLT +MRLLFEIS LKTATPATVSRAGILYINP DLGWQPFV+SW+  R        +SE++ L+I FDKY+P CLE ++ +FKKITPI +ISHVQMLCHLLE LL  E    +  +  KE YE++FVFC +WAFG C+F+DQL+DHR+EF+KWW+ EFK IK P+ G VFD+Y + +TKKF  W  ++TKFE+D E+PLQAVLVPT E  R  +FLDLLI   +PVML+G AGTGK+VLLQDK  ++ D ++V NVPFNFYTTSEMLQ+VLEK +EKKAG+NYGP G  +LIYFIDD+NMPEVDKYFTVQPHTLIRQH+DYSHWYDR KLTLK +H TQY+A MNPT+GSFTISPRLQRHF VFALSFP  E++K IYSTI+ +   +   S+ + + V  L +L++  H+K+ ++FLPTAIKFHY+FNLRDLSN+FQG+LFA  DC+     L+RLW HE +RVY+DK++++ D+E Y++L K    + F E+ +  + ++P L+CHF++G G+  Y PV     + +IL ++L  YNE  AAMNLVLFE+AV HILRINRILE PRG ALL+G+GGSGKQSLS+LAAFI+ LDV+Q+ LRKG+ +NDLK ++AA+Y+K+G+KN+  VFL+TDAQIADEK+LV +ND LASGEI DLFPD++++ II+ +R E K+ G+ID+ ENCW FFI+KVR +L++VLCFSPVG+T+RVRAR+FPA+VNCT IDWFHEWP DAL+SVS RFL E+EL  ++ KDS +++M+F H  VN +S  YL  +RR+NYTTPKSFLEQI L+  +L+ +  E++ K+SRL NGL++L+  ++Q  DLK +LA QEV + +K  +ANEL+  V  +T+KV +EK IA  EE KV+ IK EV KKQ++CERDLAKAEPAL AAQEALNTLNKNNL+E+K+ GTPPP V+ V  A M L A++GK+P+DRSWKAAKAG M K+D FL +LINY+K+NI   S  AA+ Y K P+F P+ I+ KS AAAGLC+WVINI+ +++++C+VKPKRDALEAANEELR A+EKL  IQ KI  LE  L+ L  +F+ A  +K RCQ+EAD T KT++LANRLV G ASEN+RW  QV++ +    T+PGDVL+T +F+SY G FTK YR+ L++    PFL      IPI  N+DPL++LVDDAI+A+W+NE LP+DRMS+ENATIL+  ERWPL+IDPQLQ IKWIKT++G DL VVRL QKGYL+ IE+A+S+G VVL+ENI E MDPVLD ++GR TIKKGRAIK+GDKE  YN  FRLILQTKLANPHYKPEMQAQTT+INFTVTRDGLEDQLLA VV+KER DLE LK DLT QQN FKITLK LEDSLL +L++++GNFLGD++LVENLE+NK+TA EIEEKV +AK+TE  IN  RE YRP AARAS++YFI+NDL KINPMYQFSLKAFR+VFE+AI+ A  +E  K R  NLIDSI+FS + YT+RGLFE+DKLIFT  +  QI L +KEI+   +DFLLR+P VP+L SP+DFLS+ SWGGI AL  L EF++LD+D+  SAKRWK FVE E PEKEKFPQEWKNK+S ++LCMMRALRPDRMTYA+  ++    G KY+EG  +EF++S++ESGPA PIFFILSPGVDPLKDVE LG+ +GFS D  NF NISLGQGQEIVAE+A+D GA +G WVVLQN+HLV+KWL+ LEKKLE+Y+E+S+E+YRVF+SAEP+GSPE HIIPQGILENAIKITNEPPTGM ANLHK+L+NFNQET+E C KE+EFK ILF+LCYFHAVV+ERRKFG QGWNR+YPFN GDL I V+VL+NYLEAN KVPWEDLRYLFGEIMYGGHITDDWDR LC+TYL+E++QPE+L+G+L    GF VPPN+DYKGYH YIDE LP ESPYLYGLHPNAEIEFLT+ S+++F+TVFEMQPRD  +GAG T  SREE +  ++D+++EK P+ FNM E+Q K  PEER PY VV  QECERMN+L +EI+RSLKEL LGLKGELTIT+DME L NSL++D +P SW + AYPSL  L LW+AD+L+RIKEL+ W  DF LP  +WL GLFNPQSFLTA+MQQ ARKN+WPLDRM + CDVTKK +E+MG  PR+GAYVHGLF+EGARWD Q+G+I +AKLKEL P +PVIF+KAIPVDRQDLR  YACPVYKTK RGPT+VWTFNLKTK+K SKW
Sbjct:    3 EDSVLMRALRDFNTPKIVTDDTPVFLGLIGDLFPQLNAPRQRNLKFETDVRSATEDLGLQPEDSFILKVVQLQELFNVRHSVFIVGNAGTGKSQVWKSLHNTYKLQKMKPIAVDLDPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLAHDDPKWIVLDGDIDPMWIESLNTVMDDNKILTLASNERIPLTKSMRLLFEISQLKTATPATVSRAGILYINPGDLGWQPFVHSWLDERVKSQKVLSRSERSALSICFDKYIPPCLEGVRSKFKKITPIPDISHVQMLCHLLECLLDQEKQLKSTTELTKEGYEMFFVFCCVWAFGGCLFKDQLIDHRLEFSKWWLNEFKQIKFPSSGGVFDFYFNVKTKKFTSWQTKVTKFELDPEKPLQAVLVPTVEVARISFFLDLLIPVGKPVMLIGSAGTGKSVLLQDKFENLPDKFIVKNVPFNFYTTSEMLQQVLEKSIEKKAGKNYGPPGQSQLIYFIDDLNMPEVDKYFTVQPHTLIRQHLDYSHWYDRHKLTLKIVHKTQYIAAMNPTSGSFTISPRLQRHFAVFALSFPNDEAVKTIYSTIIRQHFAAQKVSSQIARYVDQLAELSVFVHHKVAASFLPTAIKFHYIFNLRDLSNLFQGLLFATVDCLTSQVQLLRLWKHEAQRVYSDKMVEEADLELYRKLVKISIGQVFPELGDGSVHEEPNLFCHFSKGTGDKVYGPVIEYNKIVEILTDSLNLYNETFAAMNLVLFENAVCHILRINRILEMPRGNALLIGIGGSGKQSLSKLAAFIAGLDVYQLVLRKGFTMNDLKNEMAAIYLKSGLKNMPTVFLMTDAQIADEKYLVYINDFLASGEIPDLFPDEDVDQIITGVRGECKAYGIIDTNENCWKFFIDKVRKSLKVVLCFSPVGNTIRVRARRFPALVNCTCIDWFHEWPYDALLSVSRRFLDELEL-EDNIKDSISEYMAFGHTTVNDISQQYLAKDRRFNYTTPKSFLEQIDLFKKLLRNRDDEIKLKISRLVNGLERLKDASEQTKDLKVQLADQEVVVAEKTQAANELIVVVGNETEKVRAEKEIAAGEESKVAVIKKEVEKKQRECERDLAKAEPALVAAQEALNTLNKNNLSELKALGTPPPDVVLVGQAVMVLFASDGKLPRDRSWKAAKAGPMSKVDQFLSSLINYDKENIHPVSKAAAQVYLKSPSFQPDIIRGKSFAAAGLCAWVINILKFHDVYCEVKPKRDALEAANEELRAASEKLEVIQKKISHLEASLEVLTSQFKAATDEKLRCQEEADFTAKTLDLANRLVNGFASENIRWANQVQELEEIANTVPGDVLITTSFISYFGYFTKFYRVQLLNEKMWPFLKEQKVRIPIRDNIDPLELLVDDAIVATWSNENLPTDRMSVENATILSFCERWPLMIDPQLQAIKWIKTKYGDDLIVVRLNQKGYLEKIEKAISSGGVVLLENISEEMDPVLDPVIGRQTIKKGRAIKMGDKEISYNENFRLILQTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAVVVSKERPDLEKLKSDLTTQQNTFKITLKALEDSLLAKLASSDGNFLGDHSLVENLESNKKTAKEIEEKVIEAKVTEKQINIAREFYRPNAARASLIYFIMNDLYKINPMYQFSLKAFRIVFEQAIENAVEAETEKERFANLIDSISFSAFNYTTRGLFEQDKLIFTVLIVLQIQLLSKEISSKLVDFLLRYPAVPDLKSPVDFLSDLSWGGIHALIKLPEFRDLDKDVVASAKRWKAFVEIEAPEKEKFPQEWKNKSSFEKLCMMRALRPDRMTYALRHYIANTFGAKYIEGRSIEFAKSYQESGPAVPIFFILSPGVDPLKDVELLGRSIGFSTDMGNFHNISLGQGQEIVAEEALDKGAADGQWVVLQNVHLVAKWLATLEKKLEQYSEKSNENYRVFLSAEPAGSPEFHIIPQGILENAIKITNEPPTGMHANLHKALDNFNQETLERCTKESEFKPILFSLCYFHAVVTERRKFGAQGWNRTYPFNVGDLTICVDVLFNYLEANPKVPWEDLRYLFGEIMYGGHITDDWDRTLCRTYLQEFMQPELLEGDLMFAHGFAVPPNSDYKGYHTYIDENLPPESPYLYGLHPNAEIEFLTTTSERVFRTVFEMQPRDIDAGAGETA-SREEVLGNLIDELIEKSPELFNMAELQGKQAPEERTPYTVVVLQECERMNVLINEIKRSLKELKLGLKGELTITSDMEVLGNSLFLDQVPLSWDRVAYPSLNPLGLWFADMLIRIKELDAWVQDFSLPGSVWLSGLFNPQSFLTAVMQQTARKNDWPLDRMCINCDVTKKQREEMGMAPREGAYVHGLFIEGARWDPQAGVITDAKLKELAPQLPVIFLKAIPVDRQDLRVTYACPVYKTKVRGPTYVWTFNLKTKQKASKW 2421          
BLAST of DNAHb-1 vs. Planmine SMEST
Match: SMESG000069008.1 (SMESG000069008.1)

HSP 1 Score: 3311.55 bits (8585), Expect = 0.000e+0
Identity = 1620/2416 (67.05%), Postives = 1979/2416 (81.91%), Query Frame = 1
Query: 6217 MRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTRE------IQSEQANLTILFDKYVPVCLEALKLRFKKITPIVEISHVQMLCHLLEVLLVPEN---TPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAKLTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSN-FSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQRLQKELTKKAFEEMDEMVMFKKPLLYCHFAQGIGEPKYMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKMLVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGADLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIKKGRAIKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPIVPNLTSPIDFLSNNSWGGIKALSALEEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNKTSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLHKSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDGELNIVPGFKVPPNTDYKGYHNYIDECLPAESPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRD-SSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTKKNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLRNVYACPVYKTKERGPTFVWTFNLKTKEKPSKW 13431
            MRALRDFN PKIVTDDTPVF+GLIGDLFP L+ PR+R+ +FE  VR AT DL LQ E++F+LKVVQLQELF VRHSVF++GNAGTGKS VWK+L  TY   K KP+AVDL+PKAVTNDELFGIINPSTREWKDGLFSVIMRDLANL  D PKWIVLDGDIDPMWIESLNTVMDDNK+LTLASNERIPLT +MRLLFEIS LKTATPATVSRAGILYINP DLGWQPFV+SW+  R        +SE++ L+I FDKY+P CLE ++ +FKKITPI +ISHVQMLCHLLE LL  E    +  +  KE YE++FVFC +WAFG C+F+DQL+DHR+EF+KWW+ EFK IK P+ G VFD+Y + +TKKF  W  ++TKFE+D E+PLQAVLVPT E  R  +FLDLLI   +PVML+G AGTGK+VLLQDK  ++ D ++V NVPFNFYTTSEMLQ+VLEK +EKKAG+NYGP G  +LIYFIDD+NMPEVDKYFTVQPHTLIRQH+DYSHWYDR KLTLK +H TQY+A MNPT+GSFTISPRLQRHF VFALSFP  E++K IYSTI+ +   +   S+ + + V  L +L++  H+K+ ++FLPTAIKFHY+FNLRDLSN+FQG+LFA  DC+     L+RLW HE +RVY+DK++++ D+E Y++L K    + F E+ +  + ++P L+CHF++G G+  Y PV     + +IL ++L  YNE  AAMNLVLFE+AV HILRINRILE PRG ALL+G+GGSGKQSLS+LAAFI+ LDV+Q+ LRKG+ +NDLK ++AA+Y+K+G+KN+  VFL+TDAQIADEK+LV +ND LASGEI DLFPD++++ II+ +R E K+ G+ID+ ENCW FFI+KVR +L++VLCFSPVG+T+RVRAR+FPA+VNCT IDWFHEWP DAL+SVS RFL E+EL  ++ KDS +++M+F H  VN +S  YL  +RR+NYTTPKSFLEQI L+  +L+ +  E++ K+SRL NGL++L+  ++Q  DLK +LA QEV + +K  +ANEL+  V  +T+KV +EK IA  EE KV+ IK EV KKQ++CERDLAKAEPAL AAQEALNTLNKNNL+E+K+ GTPPP V+ V  A M L A++GK+P+DRSWKAAKAG M K+D FL +LINY+K+NI   S  AA+ Y K P+F P+ I+ KS AAAGLC+WVINI+ +++++C+VKPKRDALEAANEELR A+EKL  IQ KI  LE  L+ L  +F+ A  +K RCQ+EAD T KT++LANRLV G ASEN+RW  QV++ +    T+PGDVL+T +F+SY G FTK YR+ L++    PFL      IPI  N+DPL++LVDDAI+A+W+NE LP+DRMS+ENATIL+  ERWPL+IDPQLQ IKWIKT++G DL VVRL QKGYL+ IE+A+S+G VVL+ENI E MDPVLD ++GR TIKKGRAIK+GDKE  YN  FRLILQTKLANPHYKPEMQAQTT+INFTVTRDGLEDQLLA VV+KER DLE LK DLT QQN FKITLK LEDSLL +L++++GNFLGD++LVENLE+NK+TA EIEEKV +AK+TE  IN  RE YRP AARAS++YFI+NDL KINPMYQFSLKAFR+VFE+AI+ A  +E  K R  NLIDSI+FS + YT+RGLFE+DKLIFT  +  QI L +KEI+   +DFLLR+P VP+L SP+DFLS+ SWGGI AL  L EF++LD+D+  SAKRWK FVE E PEKEKFPQEWKNK+S ++LCMMRALRPDRMTYA+  ++    G KY+EG  +EF++S++ESGPA PIFFILSPGVDPLKDVE LG+ +GFS D  NF NISLGQGQEIVAE+A+D GA +G WVVLQN+HLV+KWL+ LEKKLE+Y+E+S+E+YRVF+SAEP+GSPE HIIPQGILENAIKITNEPPTGM ANLHK+L+NFNQET+E C KE+EFK ILF+LCYFHAVV+ERRKFG QGWNR+YPFN GDL I V+VL+NYLEAN KVPWEDLRYLFGEIMYGGHITDDWDR LC+TYL+E++QPE+L+G+L    GF VPPN+DYKGYH YIDE LP ESPYLYGLHPNAEIEFLT+ S+++F+TVFEMQPRD  +GAG T  SREE +  ++D+++EK P+ FNM E+Q K  PEER PY VV  QECERMN+L +EI+RSLKEL LGLKGELTIT+DME L NSL++D +P SW + AYPSL  L LW+AD+L+RIKEL+ W  DF LP  +WL GLFNPQSFLTA+MQQ ARKN+WPLDRM + CDVTKK +E+MG  PR+GAYVHGLF+EGARWD Q+G+I +AKLKEL P +PVIF+KAIPVDRQDLR  YACPVYKTK RGPT+VWTFNLKTK+K SKW
Sbjct:    1 MRALRDFNTPKIVTDDTPVFLGLIGDLFPQLNAPRQRNLKFETDVRSATEDLGLQPEDSFILKVVQLQELFNVRHSVFIVGNAGTGKSQVWKSLHNTYKLQKMKPIAVDLDPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLAHDDPKWIVLDGDIDPMWIESLNTVMDDNKILTLASNERIPLTKSMRLLFEISQLKTATPATVSRAGILYINPGDLGWQPFVHSWLDERVKSQKVLSRSERSALSICFDKYIPPCLEGVRSKFKKITPIPDISHVQMLCHLLECLLDQEKQLKSTTELTKEGYEMFFVFCCVWAFGGCLFKDQLIDHRLEFSKWWLNEFKQIKFPSSGGVFDFYFNVKTKKFTSWQTKVTKFELDPEKPLQAVLVPTVEVARISFFLDLLIPVGKPVMLIGSAGTGKSVLLQDKFENLPDKFIVKNVPFNFYTTSEMLQQVLEKSIEKKAGKNYGPPGQSQLIYFIDDLNMPEVDKYFTVQPHTLIRQHLDYSHWYDRHKLTLKIVHKTQYIAAMNPTSGSFTISPRLQRHFAVFALSFPNDEAVKTIYSTIIRQHFAAQKVSSQIARYVDQLAELSVFVHHKVAASFLPTAIKFHYIFNLRDLSNLFQGLLFATVDCLTSQVQLLRLWKHEAQRVYSDKMVEEADLELYRKLVKISIGQVFPELGDGSVHEEPNLFCHFSKGTGDKVYGPVIEYNKIVEILTDSLNLYNETFAAMNLVLFENAVCHILRINRILEMPRGNALLIGIGGSGKQSLSKLAAFIAGLDVYQLVLRKGFTMNDLKNEMAAIYLKSGLKNMPTVFLMTDAQIADEKYLVYINDFLASGEIPDLFPDEDVDQIITGVRGECKAYGIIDTNENCWKFFIDKVRKSLKVVLCFSPVGNTIRVRARRFPALVNCTCIDWFHEWPYDALLSVSRRFLDELEL-EDNIKDSISEYMAFGHTTVNDISQQYLAKDRRFNYTTPKSFLEQIDLFKKLLRNRDDEIKLKISRLVNGLERLKDASEQTKDLKVQLADQEVVVAEKTQAANELIVVVGNETEKVRAEKEIAAGEESKVAVIKKEVEKKQRECERDLAKAEPALVAAQEALNTLNKNNLSELKALGTPPPDVVLVGQAVMVLFASDGKLPRDRSWKAAKAGPMSKVDQFLSSLINYDKENIHPVSKAAAQVYLKSPSFQPDIIRGKSFAAAGLCAWVINILKFHDVYCEVKPKRDALEAANEELRAASEKLEVIQKKISHLEASLEVLTSQFKAATDEKLRCQEEADFTAKTLDLANRLVNGFASENIRWANQVQELEEIANTVPGDVLITTSFISYFGYFTKFYRVQLLNEKMWPFLKEQKVRIPIRDNIDPLELLVDDAIVATWSNENLPTDRMSVENATILSFCERWPLMIDPQLQAIKWIKTKYGDDLIVVRLNQKGYLEKIEKAISSGGVVLLENISEEMDPVLDPVIGRQTIKKGRAIKMGDKEISYNENFRLILQTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAVVVSKERPDLEKLKSDLTTQQNTFKITLKALEDSLLAKLASSDGNFLGDHSLVENLESNKKTAKEIEEKVIEAKVTEKQINIAREFYRPNAARASLIYFIMNDLYKINPMYQFSLKAFRIVFEQAIENAVEAETEKERFANLIDSISFSAFNYTTRGLFEQDKLIFTVLIVLQIQLLSKEISSKLVDFLLRYPAVPDLKSPVDFLSDLSWGGIHALIKLPEFRDLDKDVVASAKRWKAFVEIEAPEKEKFPQEWKNKSSFEKLCMMRALRPDRMTYALRHYIANTFGAKYIEGRSIEFAKSYQESGPAVPIFFILSPGVDPLKDVELLGRSIGFSTDMGNFHNISLGQGQEIVAEEALDKGAADGQWVVLQNVHLVAKWLATLEKKLEQYSEKSNENYRVFLSAEPAGSPEFHIIPQGILENAIKITNEPPTGMHANLHKALDNFNQETLERCTKESEFKPILFSLCYFHAVVTERRKFGAQGWNRTYPFNVGDLTICVDVLFNYLEANPKVPWEDLRYLFGEIMYGGHITDDWDRTLCRTYLQEFMQPELLEGDLMFAHGFAVPPNSDYKGYHTYIDENLPPESPYLYGLHPNAEIEFLTTTSERVFRTVFEMQPRDIDAGAGETA-SREEVLGNLIDELIEKSPELFNMAELQGKQAPEERTPYTVVVLQECERMNVLINEIKRSLKELKLGLKGELTITSDMEVLGNSLFLDQVPLSWDRVAYPSLNPLGLWFADMLIRIKELDAWVQDFSLPGSVWLSGLFNPQSFLTAVMQQTARKNDWPLDRMCINCDVTKKQREEMGMAPREGAYVHGLFIEGARWDPQAGVITDAKLKELAPQLPVIFLKAIPVDRQDLRVTYACPVYKTKVRGPTYVWTFNLKTKQKASKW 2414          
BLAST of DNAHb-1 vs. Planmine SMEST
Match: SMESG000051829.1 (SMESG000051829.1)

HSP 1 Score: 2210.65 bits (5727), Expect = 0.000e+0
Identity = 1466/4409 (33.25%), Postives = 2392/4409 (54.25%), Query Frame = 1
Query:  625 RSIIYAIETVVIEWAHQIDDVLSKQSSEQLMAGLNPTPFVELDYWKTRSFNLECIYEQLASPKVKKMATLLEYVDSTYAPPFKHIFKSVVAALKESQNINLYLAPLRNQLEEIE-QVEFSEMEPMIDPLFHVLCLIWAHCKDYRVPERIVVLAQEISNLIINCCHSYLDPKEIFKGETEEALEKVERSLKILNQFKESFESHREKVKEYFKDGAEPVEWQFASNLIFGRLNSFMSRIEIVKWILNATLEFNKLEKVEISGIKGRNLSQNIVDMFEEFKNIFKGFTEQTYDCLDPLE-----TDFLQDYHKFKASIDDLDRRLATTVSQAFADCHCYDAVFKLIDIFGGLLDRPILKLEFDKRYFELVKMLDEEMENDKLVYDIHVSGNEKVPKIHKNMPKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNXXXXXXXXXXXXXXXXXXXYYNNWLTGVDETCSFNLSQPLLIRNMDTMFIS----------------VNFDTKLQAVLREVKYLKILDQEEIPQSATDIHSKNDTLRKYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDALDNGAWQYIEQVRDLVHNLRSRVVKSKENIDTIRIIMSNWQKSPLFERKEG----KYDTLLNLDDRE-----DRCNKRYKEITEAGERVHGLV---KENSELLKADSVSEHW-KQYVDNIDDMIVENFQETINYSLQYMIDQIEGSKDPLFEVSMDLQGNEIVFQPSLDRDYADNFSELVDSL-VTDIF---KQASKVKRLAIGSSMED------YRTDLEENEELQKKRNEISERTEVATEKAKLYQAKFDEYSNLWTDNREEFMSQFLRYGQAISAEELEAHGEQDISAFEERPPTLDQFKHQIDKYEKQFEE--IEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNKEAAEGDFEGLV-------EMMGHLGNVKERQQATDEMFEP----LKQTIDLLKTYNQEMPDEVHLQLEELPEKWNNXXXXXXXXXXXXXPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSCLEHYEDLD-------RKHIEISGLEKAMEELNESAALFEVTVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAATKVKFDMNEST-TLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTWSQMEFEHEKHSRTGIT---LLKASEELIETLEEDQVKLQNMMTSKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALXXXXXXXXXXXKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNSPEIVMKHLTKLFDSXXXXXXXXXXXXXNTKVGVAMYAKDGEMVEFTNNCDLGGQVETWLNRLLEEMRTTMRTXXXXXXX-XXXXXXRDQWIFEFPAQVALSSSQIAWGTEVYLSFARLEEGYENALKDFNKKQITQLNALITLLIGELSKDDRQKVMTICTIDVHNRDVVQKLITQKIDNSQSFTWLCQLRHRWADTDKDCYINICDAQFRYAHEYLGNTPRLVITPLTDRCYITLTQSLHLTMSXXXXXXXXXXXXXXXXDLGRALGIMVYVFNCSEQMDYKSIGNIYKGLAQSGSWGCFDEFNRISXXXXXXXXXXXKCIQDAIKNKRKRFDFLGEEISLDSAIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLQARILARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGALKRSDPDRPEDQVLMRALRDFNIPKIVTDDTPVFMGLIGDLFPALDVPRKRDPEFEKHVRQATLDLKLQAEENFVLKVVQLQELFAVRHSVFVLGNAGTGKSMVWKTLIKTYSNLKKKPLAVDLNPKAVTNDELFGIINPSTREWKDGLFSVIMRDLANLTSDGP-KWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQDLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEAL---------KLRFKKITPIVEISHVQMLCHLLEVLLVPENTPADCPKEWYELYFVFCAIWAFGSCMFQDQLVDHRVEFTKWWVT---------EFKTIKLPAQ-GTVFDYYIDT--ETKKFEPWTKRMTKFEMDLEQPLQAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKL-NSIGDNYVVANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDYSHWYDRAK-LTLKEIHNTQYLACMN-PTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTILSEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRLWMHEGERVYNDKLIDDNDIETYQR-LQKELTKKAFEEMDEMVMFKKPLLYCHF--AQGIGEPK-YMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRILESPRGYALLVGVGGSGKQSLSRLAAFISSLDVFQITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGSTLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQ-EVELLPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHTELQGKMSRLENGLQKLESTAQQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDXXXXXXXXXXXXXXXNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVPKDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAGLCSWVINIITYYEIFCDVKPKRDXXXXXXXXXXXXXXKLSGIQNKIXXXXXXXXXXXXXFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYWLPFLANLTPIIPITQNLDPLKM---LVDDAIIASWNNEGLPSDRMSIENATILTNAERWPLIIDPQLQGIKWIKTRHGA-DLKVVRLGQKGYLDVIEQAVSAGDVVLIENIEESMDPVLDHLLGRNTIK--KGRA-IKLGDKECEYNPEFRLILQTKLANPHYKPEMQAQTTIINFTVTRDGLEDQLLATVVNKERSDLETLKLDLTKQQNQFKITLKELEDSLLHRLSAAEGNFLGDYALVENLENNKRTAIEIEEKVEQAKITEVTINETRELYRPAAARASMLYFILNDLNKINPMYQFSLKAFRVVFEKAIDRAEPSEELKGRVENLIDSITFSVYLYTSRGLFEKDKLIFTAQMSFQILLGTKEINPFELDFLLRFPI---VPNLTSPIDFLSNNSWGGIKALSAL--EEFKNLDRDIEGSAKRWKKFVESETPEKEKFPQEWKNK-TSLQRLCMMRALRPDRMTYAVADFVDEKLGHKYVEGGGVEFSQSFEESGPATPIFFILSPGVDPLKDVETLGKKLGFSGDNKNFRNISLGQGQEIVAEKAMDLGAKEGHWVVLQNIHLVSKWXXXXXXXXXXXXXXXXXXXRVFISAEPSGSPESHIIPQGILENAIKITNEPPTGMLANLH--------KSLNNFNQETMEMCAKENEFKTILFALCYFHAVVSERRKFGPQGWNRSYPFNTGDLAISVNVLYNYL-----EANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCKTYLEEYLQPEMLDG------ELNIVPGFKVPPNTDYKGYHNYIDECLPAE-SPYLYGLHPNAEIEFLTSISDKLFKTVFEMQPRDSSGAGATGISREERIKQILDDIMEKLPDDFNMVEIQAKVPPEERNPYVVVAFQECERMNMLTSEIRRSXXXXXXXXXXXXTITADMEALSNSLYMDVIPESWSKRAYPSLYGLALWYADLLLRIKELEIWTTDFQLPSVIWLGGLFNPQSFLTAIMQQMARKNEWPLDRMALQCDVTK-KNKEDMGGPPRDGAYVHGLFMEGARWDTQSGMIAEAKLKELGPSMPVIFIKAIPVDRQDLR--NVYACPVYKTKER----GPTFVWTFNLKTKEKPSKW 13431
            + I+  IE+ V++W  QI   L    S Q +    P+P  E+D+W+ R+  L  + EQL  PKVK++  L    +    P F      +     E+++   +L+ +    + I   V F  +   I P+   L +IW   + Y   ER+V L + I+  + +     +D   IF    E  L+    + K+L  + +++   R  ++   +D      W+F    +F + N        +  I     EF  +   E+  +   N ++ I ++ ++ + + +   E  ++  + ++     ++F++D+ +   SI++   +    ++  F      +  F ++  F  +  R  +     +++ +++   ++E+E+   ++  +++     P ++     V G + W + +   IK P+     +D +  ++     +  K+  +   ++  E K +N W   VD+  S  L + +L       F+S                V+F  ++  ++ E + L++L  + +P+ A ++  +++   K +  L  MV  Y+ + K+  ++E  ++ +E+ ++   +   +  L WNS  + +    YIE+    +H   S+V    +    I   +     + LF+ + G    K        + E     +   ++Y  I     ++ G +   ++ +   K     E W K+  D + +M+++N Q+      Q M+ + E     LFEV + L G +++  P     Y     +L D++  T +F   K+ S ++   +    +D      +  D+  + E+     +I+        K + YQ K+ ++  ++  N++  + ++L               +  +  F ER       +  ID+ E+   +  I K+ GF        ++ +       +  KRW         D   NSL E A+    TN    K   EG F  L        E+   L  ++  Q  + E FE     +++   +L   N  +  E   + ++L + +++    +  V   + P++ +     + + + F      F ++F++  P +        DLD       + H E++G+E   +ELN +  LF + +  + +L   +KE++ L  +++  +    + E W +TLWK+++++ +D+  + F K  R + +E+++      + +++K    +L   ++L++ A+R+RHW +LM  T   FD+N  T TL  +  + L+ F+D +  IV  A KE+S+EK ++E+  TW  ++F  + + + G     +L A +E+++ L+++ + LQ+M  S++I  F   V +W+K LS   +V+ +W  VQR W +LE IFIG D IR QLPE++++FD ID  FK ++TE  +   + +A   P     L  +   L  C+K+L +YL++KR AFPRF+F+S  +LL IL + +  E V +H+ K+FD+++ L+F K    E +    AM + + E++EF +   + G+VE W+ ++  EMR T R +  E+V    E K R QW+F++   VAL ++QI W  EV   F ++++G + ALKD+ K    Q++ ++  +   LSK+DR K+ T+  IDVH RD+V   +   I +++ F W  QLR  W     +  I  C  QF Y +EY+G   RLVITPLTDR Y+TLTQ+L + + GAPAGPAGTGKTETTKDL +ALG++  V NC E MDY+S+G I+ GL Q G+WGCFDEFNRI V VLSV++ Q+K IQ+ +  K  RF F G+EI LDS +GIFITMNPGYAGRTELPE++KA FRP  ++VPD + ICEIML ++GFL A++LA+K  TLY+L KE LSKQ+HYD+GLRA+KSVLV+AG L+R+DPD  ED+VLMRALRD N+PK + +D P+F+GLI DLFP LD PR R P+F   V +   + K     +   K+VQL E    RH+  V+G  G GKS+V K L  + + L+     + +NPK  +  EL+GI++P+TR+W DGL S I R++   T     ++++ DGD+D +W+E++N+VMDDNK+LTLA+ ERI L     LLFE+  L+ A+PATVSR G++Y++P++LG+ PF   W++ +E + E   L  L+ KY+P  ++ +           + K I P+  ++ V  LC++L+  L  E    D      E  F+    W+ G C+ +D  V    +F K               K  +LP++  T+FDYY D+  E +++ PW   + ++  + E+    +LVPT +T R  + L   I+ +RPV+LVG  GT KT + Q  L N+  D Y+   + F+  TTS  +QR LE  +EK+   +YGP   K+L+ FIDDMNMP+VD+Y T QP  +++  ++    YDR K L  K++ +  +LA M  P  G   + PR    F VF  +FP + SL +IYS+ILS      FS  +  TV  +  + +  +N+I     PT  KFHY+FNLRDLS I+QG+     D   +     R+W HE  RV  D+LI+D+D    Q+ ++++L++ A  + D       P+L+  +  A  + E + Y  +   E    + +E +E Y+E  + M LVLF+DA+ H+ RI+R +    G+ALLVGVGGSGKQSL++LAA+  S D+F+I L +GY   DL+ +L  LY K G++N   VF+  D  + +E FL L+N++L+SG +  LFPDDE E IIS +RNE  S GM  S+E+ W +F+NK  S L +VLC SPVG TLR R R FP VVN T+IDWF  WPE AL +V+  F+  E  L+P+D +    K    VH +V + S  ++Q  RR NY TPK++L+ I  Y  +L+ K    + +  RL+ GLQKL   + Q+ +L  KLA Q+V + +K  +   LL+++ + T+  + +K+IA  + + V     E+ K++ + E  L +A P L+ A+ AL+ L KN++ E++SF  PP  V  V + C+ +     K  K+ +WK AK G+M    +FL +L   + DNI        ++         +E++S S A  GL  +V  ++ Y ++  ++KPKR+ +    +   +   +L  ++N+I +LE +L+ L   +E A  ++QR Q+E D+  + +  A++L+ GL+SEN RW   ++  K ++  L GD LV  AFLSYVG F+  +R  ++ + W   +      IP++   DP ++   L +D  I+ WN+EGLP D +SI+N  + T A R+PL IDPQ Q + WI  +  + +LK        +L  +E A+  G   L ++++E +DPV+D++L +N IK  +GR  + LGDKE +++P FRL L TKL+NP Y P +  ++ +IN+TVT  GLEDQLL+ +V  ER +LE  +  L ++ +  K  LK+LEDSLL  L+ + GN L +  L+  LE  K  A E+ EK++    T   I++ R+ YR AA R ++L+F+L +++ IN MYQ+SL A+  VF+ ++ ++ P   L+ R++N++ ++T +VY Y   G+FEK KL+FT Q++ ++ +    +   ELDF ++      V     P  +LS+ SW  +  L+ +   +F  L  DIE     WK+++  ETPE    P+++ NK  S Q+LC++R  R DR+  A+  +V E++G +YV    + F +  ++S P +PI FILSPG DP  DV  L ++ GF      F  IS+GQGQE  A+  +D     GHW++LQN HL+ KW     +K  E   + H  +R++++ EP+ +      P GIL+ ++K+  EPP G+  NL          SLNNFN            F +++F L +FHAVV ERRK+G  GWN  Y FN  D  + + +L  YL     + +SK+PW  L+YL GE+MYGG   DD+DR++ +TY++EY    + D         +    + +P          YI E LP E +P ++GLH NAEI + TS + +++  + ++QP+  +G   +  SR+E I +    I  KLP  F++  ++ K    + +P +VV  QE ER N+L   + +SL  L   L GE+ ++A+++ ++ SLY   IP+ W + A  +L  LA W      R  +   W  + + P+V+WL GL  P+S+LTA++Q   RKN WPLD+  L   VT+     ++      G +VHGL++EGA WD     +   K K+L  S+PV  IK IP++   L+  N +  PVY T +R    G   V   +L T E PS W
Sbjct:  331 KEIMEMIESTVLKWDQQITGTLE---SLQKIVPHGPSPLAEIDFWRERNALLSALLEQLKLPKVKRILNLYSLAE---GPVFDTQNNELNKFHIEAKDNTKFLSLVERHFKSIAYGVNFLAVTDSIPPMMQALRMIWIISRHYNKDERMVPLMERIAWNLSDRVARLIDVNTIFNLPLEHVLKDTAEAEKMLRVWNDTYFEVRASIEASGRDA----RWEFDRKRLFEKTNYMADICHDLNEIAMILQEFYNIFGPELKSVT--NEAKRIEEVLQKVEELVQPLKEMPFNPFNLMKHKYDWSNFMEDFRRKVVSIEN---QAIDFINNCFCTLRSAEGAFDMLLRFQHIRSRQAINKLMTQKFNDIMSQYEKEVESIDQLFKTNMNN----PPLYHFKSCVAGGISWERHLFYNIKRPILRFLTMD-EMMQSDNGKRIRTKYLNVGRTMRAFEEKRFNEWRVYVDKVLSELLRKNILALANSENFVSENVPEETIDKMDDDLRVDFGFEINEIITETRNLELLGYK-VPELARNVALQDEYYNKIVEGLLGMVGTYHSVIKSLESIEVKILTDEIKEVKRTIRPGLRRLNWNSLGISD----YIEKCNLALHGFESKVATIHKVTMDIEEKLKEIDNAKLFKLQSGNKFLKCKEFFEFMESERTSDFEHLGRKYSTIGPLITKLQGEIIGDRDVNPFEKFQPFYEFWEKRIFDRVYNMVLKNLQD-----YQNML-RDENFPTCLFEVDLMLAGTDVIGNPQTTEIYKLAIQDLRDAVEATRVFIRWKRNSCIETTGMKIDGQDELFYFTFYLDIGNSVEITYFCEQIANYYRNIIGKLRKYQDKWKKHKRVFIPNKQAQIDKWLT-------------KDPTVMDFYER------IRDTIDRKEELLNQPVIRKI-GF------ISVNLKTLLSHVEDHFKRWK--------DLYCNSLHESAK----TNLASIKNDIEGHFTDLSLIPCDLEELKALLSTIQTIQLLSLE-FESRITDVQERYRVLTLSNHPIDQEEIEESDKLRQLFDSLTFESKNVNYRLTPVKTKFTDITKEEISDFGKDLKNFADKFKEEGPGSIG-----RDLDVGLVVLKKFHDELTGIEHRRQELNAAEQLFNLPITPYPELFNVQKEMKNLDQIYELYDAQKKARENWAETLWKNLDIKVLDEGIEGFLKEWRKMPREVKAMVTARNLAEKLKEFKDALPLFSDLKHEALRERHWKELMTKTGQNFDINPDTFTLSSVFAMELNRFQDVIAEIVTSASKELSIEKGVREVEETWMTLKFSVQPYLKGGKERGYILGALDEVLQILDDNAMNLQSMSASRFIGPFLVSVQNWEKNLSLISEVLDVWMVVQRKWMYLEGIFIGGD-IRSQLPEEAKKFDAIDKTFKKIMTETAKQPIIKQACQVPNRLSDLTNLSDGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDC-ECVQEHMIKMFDNISSLRFTKGTSLEMS--ATAMISSEQEIMEFRSPVLIEGRVEDWMTKIEMEMRRTNRVITKEAVFFYRESKVRVQWMFDYQGMVALCTNQIWWTWEVEDVFRKIKKGQKTALKDYAKLLHNQIDEIVFNVRSPLSKNDRSKLTTVLIIDVHARDIVDSFVRDSIMDAKEFEWESQLRFYWLREADEIQIQQCTGQFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYRSVGKIFNGLCQCGAWGCFDEFNRIEVSVLSVISTQLKTIQNGLIMKLSRFHFEGQEIKLDSRVGIFITMNPGYAGRTELPESVKAQFRPVVVIVPDLQQICEIMLFSQGFLSAKVLAKKMTTLYRLSKEQLSKQNHYDFGLRALKSVLVMAGELRRNDPDLSEDKVLMRALRDMNLPKFIFEDAPLFLGLIQDLFPGLDCPRVRYPDFNDSVEECLAEHKYIVLSDQADKIVQLYETMKTRHTTMVVGPTGGGKSVVIKILCASQTKLQLHTKLIPMNPKDRSVIELYGILDPNTRDWTDGLLSNIFREINKPTDKNERRYMLFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVYVDPKNLGYNPFWQCWLNKKENKFENDTLAGLYKKYIPPTIDRVIEGMMNGQAVEKLKTIIPLTNLNLVTQLCNMLDCQLTREGMNQDT----IEAIFIQSIYWSLGGCLIEDSQVKFD-QFIKSLCAMPQSNEEDKPAKAGELPSRFPTLFDYYFDSIEEKQEWIPWANLVPQYVHNPEKKFSEILVPTIDTVRLTWLLTEQIKIQRPVLLVGETGTSKTAVSQTFLRNTDPDKYIQLAINFSSRTTSLDIQRNLESNVEKRTKDSYGPPMGKRLLVFIDDMNMPQVDQYGTQQPIAMLKLMLERRGCYDRGKDLNWKKMQDIGFLAAMGKPGGGRNDVDPRFISLFSVFNATFPSKSSLFSIYSSILSGHC-QMFSDEIKNTVPIITKMTMTIYNQIIVQLPPTPSKFHYIFNLRDLSRIYQGMCQTTLDRFTKSDQFYRVWRHEFTRVIMDRLINDDDKTFVQKAIEEQLSENAKSDKD--YAMTDPILFGDYRNALEVAEVRLYEDMINYEAAKGLFQEIMEEYSEAVSPMKLVLFDDALDHLTRIHRTIRMDGGHALLVGVGGSGKQSLTKLAAYTGSCDIFEIALSRGYSEKDLRENLKTLYNKLGIENKSTVFMFGDQHVVEEGFLELINNMLSSGIVPALFPDDEREAIISQVRNEASSAGMGPSKESIWQYFVNKCASNLHIVLCMSPVGETLRTRCRNFPGVVNNTTIDWFFPWPEQALYAVASVFIGPENSLIPDDQRIEIVKHFVMVHLSVEEYSKEFMQKFRRGNYVTPKNYLDFINTYLKLLEDKDKFTESQCDRLQGGLQKLAEASVQLAELNDKLAIQKVAVTEKTIACENLLKEITSRTQIATEKKQIAQEKSQNVEVQSKEIEKEKGEAEAALVEALPVLEQARLALDDLEKNDVVEIRSFAKPPKPV-QVVSECIAVF----KNYKEINWKVAK-GMMAD-PSFLQSLQTMDVDNITLKQSNVVRDSLDKLKITIDEMRSVSKAGYGLLKFVTAVLGYTDVAREIKPKREKVARLEKTFGQNKRELEKVKNEIDKLESELKDLNQRYELAIDERQRLQEETDIMQRRLNAADKLINGLSSENKRWLVDLQLLKDQKVRLLGDCLVCSAFLSYVGAFSWEFRKEMVYSRWKDDVVERK--IPMS---DPFRLEDILTNDVEISKWNSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIMQKEESNNLKTATFNDPDFLKQLELAIKYGIPFLFKDVDEYIDPVIDNVLEKN-IKGDQGREFVILGDKEVDFDPNFRLYLNTKLSNPKYGPNIFGKSMVINYTVTLKGLEDQLLSVIVKFERKELEEQRERLIQETSDNKRLLKDLEDSLLRELATSTGNMLDNTELINTLEETKSKASEVSEKLKLGARTSEEIDKHRDGYREAAKRGAILFFVLAEMSTINSMYQYSLSAYLDVFKFSLKKSLPDGNLQKRLQNMMSTLTRNVYTYGCTGIFEKHKLLFTFQITLKLEMDKGNLTQDELDFFIKGNTSIEVAKRKKPYLWLSDISWQDVTKLTEMIPIKFSMLLEDIERDEYSWKQWINDETPETAALPKDYSNKLGSFQKLCLLRCFRIDRIYRAITLYVIEQMGEEYVTPPILNFERIHDQSTPFSPIVFILSPGSDPASDVVKLAERSGFGTTKLKF--ISMGQGQEANAKLLLDAAIARGHWLILQNCHLLVKW-LRELEKDLERLTKPHPDFRLWLTTEPTEA-----FPIGILQRSLKVVTEPPNGLKLNLRSTYEKIALSSLNNFNHTA---------FPSLVFTLAFFHAVVQERRKYGKIGWNIPYDFNESDFRVCIQILQTYLQKAADQGDSKIPWGSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYFGDFLFDTFQPFHFYASKFATYLIPQCDTGDDQLKYI-ESLPLENTPEVFGLHSNAEIGYYTSAAKEMWSKLIDIQPQ--TGKSGSSQSRDEIINEKASGIKSKLPKLFDLDRLRKKYGL-DISPTIVVLLQELERFNILVDRMTKSLHTLMRALVGEVGMSAELDDVAKSLYNGQIPQIWKRLAPDTLKSLANWITHFNDRYTQYSQWVENGE-PNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQFATAAEVTERAHQGCFVHGLYLEGAGWDRSQRCLVRPKPKQLIQSLPV--IKVIPIEAHRLKKQNTFLTPVYVTSQRRNAMGVGLVVEADLATTEHPSHW 4615          
The following BLAST results are available for this feature:
BLAST of DNAHb-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH170.000e+063.40dynein axonemal heavy chain 17 [Source:HGNC Symbol... [more]
DNAH90.000e+062.10dynein axonemal heavy chain 9 [Source:HGNC Symbol;... [more]
DNAH110.000e+057.99dynein axonemal heavy chain 11 [Source:HGNC Symbol... [more]
DNAH110.000e+057.90dynein axonemal heavy chain 11 [Source:HGNC Symbol... [more]
DNAH110.000e+057.90dynein axonemal heavy chain 11 [Source:HGNC Symbol... [more]
back to top
BLAST of DNAHb-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
che-30.000e+027.21Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-11.227e-16425.89Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-12.488e-16425.89Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-12.488e-16425.89Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-38.751e-1825.31Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of DNAHb-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhc93AB0.000e+060.41gene:FBgn0013812 transcript:FBtr0273236[more]
Dhc93AB0.000e+060.28gene:FBgn0013812 transcript:FBtr0336774[more]
kl-55.380e-7659.60gene:FBgn0267433 transcript:FBtr0346772[more]
CG33390.000e+046.42gene:FBgn0039510 transcript:FBtr0273192[more]
Dhc98D0.000e+033.15gene:FBgn0013813 transcript:FBtr0301302[more]
back to top
BLAST of DNAHb-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah9l0.000e+059.86dynein, axonemal, heavy polypeptide 9 like [Source... [more]
dnah9l4.133e-10261.83dynein, axonemal, heavy polypeptide 9 like [Source... [more]
dnah9l3.037e-8961.42dynein, axonemal, heavy polypeptide 9 like [Source... [more]
dnah110.000e+058.67dynein, axonemal, heavy chain 11 [Source:ZFIN;Acc:... [more]
dnah20.000e+032.93dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of DNAHb-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh26.062e-6866.86myosin, heavy chain 2, skeletal muscle, adult [Sou... [more]
DNAH110.000e+059.37dynein axonemal heavy chain 11 [Source:NCBI gene;A... [more]
DNAH110.000e+059.70dynein axonemal heavy chain 11 [Source:NCBI gene;A... [more]
DNAH110.000e+059.92dynein axonemal heavy chain 11 [Source:NCBI gene;A... [more]
DNAH110.000e+058.18dynein axonemal heavy chain 11 [Source:NCBI gene;A... [more]
back to top
BLAST of DNAHb-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah170.000e+063.40dynein, axonemal, heavy chain 17 [Source:MGI Symbo... [more]
Dnah170.000e+063.14dynein, axonemal, heavy chain 17 [Source:MGI Symbo... [more]
Dnah170.000e+062.80dynein, axonemal, heavy chain 17 [Source:MGI Symbo... [more]
Dnah90.000e+062.26dynein, axonemal, heavy chain 9 [Source:MGI Symbol... [more]
Dnah110.000e+057.00dynein, axonemal, heavy chain 11 [Source:MGI Symbo... [more]
back to top
BLAST of DNAHb-1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23098|DYHC_TRIGR0.000e+067.50Dynein beta chain, ciliary OS=Tripneustes gratilla... [more]
sp|P39057|DYHC_HELCR0.000e+067.29Dynein beta chain, ciliary OS=Heliocidaris crassis... [more]
sp|Q9UFH2|DYH17_HUMAN0.000e+063.40Dynein heavy chain 17, axonemal OS=Homo sapiens OX... [more]
sp|Q69Z23|DYH17_MOUSE0.000e+062.75Dynein heavy chain 17, axonemal OS=Mus musculus OX... [more]
sp|Q9NYC9|DYH9_HUMAN0.000e+062.10Dynein heavy chain 9, axonemal OS=Homo sapiens OX=... [more]
back to top
BLAST of DNAHb-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203289900.000e+0100.00tr|A0A0H3YKL3|A0A0H3YKL3_SCHMD DNAHb-1 OS=Schmidte... [more]
gnl|BL_ORD_ID|210976920.000e+070.58tr|A0A2T7Q0D5|A0A2T7Q0D5_POMCA Uncharacterized pro... [more]
gnl|BL_ORD_ID|239041570.000e+069.96tr|K1PAG1|K1PAG1_CRAGI Dynein beta chain, ciliary ... [more]
gnl|BL_ORD_ID|203424810.000e+069.81tr|A0A1S3IDL2|A0A1S3IDL2_LINUN dynein beta chain, ... [more]
gnl|BL_ORD_ID|203270460.000e+069.83tr|A0A1S3IEP3|A0A1S3IEP3_LINUN dynein beta chain, ... [more]
back to top
BLAST of DNAHb-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5