Diaphanous

Overview
NameDiaphanous
Smed IDSMED30035463
Length (bp)3703
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Diaphanous (SMED30035463) t-SNE clustered cells

Violin plots show distribution of expression levels for Diaphanous (SMED30035463) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Diaphanous (SMED30035463) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Diaphanous (SMED30035463) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035463

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035463SMESG000054598.1 SmedASXL_015527SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30035463SMESG000027849.1 SMESG000054598.1 SMESG000054597.1 dd_Smed_v4_6188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035463SMESG000027849.1 SMESG000054598.1 SMESG000054597.1 dd_Smed_v4_6188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035463SMESG000027849.1 SMESG000054598.1 SMESG000054597.1 dd_Smed_v4_6188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035463SMESG000027849.1 SMESG000054598.1 SMESG000054597.1 dd_Smed_v4_6188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035463SMESG000027849.1 SMESG000054598.1 SMESG000054597.1 dd_Smed_v4_6188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035463SMESG000027849.1 SMESG000054598.1 SMESG000054597.1 dd_Smed_v4_6188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035463SMESG000027849.1 SMESG000054598.1 SMESG000054597.1 dd_Smed_v4_6188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Diaphanous vs. Ensembl Human
Match: DIAPH1 (diaphanous related formin 1 [Source:HGNC Symbol;Acc:HGNC:2876])

HSP 1 Score: 81.2629 bits (199), Expect = 1.117e-14
Identity = 92/335 (27.46%), Postives = 171/335 (51.04%), Query Frame = 2
Query: 2273 DSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN-----LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE-IHKQKM--ESINKMQIQQFQQSDQL 3241
            DSK AQN  IFL S  M  +EI N I ++N  V+T  MI  L+  MP+  QL  L   KD+ +DL   EQF V +  V   + R N I  ++  S + ++ ++  +  + ++ E+L  S+   ++LE+ + +   MN   +     G  +  L K  DTK  +    LL FL E   +  P+ LK  D+L  ++ ASR+S++++   ++Q    +  ++ D++N  +          ++++ V+ A+   + +  + + +++ Y+E+ EYF         E+ F DL  F+N F  + K   +R++  E + + K+  E   K ++++ Q+ +QL
Sbjct:  809 DSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFS-EQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTIFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQL 1142          

HSP 2 Score: 66.2402 bits (160), Expect = 3.742e-10
Identity = 43/154 (27.92%), Postives = 77/154 (50.00%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLI--NENASNKIISSFTKFTQRPEC-RFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIF 958
            I++CLK+F NN FGI  + E +    +L + +       +I A  LLS +C++   E+ + +++ + T+  +  E  RF+PL+  L +   I ++   +  IN L+        E    R+ +R EL  LG    L+  RE  ++ +  Q N+F
Sbjct:  173 IIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTTIALKVGCLQLINALITPA-----EELDFRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVF 321          
BLAST of Diaphanous vs. Ensembl Human
Match: DIAPH1 (diaphanous related formin 1 [Source:HGNC Symbol;Acc:HGNC:2876])

HSP 1 Score: 79.7221 bits (195), Expect = 2.882e-14
Identity = 92/335 (27.46%), Postives = 169/335 (50.45%), Query Frame = 2
Query: 2273 DSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN-----LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE-IHKQKM--ESINKMQIQQFQQSDQL 3241
            DSK AQN  IFL S  M  +EI N I ++N  V+T  MI  L+  MP+  QL  L   KD+ +DL   EQF V +  V   + R N I  ++  S   ++ ++  +  + ++ E+L  S+   ++LE+ + +   MN   +     G  +  L K  DTK  +    LL FL E   +  P+ LK  D+L  ++ ASR+S++++   ++Q    +  ++ D++N  +          +++  V+ A+   + +  + + +++ Y+E+ EYF         E+ F DL  F+N F  + K   +R++  E + + K+  E   K ++++ Q+ +QL
Sbjct:  853 DSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQ-VENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQL 1186          

HSP 2 Score: 66.2402 bits (160), Expect = 4.380e-10
Identity = 43/154 (27.92%), Postives = 77/154 (50.00%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLI--NENASNKIISSFTKFTQRPEC-RFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIF 958
            I++CLK+F NN FGI  + E +    +L + +       +I A  LLS +C++   E+ + +++ + T+  +  E  RF+PL+  L +   I ++   +  IN L+        E    R+ +R EL  LG    L+  RE  ++ +  Q N+F
Sbjct:  217 IIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTTIALKVGCLQLINALITPA-----EELDFRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVF 365          
BLAST of Diaphanous vs. Ensembl Human
Match: DIAPH1 (diaphanous related formin 1 [Source:HGNC Symbol;Acc:HGNC:2876])

HSP 1 Score: 79.7221 bits (195), Expect = 3.398e-14
Identity = 92/335 (27.46%), Postives = 170/335 (50.75%), Query Frame = 2
Query: 2273 DSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN-----LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE-IHKQKM--ESINKMQIQQFQQSDQL 3241
            DSK AQN  IFL S  M  +EI N I ++N  V+T  MI  L+  MP+  QL  L   KD+ +DL   EQF V +  V   + R N I  ++  S + ++ ++  +  + ++ E+L  S+   ++LE+ + +   MN   +     G  +  L K  DTK  +    LL FL E   +  P+ LK  D+L  ++ ASR+S++++   ++Q    +  ++ D++N  +          +++  V+ A+   + +  + + +++ Y+E+ EYF         E+ F DL  F+N F  + K   +R++  E + + K+  E   K ++++ Q+ +QL
Sbjct:  844 DSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFS-EQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQL 1177          

HSP 2 Score: 66.2402 bits (160), Expect = 4.282e-10
Identity = 43/154 (27.92%), Postives = 77/154 (50.00%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLI--NENASNKIISSFTKFTQRPEC-RFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIF 958
            I++CLK+F NN FGI  + E +    +L + +       +I A  LLS +C++   E+ + +++ + T+  +  E  RF+PL+  L +   I ++   +  IN L+        E    R+ +R EL  LG    L+  RE  ++ +  Q N+F
Sbjct:  208 IIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTTIALKVGCLQLINALITPA-----EELDFRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVF 356          
BLAST of Diaphanous vs. Ensembl Human
Match: DIAPH1 (diaphanous related formin 1 [Source:HGNC Symbol;Acc:HGNC:2876])

HSP 1 Score: 79.337 bits (194), Expect = 3.676e-14
Identity = 92/335 (27.46%), Postives = 170/335 (50.75%), Query Frame = 2
Query: 2273 DSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN-----LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE-IHKQKM--ESINKMQIQQFQQSDQL 3241
            DSK AQN  IFL S  M  +EI N I ++N  V+T  MI  L+  MP+  QL  L   KD+ +DL   EQF V +  V   + R N I  ++  S + ++ ++  +  + ++ E+L  S+   ++LE+ + +   MN   +     G  +  L K  DTK  +    LL FL E   +  P+ LK  D+L  ++ ASR+S++++   ++Q    +  ++ D++N  +          +++  V+ A+   + +  + + +++ Y+E+ EYF         E+ F DL  F+N F  + K   +R++  E + + K+  E   K ++++ Q+ +QL
Sbjct:  853 DSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFS-EQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQL 1186          

HSP 2 Score: 66.2402 bits (160), Expect = 4.183e-10
Identity = 43/154 (27.92%), Postives = 77/154 (50.00%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLI--NENASNKIISSFTKFTQRPEC-RFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIF 958
            I++CLK+F NN FGI  + E +    +L + +       +I A  LLS +C++   E+ + +++ + T+  +  E  RF+PL+  L +   I ++   +  IN L+        E    R+ +R EL  LG    L+  RE  ++ +  Q N+F
Sbjct:  217 IIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTTIALKVGCLQLINALITPA-----EELDFRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVF 365          
BLAST of Diaphanous vs. Ensembl Human
Match: DIAPH1 (diaphanous related formin 1 [Source:HGNC Symbol;Acc:HGNC:2876])

HSP 1 Score: 79.337 bits (194), Expect = 4.025e-14
Identity = 92/335 (27.46%), Postives = 170/335 (50.75%), Query Frame = 2
Query: 2273 DSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN-----LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE-IHKQKM--ESINKMQIQQFQQSDQL 3241
            DSK AQN  IFL S  M  +EI N I ++N  V+T  MI  L+  MP+  QL  L   KD+ +DL   EQF V +  V   + R N I  ++  S + ++ ++  +  + ++ E+L  S+   ++LE+ + +   MN   +     G  +  L K  DTK  +    LL FL E   +  P+ LK  D+L  ++ ASR+S++++   ++Q    +  ++ D++N  +          +++  V+ A+   + +  + + +++ Y+E+ EYF         E+ F DL  F+N F  + K   +R++  E + + K+  E   K ++++ Q+ +QL
Sbjct:  844 DSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFS-EQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQL 1177          

HSP 2 Score: 66.2402 bits (160), Expect = 4.582e-10
Identity = 43/154 (27.92%), Postives = 77/154 (50.00%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLI--NENASNKIISSFTKFTQRPEC-RFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIF 958
            I++CLK+F NN FGI  + E +    +L + +       +I A  LLS +C++   E+ + +++ + T+  +  E  RF+PL+  L +   I ++   +  IN L+        E    R+ +R EL  LG    L+  RE  ++ +  Q N+F
Sbjct:  208 IIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTTIALKVGCLQLINALITPA-----EELDFRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVF 356          
BLAST of Diaphanous vs. Ensembl Celegans
Match: cyk-1 (CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q7JP75])

HSP 1 Score: 70.4774 bits (171), Expect = 7.124e-12
Identity = 90/406 (22.17%), Postives = 183/406 (45.07%), Query Frame = 2
Query: 2102 INVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKT---------KFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLV-KLEPF-KDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK----IVGITLDSLAKFVDTKDNCNGN-LLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN--------------LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQQ 3229
            IN   IP      +S W+  N+  L++D++  +L  +FA+K AA   T         K     ++ D K  Q   I   S+ M + E+  AI ++N KV+T+  + +L + MP   +L+ KL    K + E++   EQF+  L+++    +R + +  ++  S + L E++ ++  +  + E++ +S+  ++ L++V+     M    K         +  L + VDTKD  N + LL  L+E+++ + P   +          A       I S       + K++Q    NI  +                  ++    E A    S +S +  ++ + ++ + +Y+  +   Y  E+ F+D++ F  Q+ N+ K + + +   +  + + E+  + Q+QQ QQ
Sbjct:  826 INPRDIPR-----ESFWVGTNEEQLTSDRMFDRLRTKFATKPAANSGTLGGVLNSKKKVKTAQVIHDDKLLQKLGILQGSIKMSHSELKLAILEVNEKVLTVGFLEQLRSAMPVEKELIDKLRAVNKAQFEEMPEGEQFVTRLLQIQGLPLRLDLVLFKMRFS-EVLNELKPAMSSVMEACEEVRASEGFRTFLKLVLATGNFMGGATKNYSSAYAFDMRMLTRLVDTKDVDNRHTLLHHLIEEMKRIDPRRARF---------ALTDFHHCIESSRVNADEIRKTVQLTENNIKKLENCLKVYKIQGERDLFDEKMRPFHEKAVKEFSTVSSMCGKMKNDWESLVKYYAFNDKKYPMEEFFADIRTFSEQYSNAWKEL-DAEAEAKRKEAEFETQKRKQLQQSQQ 1215          
BLAST of Diaphanous vs. Ensembl Celegans
Match: cyk-1 (CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q7JP75])

HSP 1 Score: 70.4774 bits (171), Expect = 7.561e-12
Identity = 90/406 (22.17%), Postives = 183/406 (45.07%), Query Frame = 2
Query: 2102 INVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKT---------KFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLV-KLEPF-KDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK----IVGITLDSLAKFVDTKDNCNGN-LLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN--------------LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQQ 3229
            IN   IP      +S W+  N+  L++D++  +L  +FA+K AA   T         K     ++ D K  Q   I   S+ M + E+  AI ++N KV+T+  + +L + MP   +L+ KL    K + E++   EQF+  L+++    +R + +  ++  S + L E++ ++  +  + E++ +S+  ++ L++V+     M    K         +  L + VDTKD  N + LL  L+E+++ + P   +          A       I S       + K++Q    NI  +                  ++    E A    S +S +  ++ + ++ + +Y+  +   Y  E+ F+D++ F  Q+ N+ K + + +   +  + + E+  + Q+QQ QQ
Sbjct:  826 INPRDIPR-----ESFWVGTNEEQLTSDRMFDRLRTKFATKPAANSGTLGGVLNSKKKVKTAQVIHDDKLLQKLGILQGSIKMSHSELKLAILEVNEKVLTVGFLEQLRSAMPVEKELIDKLRAVNKAQFEEMPEGEQFVTRLLQIQGLPLRLDLVLFKMRFS-EVLNELKPAMSSVMEACEEVRASEGFRTFLKLVLATGNFMGGATKNYSSAYAFDMRMLTRLVDTKDVDNRHTLLHHLIEEMKRIDPRRARF---------ALTDFHHCIESSRVNADEIRKTVQLTENNIKKLENCLKVYKIQGERDLFDEKMRPFHEKAVKEFSTVSSMCGKMKNDWESLVKYYAFNDKKYPMEEFFADIRTFSEQYSNAWKEL-DAEAEAKRKEAEFETQKRKQLQQSQQ 1215          
BLAST of Diaphanous vs. Ensembl Fly
Match: dia (gene:FBgn0011202 transcript:FBtr0081410)

HSP 1 Score: 98.9821 bits (245), Expect = 1.826e-20
Identity = 100/427 (23.42%), Postives = 211/427 (49.41%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAA-EFKTKFVKP---------LIVLDSKNAQNFEIFLRSV--NMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKDNCNG-NLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIEN-----IDSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKI-IYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFK 3307
             KR N   I    +++K+ W++  +  L+ D  + +L  +F+SK    E K    KP         L VLDSK AQN  I L     ++  E+I   + + +  +++ +++ +L+ Y+P    L +L+  K K E L   EQF   + E+     R + ++ ++  + D +++++  +    ++ E++ +S K   +LE+++ +   MN   K     G  +  L K  +TKD  N   LL +L + +    P++L  +DDL  ++ ASR++ D+I   + Q ++ +K+L+ D++N      D       +    E  +  +  +  +Q +++  Y+++ EY+    S Y  E+ F+D+K FK+ F+ +    +  R++L +  K++++   +   ++ Q+  Q    +  +D  ++ E  + S+ +
Sbjct:  611 MKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVKKEQKDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLTYA-DMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNTKDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFADIKTFKDAFQAAHNDNVRVREELEK--KRRLQEAREQSAREQQERQQRKKAVVDMDAPQTQEGVMDSLLE 1034          
BLAST of Diaphanous vs. Ensembl Fly
Match: dia (gene:FBgn0011202 transcript:FBtr0335145)

HSP 1 Score: 98.9821 bits (245), Expect = 1.826e-20
Identity = 100/427 (23.42%), Postives = 211/427 (49.41%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAA-EFKTKFVKP---------LIVLDSKNAQNFEIFLRSV--NMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKDNCNG-NLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIEN-----IDSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKI-IYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFK 3307
             KR N   I    +++K+ W++  +  L+ D  + +L  +F+SK    E K    KP         L VLDSK AQN  I L     ++  E+I   + + +  +++ +++ +L+ Y+P    L +L+  K K E L   EQF   + E+     R + ++ ++  + D +++++  +    ++ E++ +S K   +LE+++ +   MN   K     G  +  L K  +TKD  N   LL +L + +    P++L  +DDL  ++ ASR++ D+I   + Q ++ +K+L+ D++N      D       +    E  +  +  +  +Q +++  Y+++ EY+    S Y  E+ F+D+K FK+ F+ +    +  R++L +  K++++   +   ++ Q+  Q    +  +D  ++ E  + S+ +
Sbjct:  611 MKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVKKEQKDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLTYA-DMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNTKDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFADIKTFKDAFQAAHNDNVRVREELEK--KRRLQEAREQSAREQQERQQRKKAVVDMDAPQTQEGVMDSLLE 1034          
BLAST of Diaphanous vs. Ensembl Fly
Match: dia (gene:FBgn0011202 transcript:FBtr0081411)

HSP 1 Score: 98.9821 bits (245), Expect = 1.826e-20
Identity = 100/427 (23.42%), Postives = 211/427 (49.41%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAA-EFKTKFVKP---------LIVLDSKNAQNFEIFLRSV--NMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKDNCNG-NLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIEN-----IDSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKI-IYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFK 3307
             KR N   I    +++K+ W++  +  L+ D  + +L  +F+SK    E K    KP         L VLDSK AQN  I L     ++  E+I   + + +  +++ +++ +L+ Y+P    L +L+  K K E L   EQF   + E+     R + ++ ++  + D +++++  +    ++ E++ +S K   +LE+++ +   MN   K     G  +  L K  +TKD  N   LL +L + +    P++L  +DDL  ++ ASR++ D+I   + Q ++ +K+L+ D++N      D       +    E  +  +  +  +Q +++  Y+++ EY+    S Y  E+ F+D+K FK+ F+ +    +  R++L +  K++++   +   ++ Q+  Q    +  +D  ++ E  + S+ +
Sbjct:  611 MKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVKKEQKDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLTYA-DMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNTKDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFADIKTFKDAFQAAHNDNVRVREELEK--KRRLQEAREQSAREQQERQQRKKAVVDMDAPQTQEGVMDSLLE 1034          
BLAST of Diaphanous vs. Ensembl Fly
Match: dia (gene:FBgn0011202 transcript:FBtr0305961)

HSP 1 Score: 98.5969 bits (244), Expect = 2.248e-20
Identity = 101/427 (23.65%), Postives = 210/427 (49.18%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAA-EFKTKFVKP---------LIVLDSKNAQNFEIFLRSV--NMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKDNCNG-NLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIEN-----IDSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKI-IYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFK 3307
             KR N   I    +++K+ W++  +  L+ D  + +L  +F+SK    E K    KP         L VLDSK AQN  I L     ++  E+I   + + +  +++ +++ +L+ Y+P    L +L+  K K E L   EQF   + E+     R + ++ + L   D +++++  +    ++ E++ +S K   +LE+++ +   MN   K     G  +  L K  +TKD  N   LL +L + +    P++L  +DDL  ++ ASR++ D+I   + Q ++ +K+L+ D++N      D       +    E  +  +  +  +Q +++  Y+++ EY+    S Y  E+ F+D+K FK+ F+ +    +  R++L +  K++++   +   ++ Q+  Q    +  +D  ++ E  + S+ +
Sbjct:  618 MKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVKKEQKDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFK-LTYADMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNTKDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFADIKTFKDAFQAAHNDNVRVREELEK--KRRLQEAREQSAREQQERQQRKKAVVDMDAPQTQEGVMDSLLE 1041          
BLAST of Diaphanous vs. Ensembl Fly
Match: form3 (gene:FBgn0053556 transcript:FBtr0091533)

HSP 1 Score: 64.3142 bits (155), Expect = 8.717e-10
Identity = 78/299 (26.09%), Postives = 153/299 (51.17%), Query Frame = 2
Query: 2261 LIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNP---EKKIVGITLDSLAKFVDTKDNCNG-NLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDS-INLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEK 3142
            + +LD K + N  IFL+     N++II  IR+   + I  + +  L+  MP++ +L  L+ F      L   E+F++ L+EV NYK+R   + L+   + + +  +E  ++ +  + + LL++  L+ VL MVV     +N         G+ L SL K  D + N  G NL+ F+  Q     PE L+    L +L+SAS+ +S+ IN+ +N     ++ +   IE   + ++++ +++  ++ A++ LS +     +++S   ++ E+F    + +  E+ F     F ++FK + K
Sbjct:  437 ITLLDGKRSLNVNIFLKQFRTSNDDIIQLIRQGAHEEIGAERLRGLLKIMPEVDELDMLKGFNGDKARLGNAEKFLLQLLEVPNYKLRIESMLLKEEFAAN-VAYLEPCINSMLYAGDDLLNNKTLQEVLYMVVVAGNFLNSGGYAGNAAGVKLSSLQKLTDIRANKPGMNLIHFVALQAEKRNPELLQFTGQLSNLESASKTTSEQINNEINTLDGRIRRIARQIEQPATDVDIKEQMADFLQAAESELSVLQAGMKQVESMRLKMSEFFCDDAATFRLEECFKIFHNFCDKFKQAVK 734          
BLAST of Diaphanous vs. Ensembl Zebrafish
Match: diaph3 (diaphanous-related formin 3 [Source:ZFIN;Acc:ZDB-GENE-040801-144])

HSP 1 Score: 88.5817 bits (218), Expect = 3.785e-17
Identity = 108/397 (27.20%), Postives = 174/397 (43.83%), Query Frame = 2
Query: 2090 SFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFK----------TKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGI-----------HLQ--ILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKKIV---GITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN-----LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQ 3184
            S KR+N + I    L+E   W+   +     + ++ +L   F +++ A  +           K VK L VLD K AQN  IFL S  M  EEI   I +++   +T  MI  LV ++P+  QL  L  +K +  +L   EQF V +  V   + R N I           HL+  I+  N    EV  S                   +LE+++     MN   +     G  L SL K  DTK  +    LL FL E   +  PE LK  DDL  +D ASR+S++++   + Q    L  L+ D++   S +       S+++++   A++    +  + + + + Y  + EYF I       E+LF+DL  F+  F  + K    R++  E  ++
Sbjct:  611 SMKRLNWSKISPQELSENCFWVIAKEDRYENEDLLTRLSVTFGTQRVARREEEDLEEKKCIKKRVKELKVLDPKIAQNLSIFLGSFRMPYEEIRRMILEVDEDQLTEPMIQNLVKHLPEQEQLNALVKYKSEYANLSEPEQFGVVMSSVKRLRPRLNSILFKLQFEEQVNHLRPDIMAVNAACDEVRKSKSF--------------SRLLELILLTGNFMNAGSRNAQSFGYNLSSLCKLKDTKSTDQKSTLLHFLAEICEEKFPEVLKFVDDLQHVDRASRVSAENLEKSLKQMEKHLLQLEKDLDTFSSTDDQQDLFHSKMAISFLHARDQYQKLVVMHSNMVTLYLNMLEYFAIDPKKTSVEELFTDLSNFRAMFMQAMKENIRRKEAEEKQRK 993          

HSP 2 Score: 62.3882 bits (150), Expect = 3.594e-9
Identity = 46/164 (28.05%), Postives = 75/164 (45.73%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLIN-ENASNKIISSFTKFTQ-RPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEF 991
            +++CLK+F NN +G+ R+  E+    +L + I       +   + LLS IC++  EN   K++ + T  T+ R   RF P++  L  R+ + +Q + M  IN L+ S      +    RL +R E    G    L       +  L  Q  +F      DM EF
Sbjct:  221 VIQCLKAFMNNKYGLERILGEETSLALLAQAIDPCQPAMMTDVVKLLSAICIVGEENTLEKVLEAITTATEGRGVARFNPIVQGLSVRS-VQLQVACMQLINALVTSP-----DELDFRLHIRNEFMRCGLREILPSLSVVKNDALDIQLKVFEEHKEEDMIEF 378          
BLAST of Diaphanous vs. Ensembl Zebrafish
Match: diaph3 (diaphanous-related formin 3 [Source:ZFIN;Acc:ZDB-GENE-040801-144])

HSP 1 Score: 87.4261 bits (215), Expect = 5.490e-17
Identity = 108/397 (27.20%), Postives = 172/397 (43.32%), Query Frame = 2
Query: 2090 SFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFK----------TKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGI-----------HLQ--ILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKKIV---GITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN-----LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQ 3184
            S KR+N + I    L+E   W+   +     + ++ +L   F +++ A  +           K VK L VLD K AQN  IFL S  M  EEI   I +++   +T  MI  LV ++P+  QL  L  +K +  +L   EQF V +  V   + R N I           HL+  I+  N    EV  S                   +LE+++     MN   +     G  L SL K  DTK  +    LL FL E   +  PE LK  DDL  +D ASR+S++++   + Q    L  L+ D++   S +       S+++     A++    +  + + + + Y  + EYF I       E+LF+DL  F+  F  + K    R++  E  ++
Sbjct:  128 SMKRLNWSKISPQELSENCFWVIAKEDRYENEDLLTRLSVTFGTQRVARREEEDLEEKKCIKKRVKELKVLDPKIAQNLSIFLGSFRMPYEEIRRMILEVDEDQLTEPMIQNLVKHLPEQEQLNALVKYKSEYANLSEPEQFGVVMSSVKRLRPRLNSILFKLQFEEQVNHLRPDIMAVNAACDEVRKSKSF--------------SRLLELILLTGNFMNAGSRNAQSFGYNLSSLCKLKDTKSTDQKSTLLHFLAEICEEKFPEVLKFVDDLQHVDRASRVSAENLEKSLKQMEKHLLQLEKDLDTFSSTDDQQDLFHSKMASFSTQARDQYQKLVVMHSNMVTLYLNMLEYFAIDPKKTSVEELFTDLSNFRAMFMQAMKENIRRKEAEEKQRK 510          
BLAST of Diaphanous vs. Ensembl Zebrafish
Match: diaph2 (diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-GENE-090115-1])

HSP 1 Score: 75.485 bits (184), Expect = 3.306e-13
Identity = 98/398 (24.62%), Postives = 195/398 (48.99%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKTKF---VKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSE-----ISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE-IHKQKM--ESINKMQIQQFQQSDQL 3241
             KR+N + I    + E   WL++ +       +  +L   F+SK   +  T+F    K L +LD+K AQN  IFL S  +  EEI + + +++ + ++  +I  L+  +P+  +L  L   K++ E+L   EQF + +  V   + R NGI  + L   + +  +   +  +  + E++  S+    +LEMV+ +   MN   +     G  +  L K  DTK  + N  LL FL E+  +  PE LK  D+L+ ++SAS++++ ++ + ++     ++ L+ DI+N    + + +     +S   + ++     +S +   +   Y+ +  YF         E  F DL  F+N F ++ +  ++++++ E I + K+  E   + +I++ Q+  QL
Sbjct:  607 MKRVNWSKIVPQEMAENCFWLKVKEERFENTDMFSELSLSFSSKSRDDRMTQFKKKAKELRILDAKTAQNLSIFLGSFRLPYEEIRDIVLQVDEERLSEALIQNLIKNLPEQKELSNLAELKNEYEELCESEQFGIVMSSVKMLRPRLNGILFK-LTFEEQVNNIRPDIMNVTFACEEVKKSEGFHMLLEMVLLVGNYMNSGSRNAQTFGFNISFLCKLRDTKSTDQNTTLLHFLAEKCEEKYPEMLKFPDELEHVESASKVAAQTLKASLDIMERHIQRLENDIQNFPKTDDKQDKFVEKMSGFSKHSREQYEKLSTMHKNMQKLYENLGSYFAFDPHTVSIEDFFGDLANFRNLFMDAVRENHKKREMEEKIKRAKIAKEKAEREKIERQQKKKQL 1003          

HSP 2 Score: 60.077 bits (144), Expect = 1.752e-8
Identity = 38/143 (26.57%), Postives = 72/143 (50.35%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLIN-ENASNKIISSFTKFTQR-PECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESND 928
            +++CLK+F NN +G+ R+  ++    +L + I  +    +   + +LS +C+I  EN  +KI+++ T   +R  + RF P++  L N     +Q + M  IN L+ S      +    R+ LR E    G +  L   +E+ +
Sbjct:  196 LIQCLKAFMNNKYGLQRILGDERSLLLLARAIDPKQTNMMTEIVKILSAVCIIGEENILDKILAAMTIAAERNNKERFAPIVEGLENHEAQQLQVACMQLINALVTSP-----DDLDFRIHLRNEFLRCGLKKILPELKETEE 333          
BLAST of Diaphanous vs. Ensembl Zebrafish
Match: daam2 (dishevelled associated activator of morphogenesis 2 [Source:ZFIN;Acc:ZDB-GENE-070709-1])

HSP 1 Score: 73.559 bits (179), Expect = 1.293e-12
Identity = 97/420 (23.10%), Postives = 204/420 (48.57%), Query Frame = 2
Query: 2252 VKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFK-VITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK--IVGITLDSLAKFVDTKDNCNGN--LLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDS-INLRSE-----ISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLK-SIFKQSAFIENAIIGISSGKIFCDEDSVLNWNVQYHRRENQKNRVRNA----RNIRRLNF 3463
            VK L V+D + AQN  I L  + M NEE+  A+ +M+ +  +  DM+ +L+ ++P+ S +  LE  K ++E +   ++F+  +  +D+Y+ R   +  +   + D L E +   + +  +  +++ S  L+ VLE+V+     MN  ++    G  + SL K +DTK + + N  +L +L+       P+ L +  DL S+  A++++   +   V+   + LK+L+ ++    S +  R +     +S  + +A    S +  L NE   K+    ++FG  +     ++ F    +F   F  +      R  L  + + K E   K++++        A++    + E+ ++K  K S+ ++    ++ +  + SG++F D+DS L  N     R+   N++ +A    R++ ++N+
Sbjct:  630 VKELSVIDGRRAQNCVILLSKLKMSNEELKRAVLEMDEREELAKDMLEQLLKFVPEKSDMDLLEEHKHELERMARADRFLFEMSRIDHYQQRLQSLFFKKKFA-DRLAETKPKAEAILCASREVMRSKLLRQVLEVVLAFGNFMNKGQRGNAYGFKVSSLNKIIDTKSSIDRNITMLHYLIMIFEKNYPDILSIQQDLCSVSEAAKVNLAELEKEVSSIRSGLKALEVELRYQQSRVCDRGDKFVPVVSDFITVASFSFSELEELLNEAKDKFSMALKHFGEEEGRMQPDEFFGIFDIFLQSFSEA------RHDLKNMQRCKEEEERKIRLE--------AMLKDQRERERRAKKGTKGSVSEEVGEFDDLVSALRSGEVF-DKDSKLKRN-----RKRSVNQLADAGGRERSVTKMNY 1028          
BLAST of Diaphanous vs. Ensembl Zebrafish
Match: daam2 (dishevelled associated activator of morphogenesis 2 [Source:ZFIN;Acc:ZDB-GENE-070709-1])

HSP 1 Score: 73.559 bits (179), Expect = 1.426e-12
Identity = 97/420 (23.10%), Postives = 204/420 (48.57%), Query Frame = 2
Query: 2252 VKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFK-VITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK--IVGITLDSLAKFVDTKDNCNGN--LLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDS-INLRSE-----ISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLK-SIFKQSAFIENAIIGISSGKIFCDEDSVLNWNVQYHRRENQKNRVRNA----RNIRRLNF 3463
            VK L V+D + AQN  I L  + M NEE+  A+ +M+ +  +  DM+ +L+ ++P+ S +  LE  K ++E +   ++F+  +  +D+Y+ R   +  +   + D L E +   + +  +  +++ S  L+ VLE+V+     MN  ++    G  + SL K +DTK + + N  +L +L+       P+ L +  DL S+  A++++   +   V+   + LK+L+ ++    S +  R +     +S  + +A    S +  L NE   K+    ++FG  +     ++ F    +F   F  +      R  L  + + K E   K++++        A++    + E+ ++K  K S+ ++    ++ +  + SG++F D+DS L  N     R+   N++ +A    R++ ++N+
Sbjct:  620 VKELSVIDGRRAQNCVILLSKLKMSNEELKRAVLEMDEREELAKDMLEQLLKFVPEKSDMDLLEEHKHELERMARADRFLFEMSRIDHYQQRLQSLFFKKKFA-DRLAETKPKAEAILCASREVMRSKLLRQVLEVVLAFGNFMNKGQRGNAYGFKVSSLNKIIDTKSSIDRNITMLHYLIMIFEKNYPDILSIQQDLCSVSEAAKVNLAELEKEVSSIRSGLKALEVELRYQQSRVCDRGDKFVPVVSDFITVASFSFSELEELLNEAKDKFSMALKHFGEEEGRMQPDEFFGIFDIFLQSFSEA------RHDLKNMQRCKEEEERKIRLE--------AMLKDQRERERRAKKGTKGSVSEEVGEFDDLVSALRSGEVF-DKDSKLKRN-----RKRSVNQLADAGGRERSVTKMNY 1018          
BLAST of Diaphanous vs. Ensembl Xenopus
Match: DIAPH1 (diaphanous related formin 1 [Source:NCBI gene;Acc:733754])

HSP 1 Score: 100.138 bits (248), Expect = 9.997e-21
Identity = 116/407 (28.50%), Postives = 203/407 (49.88%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASK---KAAE-------FKTKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENI-------DSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQ---KMESINKMQIQQFQQSDQL 3241
             KR N + I    L+EKS W Q  +     +++  K+   F+S+   K AE        + K  K L VLDSK AQN  IFL S  M  EEI N I ++N +V+T  M++ L+  +P+  QL  L  FK++ +DL   EQF V +  V   + R N I  ++L  N+ ++ ++  +  + ++ E++       S+LE+ + +   MN   +     G  +  L K  DTK  +    LL FLVE   +  P+ LK  D++  ++ ASR+S++++   ++Q    +  LQ DI++        D    +  IS   +L K + + +  +   + S +Q++ +YF         E+ F+DL+ F+N F ++ K   +R++  E  K+     E   K ++++ Q+ +QL
Sbjct:  245 LKRPNWSKITPAELSEKSFWTQTKEDRFEKEELFAKITLTFSSQIKSKKAEDGDDKKAAQKKKTKELKVLDSKTAQNLSIFLGSFRMPYEEIKNVILQVNEEVLTESMVSNLIKQLPEPDQLQMLTEFKNEYKDLAEPEQFGVVMCSVPRLRPRLNAILFKLLF-NEQIENIKPDIVSVTAACEEVQKCQSFASLLEITLLVGNFMNAGSRNADAYGFDISFLCKLKDTKSADQKTTLLHFLVETCENDYPDVLKFPDEMVHVEKASRVSAETLQKNLDQMKKQIADLQRDIDSFPPTEDEKDKFVEKMTISFYYKLIK-IYTKLCMMHENMLSLFQDLGKYFVFDPKKTSIEEFFADLQNFRNMFLHALKENQKRREAEEKMKRAKLAKEKAEKERLEKQQKKEQL 649          
BLAST of Diaphanous vs. Ensembl Xenopus
Match: DIAPH2 (diaphanous related formin 2 [Source:NCBI gene;Acc:100485481])

HSP 1 Score: 79.337 bits (194), Expect = 3.273e-14
Identity = 107/396 (27.02%), Postives = 184/396 (46.46%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFA----SKKAAE--------FKTKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTK-DNCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENI-------DSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQF------KNSEKIIYERQKLNEIHKQKME 3193
             KRIN + +    + E  IW++  +      +I  +L   FA    +KKA E           K VK L VLDSK AQN  IFL S  M  EEI + I +++ + ++  +I  L+  +P+  +L  L   K + EDL   EQF V +  +   + R NGI  + L  ++ +  ++  +  +  + E+L  S+  K ++E+V+ +   MN   +    +G  +  L K  DTK  +    LL FL E   +   E LK  D+L+ ++SAS++S+ ++ S ++     +K L+ DI+N        D    +    +  + A+     +S + N ++  Y  + +Y          E+ F DL  F+  F       N  + + E+ K  +I K+K E
Sbjct:  587 MKRINWSKVEPQDITETCIWVKAKEDHFENPEIFTRLSQMFATHMKAKKATEQAEENKPTLIKKKVKELRVLDSKTAQNLSIFLGSYRMSYEEIKSMILEVDEEKLSESLIQNLIKNLPEQKELSALSQLKSEYEDLCEPEQFGVVMSTIKMLRSRLNGILFK-LTFDEHISNIKPDIIAVTLACEELKKSESFKKIVELVLLVGNYMNSGSRNAQSLGFNVSFLCKIRDTKSSDQKTTLLHFLAEICEERFKEILKFPDELEHVESASKVSAQNLKSSLDAMEHQIKRLEGDIKNFTKTDNPNDKFVEKMTTYIFAKGAREQYEKLSNMYNHMNKLYDNLGDYLTFDAKAVSVEEFFGDLSSFRTLFLEAVKENNKRREMEEKMKRAKIAKEKAE 981          

HSP 2 Score: 66.6254 bits (161), Expect = 2.532e-10
Identity = 43/135 (31.85%), Postives = 67/135 (49.63%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLINE-NASNKIISSFTKFTQ-RPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYL 904
            +++CLK+F NN +G+ R+  ED    +L + I  +    +   L +LS IC+I E N  +K++ + T   +   + RF P++  L N     +Q S M FIN LL S      E    R+ LR E    G +  L
Sbjct:  192 LIQCLKAFMNNKYGLQRILSEDRSLLLLARAIDPKQANMMTEILKILSAICIIGEDNILDKLLEAITTAAEIHNKERFAPIVEALENHEAFQLQASCMQFINALLTSP-----EELDFRIHLRNEFLRCGLKQIL 321          
BLAST of Diaphanous vs. Ensembl Xenopus
Match: DIAPH2 (diaphanous related formin 2 [Source:NCBI gene;Acc:100485481])

HSP 1 Score: 78.9518 bits (193), Expect = 4.569e-14
Identity = 109/394 (27.66%), Postives = 189/394 (47.97%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFA----SKKAAE--------FKTKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTK-DNCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIEN---IDSINLR--SEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQF------KNSEKIIYERQKLNEIHKQKME 3193
             KRIN + +    + E  IW++  +      +I  +L   FA    +KKA E           K VK L VLDSK AQN  IFL S  M  EEI + I +++ + ++  +I  L+  +P+  +L  L   K + EDL   EQF V +  +   + R NGI  + L  ++ +  ++  +  +  + E+L  S+  K ++E+V+ +   MN   +    +G  +  L K  DTK  +    LL FL E   +   E LK  D+L+ ++SAS++S+ ++ S ++     +K L+ DI+N    D+ N +   ++S++  L +     +S + N ++  Y  + +Y          E+ F DL  F+  F       N  + + E+ K  +I K+K E
Sbjct:  577 MKRINWSKVEPQDITETCIWVKAKEDHFENPEIFTRLSQMFATHMKAKKATEQAEENKPTLIKKKVKELRVLDSKTAQNLSIFLGSYRMSYEEIKSMILEVDEEKLSESLIQNLIKNLPEQKELSALSQLKSEYEDLCEPEQFGVVMSTIKMLRSRLNGILFK-LTFDEHISNIKPDIIAVTLACEELKKSESFKKIVELVLLVGNYMNSGSRNAQSLGFNVSFLCKIRDTKSSDQKTTLLHFLAEICEERFKEILKFPDELEHVESASKVSAQNLKSSLDAMEHQIKRLEGDIKNFTKTDNPNDKFVEKMSISF-LYREQYEKLSNMYNHMNKLYDNLGDYLTFDAKAVSVEEFFGDLSSFRTLFLEAVKENNKRREMEEKMKRAKIAKEKAE 968          

HSP 2 Score: 66.6254 bits (161), Expect = 2.697e-10
Identity = 43/135 (31.85%), Postives = 67/135 (49.63%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLINE-NASNKIISSFTKFTQ-RPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYL 904
            +++CLK+F NN +G+ R+  ED    +L + I  +    +   L +LS IC+I E N  +K++ + T   +   + RF P++  L N     +Q S M FIN LL S      E    R+ LR E    G +  L
Sbjct:  182 LIQCLKAFMNNKYGLQRILSEDRSLLLLARAIDPKQANMMTEILKILSAICIIGEDNILDKLLEAITTAAEIHNKERFAPIVEALENHEAFQLQASCMQFINALLTSP-----EELDFRIHLRNEFLRCGLKQIL 311          
BLAST of Diaphanous vs. Ensembl Xenopus
Match: DIAPH1 (diaphanous related formin 1 [Source:NCBI gene;Acc:733754])

HSP 1 Score: 77.7962 bits (190), Expect = 1.099e-13
Identity = 114/437 (26.09%), Postives = 200/437 (45.77%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKTKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENI-------DSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQ---KMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGKIF 3361
             KR N + I    L+EKS W Q  K       I   LF R   K A                       IFL S  M  EEI N I ++N +V+T  M++ L+  +P+  QL  L  FK++ +DL   EQF V +  V   + R N I  ++L  N+ ++ ++  +  + ++ E++       S+LE+ + +   MN   +     G  +  L K  DTK  +    LL FLVE   +  P+ LK  D++  ++ ASR+S++++   ++Q    +  LQ DI++        D    +  IS   +L K + + +  +   + S +Q++ +YF         E+ F+DL+ F+N F ++ K   +R++  E  K+     E   K ++++ Q+ +QL  + +  D     +  L+++   +AF      G   GK F
Sbjct:  728 LKRPNWSKITPAELSEKSFWTQ-TKEDPKIPCISCVLFLRSVKKWAGS---------------------IFLGSFRMPYEEIKNVILQVNEEVLTESMVSNLIKQLPEPDQLQMLTEFKNEYKDLAEPEQFGVVMCSVPRLRPRLNAILFKLLF-NEQIENIKPDIVSVTAACEEVQKCQSFASLLEITLLVGNFMNAGSRNADAYGFDISFLCKLKDTKSADQKTTLLHFLVETCENDYPDVLKFPDEMVHVEKASRVSAETLQKNLDQMKKQIADLQRDIDSFPPTEDEKDKFVEKMTISFYYKLIK-IYTKLCMMHENMLSLFQDLGKYFVFDPKKTSIEEFFADLQNFRNMFLHALKENQKRREAEEKMKRAKLAKEKAEKERLEKQQKKEQLIDMNAEGDETGVMDSLLEALNSGAAFRRKR--GPRQGKSF 1138          

HSP 2 Score: 56.9954 bits (136), Expect = 2.392e-7
Identity = 59/228 (25.88%), Postives = 105/228 (46.05%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGI-LRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLI--NENASNKIISSFT-KFTQRPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEFDFDFLKLQTRLTTLSLCEKEWNKMIHDENSKESSMISFMHLIIFLFDKDKKN-----IDEII 1162
            I++CLK+F NN+FGI   L  ED +  +L + +       +I +L LLS +C++   E+   +++ + T +       RFKPL+  L   + + ++ S M  IN ++        E    R+ +R EL   G    L+  R + ++ L  Q  IF   S +D ++       L+ RL  + L        + D +++   +    HL++   D D +      IDE+I
Sbjct:  163 IIRCLKAFMNNNFGIKAMLGTEDGIL-LLARAVDRSVPAMMIDSLKLLSALCILPQPEDMHERVLEALTERAEMEEMERFKPLLDGLNIASPVALKVSCMQLINAVISQG-----EELDYRVHIRSELMRSGLAKLLKELRNTENEDLKVQLGIFDEHSELDSDD-------LRGRLDDILLL-----NTVKDSSAEPLFLSILQHLLLIRNDYDARPQYYKLIDEVI 372          
BLAST of Diaphanous vs. Ensembl Xenopus
Match: DIAPH1 (diaphanous related formin 1 [Source:NCBI gene;Acc:733754])

HSP 1 Score: 76.6406 bits (187), Expect = 2.103e-13
Identity = 106/397 (26.70%), Postives = 185/397 (46.60%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKTKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENI-------DSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQ---KMESINKMQIQQFQQSDQL 3241
             KR N + I    L+EKS W Q  K       I   LF R   K A                       IFL S  M  EEI N I ++N +V+T  M++ L+  +P+  QL  L  FK++ +DL   EQF V +  V   + R N I  ++L  N+ ++ ++  +  + ++ E++       S+LE+ + +   MN   +     G  +  L K  DTK  +    LL FLVE   +  P+ LK  D++  ++ ASR+S++++   ++Q    +  LQ DI++        D    +  IS   +L K + + +  +   + S +Q++ +YF         E+ F+DL+ F+N F ++ K   +R++  E  K+     E   K ++++ Q+ +QL
Sbjct:  734 LKRPNWSKITPAELSEKSFWTQ-TKEDPKIPCISCVLFLRSVKKWAGS---------------------IFLGSFRMPYEEIKNVILQVNEEVLTESMVSNLIKQLPEPDQLQMLTEFKNEYKDLAEPEQFGVVMCSVPRLRPRLNAILFKLLF-NEQIENIKPDIVSVTAACEEVQKCQSFASLLEITLLVGNFMNAGSRNADAYGFDISFLCKLKDTKSADQKTTLLHFLVETCENDYPDVLKFPDEMVHVEKASRVSAETLQKNLDQMKKQIADLQRDIDSFPPTEDEKDKFVEKMTISFYYKLIK-IYTKLCMMHENMLSLFQDLGKYFVFDPKKTSIEEFFADLQNFRNMFLHALKENQKRREAEEKMKRAKLAKEKAEKERLEKQQKKEQL 1106          
BLAST of Diaphanous vs. Ensembl Mouse
Match: Diaph2 (diaphanous related formin 2 [Source:MGI Symbol;Acc:MGI:1858500])

HSP 1 Score: 81.6481 bits (200), Expect = 4.677e-15
Identity = 114/471 (24.20%), Postives = 216/471 (45.86%), Query Frame = 2
Query: 2090 SFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKT------------KFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN-----LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQ-QSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGKIFCDEDSVLNWNVQYHRRENQKNRVRN 3436
              KRIN + I    L+E  +WL+L +       +  KL   F S+   +  T            K VK L +LD+K AQN  IFL S  M  EEI N I ++N ++++  +I  LV Y+PD + L +L   K + +DL   EQF V +  V   + R   I  + L   + +  ++ S+  +  + E+L  S+  K +LE+++ +   MN   +    +G  ++ L K  DTK  +    LL FL E   +   + LK  D+L+ ++SA ++S+  + S +      +  L+ +I+N             ++ +  + A+     +S + + +   Y+ + EYF    +    E+ F DL  F+  F  + K  ++R+++ E  ++   +  K + ++ + Q  +  +I  + +G+            ++  ++N +  + SG  F D    +  N    R   +++R R+
Sbjct:  638 PMKRINWSKIEPKELSENCVWLKLKEEKYENADLFAKLALTFPSQMKGQRNTEAAEENRSGPPKKKVKELRILDTKTAQNLSIFLGSYRMPYEEIKNIILEVNEEMLSEALIQNLVKYLPDQNALRELAQLKSEYDDLCEPEQFGVVMSTVKMLRPRLTSILFK-LTFEEHVNNIKPSIIAVTLACEELKKSESFKRLLELILLVGNYMNSGSRNAQSLGFKINFLCKIKDTKSADQKSTLLHFLAEICDEKYRDILKFPDELEHVESAGKVSAQILKSNLVAMEQSILHLEKNIKNFPPAESHHDKFVEKMMIFTQNAREQYDKLSTMHSNMLKLYESLGEYFIFDPNTVNMEEFFGDLNTFRTLFLEALKENHKRKEMEEKSRRAKLAKEKAEQEKLERQKKKKQLIDINKEGD------------ETGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRPPLERSRSRH 1095          

HSP 2 Score: 67.0106 bits (162), Expect = 1.573e-10
Identity = 44/164 (26.83%), Postives = 78/164 (47.56%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLIN-ENASNKIISSFTKFTQ-RPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEF 991
            +++CLK+F NN FG+ R+  ++    +L + I  +    +   + +LS IC++  EN  +K++   T   +     RF P++  L N   + +Q + M FIN L+ S Y         R+ LR E    G ++ L   +E  ++ L  Q  +F      D+ E 
Sbjct:  236 VIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQQNMMTEIVKILSAICIVGEENILDKLLGGITAAAELNNRERFSPIVEGLENNEALHLQVACMQFINALVTSPY-----DLDFRIHLRNEFLRCGLKAMLPTLKEIENEGLDIQLRVFEENKEDDLSEL 394          
BLAST of Diaphanous vs. Ensembl Mouse
Match: Diaph2 (diaphanous related formin 2 [Source:MGI Symbol;Acc:MGI:1858500])

HSP 1 Score: 81.2629 bits (199), Expect = 6.958e-15
Identity = 115/471 (24.42%), Postives = 215/471 (45.65%), Query Frame = 2
Query: 2090 SFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKT------------KFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSEISVT-----VELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQ-QSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGKIFCDEDSVLNWNVQYHRRENQKNRVRN 3436
              KRIN + I    L+E  +WL+L +       +  KL   F S+   +  T            K VK L +LD+K AQN  IFL S  M  EEI N I ++N ++++  +I  LV Y+PD + L +L   K + +DL   EQF V +  V   + R   I  + L   + +  ++ S+  +  + E+L  S+  K +LE+++ +   MN   +    +G  ++ L K  DTK  +    LL FL E   +   + LK  D+L+ ++SA ++S+  + S +      +  L+ +I+N        +  V       + A+     +S + + +   Y+ + EYF    +    E+ F DL  F+  F  + K  ++R+++ E  ++   +  K + ++ + Q  +  +I  + +G+            ++  ++N +  + SG  F D    +  N    R   +++R R+
Sbjct:  634 PMKRINWSKIEPKELSENCVWLKLKEEKYENADLFAKLALTFPSQMKGQRNTEAAEENRSGPPKKKVKELRILDTKTAQNLSIFLGSYRMPYEEIKNIILEVNEEMLSEALIQNLVKYLPDQNALRELAQLKSEYDDLCEPEQFGVVMSTVKMLRPRLTSILFK-LTFEEHVNNIKPSIIAVTLACEELKKSESFKRLLELILLVGNYMNSGSRNAQSLGFKINFLCKIKDTKSADQKSTLLHFLAEICDEKYRDILKFPDELEHVESAGKVSAQILKSNLVAMEQSILHLEKNIKNFPPAESHHDKFVEKMMSFTQNAREQYDKLSTMHSNMLKLYESLGEYFIFDPNTVNMEEFFGDLNTFRTLFLEALKENHKRKEMEEKSRRAKLAKEKAEQEKLERQKKKKQLIDINKEGD------------ETGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRPPLERSRSRH 1091          

HSP 2 Score: 67.0106 bits (162), Expect = 1.519e-10
Identity = 44/164 (26.83%), Postives = 78/164 (47.56%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLIN-ENASNKIISSFTKFTQ-RPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEF 991
            +++CLK+F NN FG+ R+  ++    +L + I  +    +   + +LS IC++  EN  +K++   T   +     RF P++  L N   + +Q + M FIN L+ S Y         R+ LR E    G ++ L   +E  ++ L  Q  +F      D+ E 
Sbjct:  232 VIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQQNMMTEIVKILSAICIVGEENILDKLLGGITAAAELNNRERFSPIVEGLENNEALHLQVACMQFINALVTSPY-----DLDFRIHLRNEFLRCGLKAMLPTLKEIENEGLDIQLRVFEENKEDDLSEL 390          
BLAST of Diaphanous vs. Ensembl Mouse
Match: Diaph2 (diaphanous related formin 2 [Source:MGI Symbol;Acc:MGI:1858500])

HSP 1 Score: 80.8777 bits (198), Expect = 9.066e-15
Identity = 115/471 (24.42%), Postives = 215/471 (45.65%), Query Frame = 2
Query: 2090 SFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKT------------KFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSEISVT-----VELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQ-QSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGKIFCDEDSVLNWNVQYHRRENQKNRVRN 3436
              KRIN + I    L+E  +WL+L +       +  KL   F S+   +  T            K VK L +LD+K AQN  IFL S  M  EEI N I ++N ++++  +I  LV Y+PD + L +L   K + +DL   EQF V +  V   + R   I  + L   + +  ++ S+  +  + E+L  S+  K +LE+++ +   MN   +    +G  ++ L K  DTK  +    LL FL E   +   + LK  D+L+ ++SA ++S+  + S +      +  L+ +I+N        +  V       + A+     +S + + +   Y+ + EYF    +    E+ F DL  F+  F  + K  ++R+++ E  ++   +  K + ++ + Q  +  +I  + +G+            ++  ++N +  + SG  F D    +  N    R   +++R R+
Sbjct:  638 PMKRINWSKIEPKELSENCVWLKLKEEKYENADLFAKLALTFPSQMKGQRNTEAAEENRSGPPKKKVKELRILDTKTAQNLSIFLGSYRMPYEEIKNIILEVNEEMLSEALIQNLVKYLPDQNALRELAQLKSEYDDLCEPEQFGVVMSTVKMLRPRLTSILFK-LTFEEHVNNIKPSIIAVTLACEELKKSESFKRLLELILLVGNYMNSGSRNAQSLGFKINFLCKIKDTKSADQKSTLLHFLAEICDEKYRDILKFPDELEHVESAGKVSAQILKSNLVAMEQSILHLEKNIKNFPPAESHHDKFVEKMMSFTQNAREQYDKLSTMHSNMLKLYESLGEYFIFDPNTVNMEEFFGDLNTFRTLFLEALKENHKRKEMEEKSRRAKLAKEKAEQEKLERQKKKKQLIDINKEGD------------ETGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRPPLERSRSRH 1095          

HSP 2 Score: 67.0106 bits (162), Expect = 1.508e-10
Identity = 44/164 (26.83%), Postives = 78/164 (47.56%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLIN-ENASNKIISSFTKFTQ-RPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEF 991
            +++CLK+F NN FG+ R+  ++    +L + I  +    +   + +LS IC++  EN  +K++   T   +     RF P++  L N   + +Q + M FIN L+ S Y         R+ LR E    G ++ L   +E  ++ L  Q  +F      D+ E 
Sbjct:  236 VIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQQNMMTEIVKILSAICIVGEENILDKLLGGITAAAELNNRERFSPIVEGLENNEALHLQVACMQFINALVTSPY-----DLDFRIHLRNEFLRCGLKAMLPTLKEIENEGLDIQLRVFEENKEDDLSEL 394          
BLAST of Diaphanous vs. Ensembl Mouse
Match: Diaph1 (diaphanous related formin 1 [Source:MGI Symbol;Acc:MGI:1194490])

HSP 1 Score: 78.5666 bits (192), Expect = 5.430e-14
Identity = 92/335 (27.46%), Postives = 169/335 (50.45%), Query Frame = 2
Query: 2273 DSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN-----LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE-IHKQKM--ESINKMQIQQFQQSDQL 3241
            DSK AQN  IFL S  M  +EI N I ++N  V+T  MI  L+  MP+  QL  L   K++ +DL   EQF V +  V   + R N I  ++  S   ++ ++  +  + ++ E+L  S+   S+LE+ + +   MN   +     G  +  L K  DTK  +    LL FL E   +  PE LK  D+L  ++ ASR+S++++   ++Q    +  ++ D++N  +          +++  V+ A+   + +  + + +++ Y+E+ +YF         E+ F DL  F+N F  + K   +R++  E + + K+  E   K ++++ Q+ +QL
Sbjct:  836 DSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQ-VENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQL 1169          

HSP 2 Score: 68.1662 bits (165), Expect = 6.504e-11
Identity = 49/181 (27.07%), Postives = 87/181 (48.07%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLI--NENASNKIISSFTKFTQRPEC-RFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEFDFDFLKLQTRLTTLSL 1039
            I++CLK+F NN FGI  + E +    +L + +       +I A  LLS +C++   E+ + +++ + T+  +  E  RF+PL+  L +   I ++   +  IN L+        E    R+ +R EL  LG    L+  RE  ++ +  Q  +F        E+ D DF  L+ RL  + +
Sbjct:  208 IIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSIALKVGCLQLINALITPA-----EELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVF-------DEQGDEDFFDLKGRLDDIRM 376          
BLAST of Diaphanous vs. Ensembl Mouse
Match: Diaph1 (diaphanous related formin 1 [Source:MGI Symbol;Acc:MGI:1194490])

HSP 1 Score: 78.1814 bits (191), Expect = 5.523e-14
Identity = 92/335 (27.46%), Postives = 169/335 (50.45%), Query Frame = 2
Query: 2273 DSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN-----LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE-IHKQKM--ESINKMQIQQFQQSDQL 3241
            DSK AQN  IFL S  M  +EI N I ++N  V+T  MI  L+  MP+  QL  L   K++ +DL   EQF V +  V   + R N I  ++  S   ++ ++  +  + ++ E+L  S+   S+LE+ + +   MN   +     G  +  L K  DTK  +    LL FL E   +  PE LK  D+L  ++ ASR+S++++   ++Q    +  ++ D++N  +          +++  V+ A+   + +  + + +++ Y+E+ +YF         E+ F DL  F+N F  + K   +R++  E + + K+  E   K ++++ Q+ +QL
Sbjct:  836 DSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQ-VENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQL 1169          

HSP 2 Score: 68.1662 bits (165), Expect = 6.960e-11
Identity = 49/181 (27.07%), Postives = 87/181 (48.07%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLI--NENASNKIISSFTKFTQRPEC-RFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEFDFDFLKLQTRLTTLSL 1039
            I++CLK+F NN FGI  + E +    +L + +       +I A  LLS +C++   E+ + +++ + T+  +  E  RF+PL+  L +   I ++   +  IN L+        E    R+ +R EL  LG    L+  RE  ++ +  Q  +F        E+ D DF  L+ RL  + +
Sbjct:  208 IIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSIALKVGCLQLINALITPA-----EELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVF-------DEQGDEDFFDLKGRLDDIRM 376          
BLAST of Diaphanous vs. UniProt/SwissProt
Match: sp|P48608|DIA_DROME (Protein diaphanous OS=Drosophila melanogaster OX=7227 GN=dia PE=2 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 1.830e-19
Identity = 100/427 (23.42%), Postives = 211/427 (49.41%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAA-EFKTKFVKP---------LIVLDSKNAQNFEIFLRSV--NMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKDNCNG-NLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIEN-----IDSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKI-IYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFK 3307
             KR N   I    +++K+ W++  +  L+ D  + +L  +F+SK    E K    KP         L VLDSK AQN  I L     ++  E+I   + + +  +++ +++ +L+ Y+P    L +L+  K K E L   EQF   + E+     R + ++ ++  + D +++++  +    ++ E++ +S K   +LE+++ +   MN   K     G  +  L K  +TKD  N   LL +L + +    P++L  +DDL  ++ ASR++ D+I   + Q ++ +K+L+ D++N      D       +    E  +  +  +  +Q +++  Y+++ EY+    S Y  E+ F+D+K FK+ F+ +    +  R++L +  K++++   +   ++ Q+  Q    +  +D  ++ E  + S+ +
Sbjct:  611 MKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVKKEQKDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLTYA-DMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNTKDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFADIKTFKDAFQAAHNDNVRVREELEK--KRRLQEAREQSAREQQERQQRKKAVVDMDAPQTQEGVMDSLLE 1034          
BLAST of Diaphanous vs. UniProt/SwissProt
Match: sp|O70566|DIAP2_MOUSE (Protein diaphanous homolog 2 OS=Mus musculus OX=10090 GN=Diaph2 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 4.867e-14
Identity = 115/471 (24.42%), Postives = 215/471 (45.65%), Query Frame = 2
Query: 2090 SFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKT------------KFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSEISVT-----VELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQ-QSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGKIFCDEDSVLNWNVQYHRRENQKNRVRN 3436
              KRIN + I    L+E  +WL+L +       +  KL   F S+   +  T            K VK L +LD+K AQN  IFL S  M  EEI N I ++N ++++  +I  LV Y+PD + L +L   K + +DL   EQF V +  V   + R   I  + L   + +  ++ S+  +  + E+L  S+  K +LE+++ +   MN   +    +G  ++ L K  DTK  +    LL FL E   +   + LK  D+L+ ++SA ++S+  + S +      +  L+ +I+N        +  V       + A+     +S + + +   Y+ + EYF    +    E+ F DL  F+  F  + K  ++R+++ E  ++   +  K + ++ + Q  +  +I  + +G+            ++  ++N +  + SG  F D    +  N    R   +++R R+
Sbjct:  634 PMKRINWSKIEPKELSENCVWLKLKEEKYENADLFAKLALTFPSQMKGQRNTEAAEENRSGPPKKKVKELRILDTKTAQNLSIFLGSYRMPYEEIKNIILEVNEEMLSEALIQNLVKYLPDQNALRELAQLKSEYDDLCEPEQFGVVMSTVKMLRPRLTSILFK-LTFEEHVNNIKPSIIAVTLACEELKKSESFKRLLELILLVGNYMNSGSRNAQSLGFKINFLCKIKDTKSADQKSTLLHFLAEICDEKYRDILKFPDELEHVESAGKVSAQILKSNLVAMEQSILHLEKNIKNFPPAESHHDKFVEKMMSFTQNAREQYDKLSTMHSNMLKLYESLGEYFIFDPNTVNMEEFFGDLNTFRTLFLEALKENHKRKEMEEKSRRAKLAKEKAEQEKLERQKKKKQLIDINKEGD------------ETGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRPPLERSRSRH 1091          

HSP 2 Score: 67.0106 bits (162), Expect = 1.062e-9
Identity = 44/164 (26.83%), Postives = 78/164 (47.56%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLIN-ENASNKIISSFTKFTQ-RPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEF 991
            +++CLK+F NN FG+ R+  ++    +L + I  +    +   + +LS IC++  EN  +K++   T   +     RF P++  L N   + +Q + M FIN L+ S Y         R+ LR E    G ++ L   +E  ++ L  Q  +F      D+ E 
Sbjct:  232 VIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQQNMMTEIVKILSAICIVGEENILDKLLGGITAAAELNNRERFSPIVEGLENNEALHLQVACMQFINALVTSPY-----DLDFRIHLRNEFLRCGLKAMLPTLKEIENEGLDIQLRVFEENKEDDLSEL 390          
BLAST of Diaphanous vs. UniProt/SwissProt
Match: sp|O60610|DIAP1_HUMAN (Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 1.766e-13
Identity = 92/335 (27.46%), Postives = 170/335 (50.75%), Query Frame = 2
Query: 2273 DSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN-----LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE-IHKQKM--ESINKMQIQQFQQSDQL 3241
            DSK AQN  IFL S  M  +EI N I ++N  V+T  MI  L+  MP+  QL  L   KD+ +DL   EQF V +  V   + R N I  ++  S + ++ ++  +  + ++ E+L  S+   ++LE+ + +   MN   +     G  +  L K  DTK  +    LL FL E   +  P+ LK  D+L  ++ ASR+S++++   ++Q    +  ++ D++N  +          +++  V+ A+   + +  + + +++ Y+E+ EYF         E+ F DL  F+N F  + K   +R++  E + + K+  E   K ++++ Q+ +QL
Sbjct:  853 DSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFS-EQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQL 1186          

HSP 2 Score: 66.2402 bits (160), Expect = 2.009e-9
Identity = 43/154 (27.92%), Postives = 77/154 (50.00%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLI--NENASNKIISSFTKFTQRPEC-RFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIF 958
            I++CLK+F NN FGI  + E +    +L + +       +I A  LLS +C++   E+ + +++ + T+  +  E  RF+PL+  L +   I ++   +  IN L+        E    R+ +R EL  LG    L+  RE  ++ +  Q N+F
Sbjct:  217 IIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTTIALKVGCLQLINALITPA-----EELDFRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVF 365          
BLAST of Diaphanous vs. UniProt/SwissProt
Match: sp|O08808|DIAP1_MOUSE (Protein diaphanous homolog 1 OS=Mus musculus OX=10090 GN=Diaph1 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.798e-13
Identity = 92/335 (27.46%), Postives = 169/335 (50.45%), Query Frame = 2
Query: 2273 DSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN-----LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE-IHKQKM--ESINKMQIQQFQQSDQL 3241
            DSK AQN  IFL S  M  +EI N I ++N  V+T  MI  L+  MP+  QL  L   K++ +DL   EQF V +  V   + R N I  ++  S   ++ ++  +  + ++ E+L  S+   S+LE+ + +   MN   +     G  +  L K  DTK  +    LL FL E   +  PE LK  D+L  ++ ASR+S++++   ++Q    +  ++ D++N  +          +++  V+ A+   + +  + + +++ Y+E+ +YF         E+ F DL  F+N F  + K   +R++  E + + K+  E   K ++++ Q+ +QL
Sbjct:  836 DSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQ-VENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQL 1169          

HSP 2 Score: 68.1662 bits (165), Expect = 4.550e-10
Identity = 49/181 (27.07%), Postives = 87/181 (48.07%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLI--NENASNKIISSFTKFTQRPEC-RFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEFDFDFLKLQTRLTTLSL 1039
            I++CLK+F NN FGI  + E +    +L + +       +I A  LLS +C++   E+ + +++ + T+  +  E  RF+PL+  L +   I ++   +  IN L+        E    R+ +R EL  LG    L+  RE  ++ +  Q  +F        E+ D DF  L+ RL  + +
Sbjct:  208 IIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSIALKVGCLQLINALITPA-----EELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVF-------DEQGDEDFFDLKGRLDDIRM 376          
BLAST of Diaphanous vs. UniProt/SwissProt
Match: sp|F1M775|DIAP1_RAT (Protein diaphanous homolog 1 OS=Rattus norvegicus OX=10116 GN=Diaph1 PE=1 SV=3)

HSP 1 Score: 75.8702 bits (185), Expect = 2.199e-12
Identity = 91/335 (27.16%), Postives = 169/335 (50.45%), Query Frame = 2
Query: 2273 DSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSIN-----LRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE-IHKQKM--ESINKMQIQQFQQSDQL 3241
            DSK AQN  IFL S  M  +EI N I ++N  V+T  MI  L+  MP+  QL  L   K++ +DL   EQF V +  V   + R N I  ++  S + ++ ++  +  + ++ E+L  S+   S+LE+ + +   MN   +     G  +  L K  DTK  +    LL FL E      P+ LK  D+L  ++ ASR+S++++   ++Q    +  ++ D++N  +          +++  V+ A+   + +  + + +++ Y+E+ +YF         E+ F DL  F+N F  + K   +R++  E + + K+  E   K ++++ Q+ +QL
Sbjct:  846 DSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFS-EQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCETDHPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQL 1179          

HSP 2 Score: 71.633 bits (174), Expect = 4.084e-11
Identity = 50/181 (27.62%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLI--NENASNKIISSFTKFTQRPEC-RFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEFDFDFLKLQTRLTTLSL 1039
            I++CLK+F NN FGI  + E +    +L + +       +I A  LLS +C++   E+ + +++ + T+  +  E  RF+PL+  L +   I ++   +  IN L+        E    R+ +R EL  LG    L+  RE ++  +  Q N+F        E+ D DF  L+ RL  + +
Sbjct:  217 IIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMEEVERFQPLLDGLKSGTSIALKVGCLQLINALITPA-----EELDFRVHIRSELMRLGLHQVLQELREIDNDDMRVQLNVF-------DEQGDEDFFDLKGRLDDIRM 385          
BLAST of Diaphanous vs. TrEMBL
Match: A0A1B0FIC1 (Uncharacterized protein OS=Glossina morsitans morsitans OX=37546 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.365e-21
Identity = 110/427 (25.76%), Postives = 216/427 (50.59%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASK-----------KAAEFKTKFVKPLIVLDSKNAQNFEIFLRSV--NMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKDNCNG-NLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSE--ISVTVELAKNLLSHISFL---QNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFK 3307
             K+ N   I    + EKS W++  +  L+++ ++ +L A+F+SK           KAA    K V  L VLDSK AQN  I L     ++  E+I   + + +  +++ +++ +L+ Y+P   QL +L+  K K E L   EQF   + E+     R + +H + L  +D +++V+ ++    ++ E++ +S K   +LE+++ +   MN   K     G  +  L K   TKD  N   LL +LV+ +    P++L  ++DL  +D ASR++ D++   + Q +  +K+L+ D++N  +     +    V  + A +    +  L   Q +++  ++++ EYF    + Y  E  F+D+K FK+ F ++ + I  R +  E  K +M+  +K  +++ Q+  Q  + L  +D  ++ E  + S+ +
Sbjct:  602 MKKANWKAILPHNITEKSFWIKCQEDKLASEDLLAELSAKFSSKPIKKEPKDSVDKAATLSKKNVD-LKVLDSKAAQNLSILLGGSLKHLSYEQIKICLLRCDTDILSYNILQQLIQYLPPPEQLKRLQDIKAKGEPLPPIEQFAATIGEIKRLLPRLHNLHFK-LTFDDQMQDVKPNIVAGTAACEEVRNSKKFSKILELILLMGNYMNSGSKSEPAYGFEISYLTKLTGTKDAENKQTLLHYLVDVVEKKFPDALTFYEDLSHVDKASRVNLDALQKSMRQMNAAVKNLETDLQNNKTPQCDDDKFCKVMGKFANDCRQQVDVLGKMQVQMEKLFKDLGEYFAFDPTKYTMEDFFADIKSFKDGFVHAHQEIV-RLRDEEKRKSRMQEAHKQSLREQQERQQRKLALVDIDAAQAQEGVMDSLME 1025          
BLAST of Diaphanous vs. TrEMBL
Match: A0A1B0ASA9 (Uncharacterized protein OS=Glossina palpalis gambiensis OX=67801 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 4.528e-21
Identity = 112/438 (25.57%), Postives = 218/438 (49.77%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASK-----------KAAEFKTKFVKPLIVLDSKNAQNFEIFLRSV--NMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKDNCNG-NLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENID----------------SINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFK 3307
             K+ N   I    ++EKS W++  +  L ++ ++ +L A+F+SK           KAA    K V  L VLDSK AQN  I L     ++  E+I   + + +  +++ +++ +L+ Y+P   QL +L+  K K E L   EQF   + E+     R + +H + L  +D +++V+ ++    ++ E++ +S K   +LE+++ +   MN   K     G  +  L K   TKD  N   LL FLV+ +    P++L  ++DL  +D ASR++ D +   + Q +  +K+L+ D++N                  + + R ++ V   L +   + I  +Q +++  ++++ EYF    + Y  E  F+D+K FK+ F ++ + I  R +  E  K +M+  +K  +++ Q+  Q  + L  +D  ++ E  + S+ +
Sbjct:  631 MKKANWKAILPHNISEKSFWVKCQEDKLVSEDLLAELSAKFSSKPIKKEPKDSVDKAATLSKKNVD-LKVLDSKAAQNLSILLGGSLKHLSYEQIKICLLRCDTDILSYNILQQLIQYLPPPEQLKRLQDIKAKGEPLPPIEQFAATIGEIKRLLPRLHNLHFK-LTFDDQMQDVKPNIVAGTAACEEVRNSKKFSKILELILLMGNYMNSGSKSEPAYGFEISYLTKLTGTKDAENKQTLLHFLVDVVEKKFPDALTFYEDLSHVDKASRVNLDVLQKSMRQMNAAVKNLETDLQNNKIPQCDDDKFCQVMGQFANDCRQQVDVLGMLGQK--AKIGKMQVQMEKLFKDLGEYFAFDPTKYTMEDFFADIKSFKDGFVHAHQEIV-RLRDEEKRKSRMQEAHKQSLREQQERQQRKLALVDIDAAQAQEGVMDSLME 1063          
BLAST of Diaphanous vs. TrEMBL
Match: A0A1B0AIR5 (Uncharacterized protein OS=Glossina pallidipes OX=7398 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 5.092e-21
Identity = 109/427 (25.53%), Postives = 216/427 (50.59%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASK-----------KAAEFKTKFVKPLIVLDSKNAQNFEIFLRSV--NMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKDNCNG-NLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIEN--IDSINLRSEISVTVELAKNLLSHISFL---QNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFK 3307
             K+ N   I    + EKS W++  +  L+++ ++ +L A+F+SK           KAA    K +  L VLDSK AQN  I L     ++  E+I   + + +  +++ +++ +L+ Y+P   QL +L+  K K E L   EQF   + E+     R + +H + L  +D +++V+ ++    ++ E++ +S K   +LE+++ +   MN   K     G  +  L K   TKD  N   LL +LV+ +    P++L  ++DL  +D ASR++ D++   + Q +  +K+L+ D++N  +   +      V  + A +    +  L   Q +++  ++++ EYF    + Y  E  F+D+K FK+ F ++ + I  R +  E  K +M+  +K  +++ Q+  Q  + L  +D  ++ E  + S+ +
Sbjct:  602 MKKANWKAILPHNITEKSFWIKCQEDKLASEDLLAELSAKFSSKPIKKEPKDSVDKAATLSKKNID-LKVLDSKAAQNLSILLGGSLKHLSYEQIKICLLRCDTDILSYNILQQLIQYLPPPEQLKRLQDIKAKGEPLPPIEQFAATIGEIKRLLPRLHNLHFK-LTFDDQMQDVKPNIVAGTAACEEVRNSKKFSKILELILLMGNYMNSGSKSEPAYGFEISYLTKLTGTKDAENKQTLLHYLVDVVEKKFPDALTFYEDLSHVDKASRVNLDALQKSMRQMNAAVKNLETDLQNNKMPQCDDDKFCKVMGKFANDCRQQVDVLGKMQVQMEKLFKDLGEYFAFDPTKYTMEDFFADIKSFKDGFVHAHQEII-RLRDEEKRKSRMQEAHKQSLREQQERQQRKLALVDIDAAQAQEGVMDSLME 1025          
BLAST of Diaphanous vs. TrEMBL
Match: A0A1A9V6Y0 (Uncharacterized protein OS=Glossina austeni OX=7395 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 6.978e-21
Identity = 109/427 (25.53%), Postives = 215/427 (50.35%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASK-----------KAAEFKTKFVKPLIVLDSKNAQNFEIFLRSV--NMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKDNCNG-NLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIEN--IDSINLRSEISVTVELAKNLLSHISFL---QNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFK 3307
             K+ N   I    + EKS W++  +  L+++ ++ +L A+F+SK           KAA    K +  L VLDSK AQN  I L     ++  E+I   + + +  +++ +++ +L+ Y+P   QL +L+  K K E L   EQF   + E+     R + +H + L  +D +++V+ ++    ++ E++ +S K   +LE+++ +   MN   K     G  +  L K   TKD  N   LL +LV+ +    P++L  ++DL  +D ASR++ D +   + Q +  +K+L+ D++N  +   +      V  + A +    +  L   Q +++  ++++ EYF    + Y  E  F+D+K FK+ F ++ + I  R +  E  K +M+  +K  +++ Q+  Q  + L  +D  ++ E  + S+ +
Sbjct:  602 MKKANWKAILPHNITEKSFWIKCQEDKLASEDLLAELSAKFSSKPIKKEPKDSVDKAATLSKKNID-LKVLDSKAAQNLSILLGGSLKHLSYEQIKICLLRCDTDILSYNILQQLIQYLPPPEQLKRLQDIKAKGEPLPPIEQFAATIGEIKRLLPRLHNLHFK-LTFDDQMQDVKPNIVAGTAACEEVRNSKKFSKILELILLMGNYMNSGSKSEPAYGFEISYLTKLTGTKDAENKQTLLHYLVDVVEKKFPDALTFYEDLSHVDKASRVNLDVLQKSMRQMNAAVKNLETDLQNNKMPQCDDDKFCKVMGKFANDCRQQVDVLGKMQVQMEKLFKDLGEYFAFDPTKYTMEDFFADIKSFKDGFVHAHQEIV-RLRDEEKRKSRMQEAHKQSLREQQERQQRKLALVDIDAAQAQEGVMDSLME 1025          
BLAST of Diaphanous vs. TrEMBL
Match: A0A482VYJ9 (Diaphanous (Fragment) OS=Asbolus verrucosus OX=1661398 GN=BDFB_001496 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.246e-20
Identity = 108/370 (29.19%), Postives = 186/370 (50.27%), Query Frame = 2
Query: 2111 TLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKT------------KFVKPLIVLDSKNAQNFEIFLRSV--NMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGI---HLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIEN--IDSINLRSEISVTVELAKNLLSHISFLQN---ELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEK 3142
            T++P   + EK+ W+++ +  L++  I+  L  +F+SK A + +             K VK L VLD K+AQN  I L     +M  +EI   + + + +V+T ++  +L+ Y+P   QL KL+ +K+K  +L   EQF V + EV     R   +   H  + + ND   ++  +     ++ +++  S K   +LE+++ +   MN   +     G  +  L K   TKD N    LL ++VE      PE L  +D++  +D ASR+S D+I   + Q  + +++LQ DI N  +   +    + V  + AK+       LQN   ++DS Y ++ EYF   K  Y  E+ F+DLK FK+ F N++K
Sbjct:  633 TIVPHK-MTEKAFWVKVQEEKLASSDILDGLAKKFSSKPAKKMEDVSENGNANTGTLKKVKELKVLDGKSAQNISILLGGSLKHMSYDEIKKCLLQCDDQVLTENVTEQLIQYLPPADQLAKLQQYKEKYNELTEAEQFCVKISEVKRLLPRLKSLGFKHHYVEMVNDTKPDIVAA----TAACDEVKKSKKFARILELILLLGNYMNTGSRNGQAFGFEMSFLTKLTGTKDVNNKQTLLHYIVETAEAKFPELLNFFDEMPHIDRASRVSLDTIQKTLKQMDSSIRNLQTDITNNRVPQGDDDKFLEVMEKFAKDAREQCDVLQNMFKKMDSLYTDLSEYFVFDKQKYTLEEFFTDLKTFKDNFINAKK 997          
BLAST of Diaphanous vs. Ensembl Cavefish
Match: diaph2 (diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-GENE-090115-1])

HSP 1 Score: 78.9518 bits (193), Expect = 2.596e-14
Identity = 92/375 (24.53%), Postives = 181/375 (48.27%), Query Frame = 2
Query: 2090 SFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKA---------AEFKTKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSEISV-TVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE 3172
            + KRIN + I    + E   W+++ +       +  +L   F+SK           A+FK K  K L +LD+K AQN  IFL S  ++ EEI + + +++ + ++  +I  L+  +P+  +L  L   K + E+L   EQF + +  V   + R NGI  + L   + +  +   +  +  + E++  S+    +LEM++ +   MN   +     G  +  L K  DTK  + N  LL FL E+  +  PE LK  D+L+ +++AS++S+  + + ++     ++ L+ DI+N    + + +  V  ++ ++     +S +   +   Y+ +  YF         E  F DL  F+  F ++ K  ++++++ E
Sbjct:  579 AMKRINWSKIVPQEMAENCFWIKVKEEKFENPDLFTELSLSFSSKTRGRAEFLFYFAQFKKK-AKELRILDAKTAQNLSIFLGSFRLRYEEIRDIVLEVDEERLSEALIQNLIKNLPEQKELSSLAELKGEYEELCESEQFGIVMSSVKLLRPRLNGILFK-LTFEEQVNNIRPDIMNVTFACEEVKKSEGFSKLLEMILLVGNYMNSGSRNAQTFGFNISFLCKIRDTKSADQNTTLLHFLAEKCEENFPEILKFPDELEHVENASKVSAQILKASLDTMERHIQRLENDIQNFPKTDDKQDKFVEKIKYSREQYEKLSTMHKNMQKLYESLGSYFAFDPHAVSIEDFFGDLANFRMLFLDAVKENHKKREMEE 951          

HSP 2 Score: 58.151 bits (139), Expect = 5.671e-8
Identity = 38/135 (28.15%), Postives = 68/135 (50.37%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLIN-ENASNKIISSFTKFTQR-PECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYL 904
            +++CLK+F NN +G+ R+  ++    +L + I  +    +   + +LS IC+I  EN  +KI+++ T   +R  + RF P++  L N     +Q + M  IN L+ S      +    R+ LR E    G +  L
Sbjct:  180 LIQCLKAFMNNKYGLQRILGDERSLLLLARAIDPKQPSMMTEIVKILSAICIIGEENILDKILAAMTIAAERNNKERFAPIVEGLENHEAQQLQTACMQLINALVTSP-----DDLDFRIHLRNEFLRCGLKKIL 309          
BLAST of Diaphanous vs. Ensembl Cavefish
Match: daam2 (dishevelled associated activator of morphogenesis 2 [Source:NCBI gene;Acc:103039904])

HSP 1 Score: 73.559 bits (179), Expect = 1.365e-12
Identity = 87/392 (22.19%), Postives = 185/392 (47.19%), Query Frame = 2
Query: 2252 VKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFK-VITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK--IVGITLDSLAKFVDTKDNCNGN--LLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSEISVTVELAKNLLSHISF-------LQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGKIFCDEDSVLNWN 3391
            VK L V+D + AQN  I L  + M NEEI  AI +M+ +  +  DM+ +L+ ++P+ S +  LE  K ++E +   ++F+  +  +D+Y+ R   +  +   + + L E +  ++ +  +  +L+ S +L  +LE+V+     MN  ++    G  + SL K  DTK + + +  +L +L+       P++L +  DL S+  A++++   +   V    + LK L+ +++      +R      V +  + ++  SF       L NE   K+ +  ++FG  +     ++ F     F   F  +      RQ L  + ++K E   + +++        A++    + E+ ++K    + ++    ++ +  + SG++F  + S L  N
Sbjct:  670 VKELSVIDGRRAQNCVILLSKLKMSNEEIKRAILEMDEREELAKDMLEQLLKFVPEKSDIDLLEEHKHELERMARADRFLFEMSRIDHYQQRLQSLFFKKKFA-ERLAETKPKVEAILHASRELVRSKRLTQILEVVLAFGNFMNKGQRGNAYGFKVSSLNKIADTKSSIDRSITMLHYLIMIFEKNYPDTLNIPQDLLSVPDAAKVNLAELEKEVYSIKSGLKGLEAELQ-YQQARVRDRGDKFVPVVSDFITVASFSFSELEDLLNEAKEKFMKALKHFGEEQGRMQPDEFFGIFDTFLQSFSEA------RQDLENMQRRKEEEEKRARME--------AMLKDQRERERRAKKSAGGVSEEVGEFDDLVSALRSGEVFDKDLSKLKRN 1045          
BLAST of Diaphanous vs. Ensembl Cavefish
Match: daam2 (dishevelled associated activator of morphogenesis 2 [Source:NCBI gene;Acc:103039904])

HSP 1 Score: 73.1738 bits (178), Expect = 1.417e-12
Identity = 87/392 (22.19%), Postives = 185/392 (47.19%), Query Frame = 2
Query: 2252 VKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFK-VITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK--IVGITLDSLAKFVDTKDNCNGN--LLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSEISVTVELAKNLLSHISF-------LQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGKIFCDEDSVLNWN 3391
            VK L V+D + AQN  I L  + M NEEI  AI +M+ +  +  DM+ +L+ ++P+ S +  LE  K ++E +   ++F+  +  +D+Y+ R   +  +   + + L E +  ++ +  +  +L+ S +L  +LE+V+     MN  ++    G  + SL K  DTK + + +  +L +L+       P++L +  DL S+  A++++   +   V    + LK L+ +++      +R      V +  + ++  SF       L NE   K+ +  ++FG  +     ++ F     F   F  +      RQ L  + ++K E   + +++        A++    + E+ ++K    + ++    ++ +  + SG++F  + S L  N
Sbjct:  680 VKELSVIDGRRAQNCVILLSKLKMSNEEIKRAILEMDEREELAKDMLEQLLKFVPEKSDIDLLEEHKHELERMARADRFLFEMSRIDHYQQRLQSLFFKKKFA-ERLAETKPKVEAILHASRELVRSKRLTQILEVVLAFGNFMNKGQRGNAYGFKVSSLNKIADTKSSIDRSITMLHYLIMIFEKNYPDTLNIPQDLLSVPDAAKVNLAELEKEVYSIKSGLKGLEAELQ-YQQARVRDRGDKFVPVVSDFITVASFSFSELEDLLNEAKEKFMKALKHFGEEQGRMQPDEFFGIFDTFLQSFSEA------RQDLENMQRRKEEEEKRARME--------AMLKDQRERERRAKKSAGGVSEEVGEFDDLVSALRSGEVFDKDLSKLKRN 1055          
BLAST of Diaphanous vs. Ensembl Cavefish
Match: daam2 (dishevelled associated activator of morphogenesis 2 [Source:NCBI gene;Acc:103039904])

HSP 1 Score: 73.1738 bits (178), Expect = 1.547e-12
Identity = 87/392 (22.19%), Postives = 185/392 (47.19%), Query Frame = 2
Query: 2252 VKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFK-VITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK--IVGITLDSLAKFVDTKDNCNGN--LLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSEISVTVELAKNLLSHISF-------LQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGKIFCDEDSVLNWN 3391
            VK L V+D + AQN  I L  + M NEEI  AI +M+ +  +  DM+ +L+ ++P+ S +  LE  K ++E +   ++F+  +  +D+Y+ R   +  +   + + L E +  ++ +  +  +L+ S +L  +LE+V+     MN  ++    G  + SL K  DTK + + +  +L +L+       P++L +  DL S+  A++++   +   V    + LK L+ +++      +R      V +  + ++  SF       L NE   K+ +  ++FG  +     ++ F     F   F  +      RQ L  + ++K E   + +++        A++    + E+ ++K    + ++    ++ +  + SG++F  + S L  N
Sbjct:  688 VKELSVIDGRRAQNCVILLSKLKMSNEEIKRAILEMDEREELAKDMLEQLLKFVPEKSDIDLLEEHKHELERMARADRFLFEMSRIDHYQQRLQSLFFKKKFA-ERLAETKPKVEAILHASRELVRSKRLTQILEVVLAFGNFMNKGQRGNAYGFKVSSLNKIADTKSSIDRSITMLHYLIMIFEKNYPDTLNIPQDLLSVPDAAKVNLAELEKEVYSIKSGLKGLEAELQ-YQQARVRDRGDKFVPVVSDFITVASFSFSELEDLLNEAKEKFMKALKHFGEEQGRMQPDEFFGIFDTFLQSFSEA------RQDLENMQRRKEEEEKRARME--------AMLKDQRERERRAKKSAGGVSEEVGEFDDLVSALRSGEVFDKDLSKLKRN 1063          
BLAST of Diaphanous vs. Ensembl Cavefish
Match: daam1a (dishevelled associated activator of morphogenesis 1a [Source:ZFIN;Acc:ZDB-GENE-030911-6])

HSP 1 Score: 62.7734 bits (151), Expect = 2.131e-9
Identity = 52/191 (27.23%), Postives = 105/191 (54.97%), Query Frame = 2
Query: 2246 KFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMN-FKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK--IVGITLDSLAKFVDTKDNCNGN--LLEFLVEQLRDLVP 2803
            K VK L V+D + AQN  I L  + + NEEI  AI  M+  + +  DM+ +L+ ++P+ S +  LE  K +++ +   ++F+  +  +++Y+ R   ++ +   + + + E++  ++ L ++ +++L S  L+ +LE+V+ +   MN  ++    G  + SL K  DTK + + N  LL +L+  L    P
Sbjct:  550 KKVKELSVIDGRRAQNCNILLSRLKLSNEEIKKAILTMDEHEDLPKDMLEQLLKFVPEKSDVDVLEEHKHELDRMARADRFLYEMSRINHYQQRLQSLYFKKKFA-ERVAEIKPKIEALSAACKEVLQSRNLRQLLEVVLALGNYMNKGQRGNAYGYKVSSLNKIADTKSSIDKNITLLHYLITILEQKYP 739          
BLAST of Diaphanous vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000125.1 (pep scaffold:Pmarinus_7.0:GL476709:11284:97599:-1 gene:ENSPMAG00000000108.1 transcript:ENSPMAT00000000125.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 3.562e-16
Identity = 110/425 (25.88%), Postives = 194/425 (45.65%), Query Frame = 2
Query: 2090 SFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKT---------------KFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSEISVT------VELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE-IHKQKM--ESINKMQIQQFQQSDQLAIILSSLDGEKSS 3280
            S KR N   I      E S W +  +       ++ KL   FA++ AA+ +                K +K L VLD K+ QN  IFL ++ M   EI   I ++N + IT  MI  L+  +P+  QL  L  FKD+ +DL   EQF V +  V   + R   I   +L   + +  V+  +  + ++ E++  SD    +LE+V+     MN   +     G  +  L K  DTK  +    LL FL E      PE LK  +DL  ++ ASR+S++++   + Q    ++ L+ DI++  S   +++  V       +  A+     ++ + + + + +  + EYF  +      E+ F DL  F++ F  + K    R++  E I K ++  E   K ++++ Q   +L ++    DG+++ 
Sbjct:  748 STKRANWAKIRPEEFKENSFWTKAKEERFENPDVLSKLAQTFAAQ-AAKVRAQKEQEGVEKDKPPSKKKIKELKVLDQKSGQNLSIFLGTLKMPYTEIKKIILEVNEEKITESMIQNLIKQLPEADQLEALAGFKDEYDDLAEAEQFSVVIGSVTRLRSRLTAIQF-MLQFEEQVSSVKPDVVAVTAACEEVQQSDAFSRLLEIVLLFGNYMNAGSRNAQTFGFNISYLCKLRDTKSADQKQTLLHFLAEVCEAEYPEVLKFTEDLSHVEKASRVSAENLQKNLKQMENQIEQLEKDIQSFPSTEDKNDKFVEKMTISFMRKAREQYGRLALMFDNMQTLFDGLGEYFVFNTKKVSVEEFFGDLTNFRSMFMQAVKDNVRRREAEEKIQKAQLAKERAEKERLEK-QNKKRLLLLKMHTDGDETG 1169          
BLAST of Diaphanous vs. Ensembl Sea Lamprey
Match: daam1a (dishevelled associated activator of morphogenesis 1a [Source:ZFIN;Acc:ZDB-GENE-030911-6])

HSP 1 Score: 64.6994 bits (156), Expect = 1.368e-10
Identity = 76/308 (24.68%), Postives = 152/308 (49.35%), Query Frame = 2
Query: 2246 KFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFK-VITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK--IVGITLDSLAKFVDTKDNC--NGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIE----NIDSINLR--SEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNS 3136
            K  K L V+D + AQN  I L  + M NEEI  A+ +M+ +  +  DM+ +L+ ++P+ S +  LE  + +IE +   ++F+  +  + +Y+ R   +  +   + + L E +  ++ +  +  ++  S +L+ +LE+V+ +   MN  ++    G  + SL K  DTK +   N NLL +L+  +    P+ L + DDL  +  A++++   +   +N     LK+++ ++E    +  +I  R  S +S  + +A    S +  L +E   K+ +   +FG        E+ F     F + F +S
Sbjct:  560 KRAKELSVIDGRRAQNCVILLSKLKMSNEEIKRALMRMDEQEELPKDMLEQLLKFVPEKSDVDVLEEHRHEIERMARADRFLFDMSRIPHYQQRLQALFFKKKFA-ERLGECKPKVEAILLASREVSRSRRLRQLLELVLALGNYMNKGQRGNAYGFKISSLNKIADTKSSTDKNINLLHYLIIVVEKKFPDVLGISDDLQHVPEAAKVNLTEMEKEINNIKIGLKAVEAELEFQRTHASAIGDRFISVMSDFITVASFSFSELEDLLSEAKEKFNKSVSHFGEEGGRTQPEEFFGMFDAFLSAFGDS 866          
BLAST of Diaphanous vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010867.1 (pep scaffold:Pmarinus_7.0:GL477036:280430:297830:1 gene:ENSPMAG00000009847.1 transcript:ENSPMAT00000010867.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.399e-10
Identity = 44/153 (28.76%), Postives = 74/153 (48.37%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLINENASN-KIISSFTK-FTQRPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIF 958
            I++CLK+F NN +G++R+  E+    +L + I   Y   +  A+ LLS +C++ E  ++ +I+ + T+   Q    RF  ++  L  R  + ++   M  IN LL S      +    RL LR E    G    L+    SND+    Q  +F
Sbjct:  176 IVRCLKAFMNNKYGLMRMLSEEQGILLLARAIEPAYPPMMADAVKLLSALCILEEERTHERILEALTQCGEQENRERFSTIVKGLGQRQGLQLKVGCMQLINALLTSV-----DELDFRLHLRNEFMRCGLVDILQDLIVSNDEPQDVQLRVF 323          
BLAST of Diaphanous vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001778.1 (pep scaffold:Pmarinus_7.0:GL479130:173791:184898:-1 gene:ENSPMAG00000001611.1 transcript:ENSPMAT00000001778.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 3.105e-6
Identity = 51/176 (28.98%), Postives = 85/176 (48.30%), Query Frame = 2
Query: 2300 IFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKDNCNG-NLLEFLVEQLRDLVPESLK 2815
            IFL S  M  +EI + I  ++ + IT  MI  L+  +P+  QL  L   K++ EDL   EQF V +  V   + R N I  + L  ++ +  ++  +  + ++ E++  SD    +LE+V+ +   MN   +     G  +  L K  DTK N     LL FL +   +  P+ L+
Sbjct:    2 IFLGSFRMDYQEIKSIILSVDEERITESMIQSLINQLPEPEQLSALASLKNEYEDLCEPEQFGVVISSVKRLRPRLNAILFR-LQFDEQVANLKPDIVAVSAACEEIRRSDSFSKLLELVLLMGNYMNAGSRNAQTFGFQMGFLCKLKDTKSNDQKLTLLHFLAQMCEEKHPDVLR 176          
BLAST of Diaphanous vs. Ensembl Nematostella
Match: EDO27387 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9E0])

HSP 1 Score: 65.4698 bits (158), Expect = 4.734e-12
Identity = 58/188 (30.85%), Postives = 91/188 (48.40%), Query Frame = 2
Query: 2267 VLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNG--------IHLQILVSN-DCLK----EVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNP---EKKIVGITLDSLAKFVDTKDN-CNGNLLEFLV 2779
            +LD K + N  IFL+     NEEII+ I K + KV  +D++   +  +PD S++  L+ F    + L   E+F++ L+ V +Y++R N         I+LQ L  N +C+K    E+ NS  L                VL++++ I   MN        +   + SL K VDT+ N    NL+ FLV
Sbjct:    3 LLDPKRSLNLNIFLKQFKKSNEEIISTIVKGDSKVFDVDVLKGFIKLLPDNSEVEMLKGFNGDTKMLGSAEKFLIELIAVKSYELRINAMLQKAELDINLQTLKPNIECMKKAIEEILNSETL--------------PEVLQLILIIGNFMNSGGYAGNAIAFKISSLVKLVDTRANKPRMNLMHFLV 176          
BLAST of Diaphanous vs. Ensembl Nematostella
Match: EDO35335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLQ1])

HSP 1 Score: 70.0922 bits (170), Expect = 4.931e-12
Identity = 86/386 (22.28%), Postives = 170/386 (44.04%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKTKFVKP---------------LIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESL-----KVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENI-------DSI-----NLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEK 3142
             KR N T I    + +   W ++N+  L  + ++ +L   FA+K A +   K   P               L VLD K+AQN  IFL S+   +EEI + I   + + ++   I  L+ Y+P   Q+ +L   KD+I +L   EQF VH+ ++   + R N +  +     + + + +  +    ++  ++ +S K   +LE+++ +   MN   +    +G  +  L K   TK  +   NLL F+ + + +     +     ++     +   +  I   SI+++      + K L+   +N        D++     + + ++ V VE+ KN+++            +++V E+F +       E+ F DLK F +Q+   +K
Sbjct:  506 MKRANWTKINNRNITDNCFWKKVNEEKLEREDMLAELTRTFAAKSAPK---KLDNPDGEEKKSVAKKKAKELKVLDPKSAQNLSIFLGSLKSSHEEIKSHILHCDQEKLSESAIESLLKYLPSPEQMEQLSNMKDQISELSEPEQFAVHISDIKKLEQRLNCLLFRTRFPEE-MSDTKPGVVNATAACREVKTSPKFAKLLELILLMGNYMNTGSRNEGTIGFEISYLTKLSSTKSVDGQRNLLHFIADAVENKYSSEIAGFENELGHVEAAGKVSEEILGKSISNMSANLRKIEKELEAKQQNTNPEDRFHDAMKEFYSSAKDQVDVLVEMHKNMVTM-----------FKDVLEFFCMDPKKTSMEEFFGDLKTFMDQYSQCKK 876          
BLAST of Diaphanous vs. Ensembl Nematostella
Match: EDO32868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU3])

HSP 1 Score: 50.0618 bits (118), Expect = 6.070e-6
Identity = 55/270 (20.37%), Postives = 133/270 (49.26%), Query Frame = 2
Query: 2048 FYRSIGKRSNTAMDSFKRINVTLIPETCLNEKSIWLQLNKTTLSTD---KIVGKLFARFASKK---AAEFKTKFVKP--LIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMN-FKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK--IVGITLDSLAKFVDTKDNCNG--NLLEFLVEQLRDLVPESLKV 2818
            F +   +++    +  K  N + +P++ + + ++W  ++ T +  +   +   ++F+ +  K+     +F     KP  L ++DS+ AQN  I L  + + +EEI  AI  ++  + ++ DM+ +L+ Y+P  ++   L     + ++    ++F+  +  + +Y+ R   +  +     + + +++  +  +  + +++  S +++++LE+++     MN   +    G  L SL + VDTK + N    LL +LV  L    P+ LK+
Sbjct:  672 FTKQPNRKTPKPSNPLKSFNWSKLPDSKI-KGTVWTDIDDTKVYNEMDLEDFDRMFSAYQGKENQGIKDFTDSAAKPKELSLIDSRRAQNCGILLTKLKLSDEEITKAILTIDEEEELSKDMVEQLLKYVPTAAEKNLLNENNKEKDNFARADKFLYDMSRIVHYEQRLKALFFKKKFP-ERMGDLKPKVQAVIMACKEVTRSKRIRTLLEVILAFGNYMNRGARGNATGFKLASLNRIVDTKSSANSRITLLNYLVTVLEKSYPDVLKL 939          
BLAST of Diaphanous vs. Ensembl Medaka
Match: DIAPH1 (diaphanous related formin 1 [Source:NCBI gene;Acc:101169616])

HSP 1 Score: 87.8113 bits (216), Expect = 4.770e-17
Identity = 102/386 (26.42%), Postives = 181/386 (46.89%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKTKFVK-------------PLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENI-----DSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQ 3184
             KR N + I    L+EKS W++  +     +++  KL   F+S+  ++ K +                 L +LDSK +QN  IFL S  +  EEI  AI ++N KV+T  ++  L+  +P   QL  L   KD+  DL   EQF V +  V     R   I  + L   + L  ++  +  + ++ E+L  S+    +L++++ +   MN   +     G ++  L K  DTK  +    LL FL +   +  P+ +   D+L  ++ ASR+S+++I   + Q S  +KS++ D+E       D+     ++S++ E        +  L   ++ +Y ++ +YF         E+ FSDL  FKN F+ +   + E QK  E  ++
Sbjct:  690 LKRANWSKISPEDLSEKSFWIKAQEDQFENNELFAKLTVTFSSQTKSKSKKEQDDGDDKKQQQKKKVKELKILDSKTSQNLSIFLGSFRLPYEEIKCAILQVNEKVLTESLVQNLIKQLPGPEQLSILGEMKDEYNDLAESEQFAVVISSVKRLMTRLQAIQFK-LQFEEQLNNIKPDVVSVTAACEELRKSETFSKLLQIILLVGNYMNAGSRNGSAFGFSISYLCKLRDTKSADLKQTLLHFLADVCEEQYPDVMSFPDELTHVEKASRVSAETIQKNLEQMSRQIKSIEKDLETFPPPQNDNDQFVEKMSISFEFTNEQFEKLDLLHKNMEKQYNDLGDYFVFDPKKISVEEFFSDLNNFKNMFQQA---VKENQKRKEAEEK 1071          

HSP 2 Score: 60.4622 bits (145), Expect = 1.386e-8
Identity = 44/165 (26.67%), Postives = 81/165 (49.09%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLIN--ENASNKIISSFTKFTQRPEC-RFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEF 991
            I++CLK+F NN +G+  + E +    +L + I+ +    +  A+ LLS I ++   E    +++   T+  ++    RF+PLI  + N N + ++ S +  IN L+      R E    R+ +R EL  LG    L+  R   ++ L  Q  +F  ++  D E+ 
Sbjct:  162 IIRCLKAFMNNKYGLKSMLESEEGITLLVRAINPQKPSMMTDAVKLLSAISILEQPEGLHERVLEVITEEAEKQNIERFQPLISGMKN-NSLPLRASCLTLINALIS-----RAEELDFRIHIRSELLRLGLREPLKAVRTIENEELKVQLRVFDEQAEDDSEDL 320          
BLAST of Diaphanous vs. Ensembl Medaka
Match: diaph3 (diaphanous related formin 3 [Source:NCBI gene;Acc:101155017])

HSP 1 Score: 87.8113 bits (216), Expect = 4.819e-17
Identity = 107/412 (25.97%), Postives = 189/412 (45.87%), Query Frame = 2
Query: 2090 SFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKT----------KFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRF-------------NGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKKIVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSE-----ISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNS------EKIIYERQKLNEIHKQKMESINKMQIQQ 3220
              KR+N + I    ++E   W++ ++   S  +++ ++   F S++  + +           K ++ L VLD K AQN  IFL S  M  EEI   I +++ + +T  MI  LV ++P+  QL  L  +K +   L   EQF V +  V   + R              N +   IL  N   +EV  SL         LL  + +            S N +    G  L SL K  DTK  +    LL FL +   +  P+ +K  DDL+ +D ASR+S++++   + Q    L  L+ D+E   S + +S+     ++   + A++  S +  + +++++ YQ + EYF +       E+LF+DL  F++ F  +      ++ + E+Q+   + K+K E   K++ QQ
Sbjct:  626 GMKRLNWSKIRPQEMSEGCFWVRADENQYSKPELLSRVALTFGSQRTVKKEEEDTEDKKSIKKRIRELKVLDPKIAQNLSIFLGSFRMPYEEIRRMIVEVDEEQLTEPMIQNLVKHLPEQEQLNALAKYKSEYSSLSEPEQFGVVMSTVKRLRPRLSHILFRLQFEEQVNNLRPDILAVNAACEEVRRSLSFGRLLELVLLLGNYMN---------AGSRNAQS--YGFDLSSLCKLKDTKSADQKTTLLHFLAQICEEEFPDVIKFVDDLEHVDRASRVSAENVEKSLRQMERQLLQLERDLETFSSPDDQSDMFFVKMASFSKGARDQYSKLVTVHSKMETSYQNILEYFAVDPKKTSVEELFTDLSNFRSMFTQALKENFKQRELEEKQRRARVAKEKAER-EKLERQQ 1025          

HSP 2 Score: 67.0106 bits (162), Expect = 1.135e-10
Identity = 53/211 (25.12%), Postives = 95/211 (45.02%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLIN-ENASNKIISSFTKFTQ-RPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEFDFDFLKLQTRLTTLSLCEKEWNKMIHDENSKESSMISFMHLIIFLFD 1132
            +++CLK+F NN +G+ R+  E+    +L ++I   ++  +   + LLS IC++  EN   KI+ + T   + R   RF P++  L +R+ + +Q + M  IN L+ S      +    RL +R E    G +  L       ++ L  Q  +F      DM EF      +++ L            M+ D N++   +    HL +   D
Sbjct:  226 VVQCLKAFMNNKYGLDRILGEERSLSLLARVIDPTHSAMMTDVVKLLSAICIVGEENTLEKILEAITTAGEWRSIERFSPIVRGLRDRS-VQLQVACMQLINALVTSP-----DELDFRLHIRNEFMRCGLKEILPQLGTIRNEALDIQLKVFEEHKEEDMMEFSHRLEDIRSELDDAGDVFSFVQSMVKDTNAEPYFLSILQHLALIRND 430          
BLAST of Diaphanous vs. Ensembl Medaka
Match: DIAPH1 (diaphanous related formin 1 [Source:NCBI gene;Acc:101169616])

HSP 1 Score: 87.8113 bits (216), Expect = 5.040e-17
Identity = 102/386 (26.42%), Postives = 181/386 (46.89%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKTKFVK-------------PLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENI-----DSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQ 3184
             KR N + I    L+EKS W++  +     +++  KL   F+S+  ++ K +                 L +LDSK +QN  IFL S  +  EEI  AI ++N KV+T  ++  L+  +P   QL  L   KD+  DL   EQF V +  V     R   I  + L   + L  ++  +  + ++ E+L  S+    +L++++ +   MN   +     G ++  L K  DTK  +    LL FL +   +  P+ +   D+L  ++ ASR+S+++I   + Q S  +KS++ D+E       D+     ++S++ E        +  L   ++ +Y ++ +YF         E+ FSDL  FKN F+ +   + E QK  E  ++
Sbjct:  685 LKRANWSKISPEDLSEKSFWIKAQEDQFENNELFAKLTVTFSSQTKSKSKKEQDDGDDKKQQQKKKVKELKILDSKTSQNLSIFLGSFRLPYEEIKCAILQVNEKVLTESLVQNLIKQLPGPEQLSILGEMKDEYNDLAESEQFAVVISSVKRLMTRLQAIQFK-LQFEEQLNNIKPDVVSVTAACEELRKSETFSKLLQIILLVGNYMNAGSRNGSAFGFSISYLCKLRDTKSADLKQTLLHFLADVCEEQYPDVMSFPDELTHVEKASRVSAETIQKNLEQMSRQIKSIEKDLETFPPPQNDNDQFVEKMSISFEFTNEQFEKLDLLHKNMEKQYNDLGDYFVFDPKKISVEEFFSDLNNFKNMFQQA---VKENQKRKEAEEK 1066          

HSP 2 Score: 60.077 bits (144), Expect = 1.491e-8
Identity = 44/165 (26.67%), Postives = 81/165 (49.09%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLIN--ENASNKIISSFTKFTQRPEC-RFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEF 991
            I++CLK+F NN +G+  + E +    +L + I+ +    +  A+ LLS I ++   E    +++   T+  ++    RF+PLI  + N N + ++ S +  IN L+      R E    R+ +R EL  LG    L+  R   ++ L  Q  +F  ++  D E+ 
Sbjct:  157 IIRCLKAFMNNKYGLKSMLESEEGITLLVRAINPQKPSMMTDAVKLLSAISILEQPEGLHERVLEVITEEAEKQNIERFQPLISGMKN-NSLPLRASCLTLINALIS-----RAEELDFRIHIRSELLRLGLREPLKAVRTIENEELKVQLRVFDEQAEDDSEDL 315          
BLAST of Diaphanous vs. Ensembl Medaka
Match: diaph3 (diaphanous related formin 3 [Source:NCBI gene;Acc:101155017])

HSP 1 Score: 87.8113 bits (216), Expect = 5.357e-17
Identity = 107/412 (25.97%), Postives = 189/412 (45.87%), Query Frame = 2
Query: 2090 SFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFK----------TKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRF-------------NGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKKIVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSE-----ISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNS------EKIIYERQKLNEIHKQKMESINKMQIQQ 3220
              KR+N + I    ++E   W++ ++   S  +++ ++   F S++  + +           K ++ L VLD K AQN  IFL S  M  EEI   I +++ + +T  MI  LV ++P+  QL  L  +K +   L   EQF V +  V   + R              N +   IL  N   +EV  SL         LL  + +            S N +    G  L SL K  DTK  +    LL FL +   +  P+ +K  DDL+ +D ASR+S++++   + Q    L  L+ D+E   S + +S+     ++   + A++  S +  + +++++ YQ + EYF +       E+LF+DL  F++ F  +      ++ + E+Q+   + K+K E   K++ QQ
Sbjct:  615 GMKRLNWSKIRPQEMSEGCFWVRADENQYSKPELLSRVALTFGSQRTVKKEEEDTEDKKSIKKRIRELKVLDPKIAQNLSIFLGSFRMPYEEIRRMIVEVDEEQLTEPMIQNLVKHLPEQEQLNALAKYKSEYSSLSEPEQFGVVMSTVKRLRPRLSHILFRLQFEEQVNNLRPDILAVNAACEEVRRSLSFGRLLELVLLLGNYMN---------AGSRNAQS--YGFDLSSLCKLKDTKSADQKTTLLHFLAQICEEEFPDVIKFVDDLEHVDRASRVSAENVEKSLRQMERQLLQLERDLETFSSPDDQSDMFFVKMASFSKGARDQYSKLVTVHSKMETSYQNILEYFAVDPKKTSVEELFTDLSNFRSMFTQALKENFKQRELEEKQRRARVAKEKAER-EKLERQQ 1014          

HSP 2 Score: 67.0106 bits (162), Expect = 1.191e-10
Identity = 53/211 (25.12%), Postives = 95/211 (45.02%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLIN-ENASNKIISSFTKFTQ-RPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEFDFDFLKLQTRLTTLSLCEKEWNKMIHDENSKESSMISFMHLIIFLFD 1132
            +++CLK+F NN +G+ R+  E+    +L ++I   ++  +   + LLS IC++  EN   KI+ + T   + R   RF P++  L +R+ + +Q + M  IN L+ S      +    RL +R E    G +  L       ++ L  Q  +F      DM EF      +++ L            M+ D N++   +    HL +   D
Sbjct:  215 VVQCLKAFMNNKYGLDRILGEERSLSLLARVIDPTHSAMMTDVVKLLSAICIVGEENTLEKILEAITTAGEWRSIERFSPIVRGLRDRS-VQLQVACMQLINALVTSP-----DELDFRLHIRNEFMRCGLKEILPQLGTIRNEALDIQLKVFEEHKEEDMMEFSHRLEDIRSELDDAGDVFSFVQSMVKDTNAEPYFLSILQHLALIRND 419          
BLAST of Diaphanous vs. Ensembl Medaka
Match: diaph3 (diaphanous related formin 3 [Source:NCBI gene;Acc:101155017])

HSP 1 Score: 87.8113 bits (216), Expect = 5.357e-17
Identity = 107/412 (25.97%), Postives = 189/412 (45.87%), Query Frame = 2
Query: 2090 SFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFK----------TKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRF-------------NGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKKIVGITLDSLAKFVDTKD-NCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSE-----ISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNS------EKIIYERQKLNEIHKQKMESINKMQIQQ 3220
              KR+N + I    ++E   W++ ++   S  +++ ++   F S++  + +           K ++ L VLD K AQN  IFL S  M  EEI   I +++ + +T  MI  LV ++P+  QL  L  +K +   L   EQF V +  V   + R              N +   IL  N   +EV  SL         LL  + +            S N +    G  L SL K  DTK  +    LL FL +   +  P+ +K  DDL+ +D ASR+S++++   + Q    L  L+ D+E   S + +S+     ++   + A++  S +  + +++++ YQ + EYF +       E+LF+DL  F++ F  +      ++ + E+Q+   + K+K E   K++ QQ
Sbjct:  615 GMKRLNWSKIRPQEMSEGCFWVRADENQYSKPELLSRVALTFGSQRTVKKEEEDTEDKKSIKKRIRELKVLDPKIAQNLSIFLGSFRMPYEEIRRMIVEVDEEQLTEPMIQNLVKHLPEQEQLNALAKYKSEYSSLSEPEQFGVVMSTVKRLRPRLSHILFRLQFEEQVNNLRPDILAVNAACEEVRRSLSFGRLLELVLLLGNYMN---------AGSRNAQS--YGFDLSSLCKLKDTKSADQKTTLLHFLAQICEEEFPDVIKFVDDLEHVDRASRVSAENVEKSLRQMERQLLQLERDLETFSSPDDQSDMFFVKMASFSKGARDQYSKLVTVHSKMETSYQNILEYFAVDPKKTSVEELFTDLSNFRSMFTQALKENFKQRELEEKQRRARVAKEKAER-EKLERQQ 1014          

HSP 2 Score: 67.0106 bits (162), Expect = 1.191e-10
Identity = 53/211 (25.12%), Postives = 95/211 (45.02%), Query Frame = 2
Query:  506 ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLIN-ENASNKIISSFTKFTQ-RPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEFDFDFLKLQTRLTTLSLCEKEWNKMIHDENSKESSMISFMHLIIFLFD 1132
            +++CLK+F NN +G+ R+  E+    +L ++I   ++  +   + LLS IC++  EN   KI+ + T   + R   RF P++  L +R+ + +Q + M  IN L+ S      +    RL +R E    G +  L       ++ L  Q  +F      DM EF      +++ L            M+ D N++   +    HL +   D
Sbjct:  215 VVQCLKAFMNNKYGLDRILGEERSLSLLARVIDPTHSAMMTDVVKLLSAICIVGEENTLEKILEAITTAGEWRSIERFSPIVRGLRDRS-VQLQVACMQLINALVTSP-----DELDFRLHIRNEFMRCGLKEILPQLGTIRNEALDIQLKVFEEHKEEDMMEFSHRLEDIRSELDDAGDVFSFVQSMVKDTNAEPYFLSILQHLALIRND 419          
BLAST of Diaphanous vs. Planmine SMEST
Match: SMESG000054598.1 (SMESG000054598.1)

HSP 1 Score: 2013.81 bits (5216), Expect = 0.000e+0
Identity = 1134/1158 (97.93%), Postives = 1137/1158 (98.19%), Query Frame = 2
Query:   56 MTNKLKTISRKSILKFNKTIKKVDHLKKPSVTEKELFFKTHEYKYLFEDILNXXXXXXXXXXXXXXXXDQRKEFVWNHHMIQKKNSFNSMKIDFKSKNIARDLYNLYQTLTLNCLCVIKNFDKSNGVKKLLHLLXXXXXXXXXXXXVIVLILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLINENASNKIISSFTKFTQRPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEFDFDFLKLQTRLTTLSLCEKEWNKMIHDENSKESSMISFMHLIIFLFDKDKKNIDEIILYLKNKLQVTCNFNQEKLSDQFQMINLTDNSESDGHLELNDETNIVNFPQNRFNKNRSFSSLSDLCSINSELLQSFISVSDLNKDSGLSQNYDRNQSSLFSICETESLNSFLFEETEVLVKSISEENLNPQLNHPNKPSFHASSFTNSGSLHFGENIKSSTFQKQNRKCFSKNSDFHQKNVLPNPEKDXXXXXXXXXXPNTLKLTQSNAFISDKKGSNLNEEKHCLSDEIIKHTAISPKSTIGILSYSSLPNSTNISNENVEINKFSXXXXXXXXXXXXXXXXXXXXXXXXMSNHFYRSIGKRSNTAMDSFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKTKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKKIVGITLDSLAKFVDTKDNCNGNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENIDSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGKIFCDEDSVLNWNVQYHRRENQKNRVRNARNIRRLNFNNLTPSRSRKIDFTQTMIPESI 3529
            MTNKLKTISRKSILKFNKTIKKVDHLKKPSVTEKELFFKTHEYKYLFEDILNEFESEKLKSEYSSYSEDQRKEFVWNHHMIQKKNSFNSMKIDFKSKNIARDLYNLYQTLTLNCLCVIKNFDKSNGVKKLLHLLDKCIKTKCKDTDVIVLILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLINENASNKIISSFTKFTQRPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEFDFDFLKLQTRLTTLSLCEKEWNKMIHDEN KESSMISFMHLIIFLFDKDKKNIDEIILYLKNKLQVTCNFNQEKLSDQFQMINLTDNSESDGHLELNDETNIVNF QNRFNKNRSFSSLSDLCSINSELLQSFISVSDLNKDSGLSQNYDRNQSSLFSICETE                  +ENLNPQLNH NKPSFHASSFTNSGSLHFGENIKSSTFQKQNRKCFSKNSDFHQKNVLPNPEKDSSCSISLKSSPNTLKLTQSNAFISDKKGSNLNEEKHCLSDEIIKHTAISPKSTIGILSYSSLPNSTNISNENVEINKFSPLLPVALPPPPPPLPPPPPPPPAPMSNHFYRSIGKRSNTAMDSFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKTKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYSSFEKLLSSDKLKSVLEMVVFITQSMNPEKKIVGITLDSLAKFVDTKDNCNGNLLEFLVEQLRDLVPESLKVWDDLDSLDSASRISSDSINSVVNQFSTVLKSLQCDIENIDSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQ+QQFQQSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGKIFCDEDSVLNWNVQYHRRENQKNRVRNARNIRR+NFNNLTPSRSRKIDFTQTMIPESI
Sbjct:    1 MTNKLKTISRKSILKFNKTIKKVDHLKKPSVTEKELFFKTHEYKYLFEDILNEFESEKLKSEYSSYSEDQRKEFVWNHHMIQKKNSFNSMKIDFKSKNIARDLYNLYQTLTLNCLCVIKNFDKSNGVKKLLHLLDKCIKTKCKDTDVIVLILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVICLINENASNKIISSFTKFTQRPECRFKPLIVCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLNKSYIDMEEFDFDFLKLQTRLTTLSLCEKEWNKMIHDENFKESSMISFMHLIIFLFDKDKKNIDEIILYLKNKLQVTCNFNQEKLSDQFQMINLTDNSESDGHLELNDETNIVNFSQNRFNKNRSFSSLSDLCSINSELLQSFISVSDLNKDSGLSQNYDRNQSSLFSICETE------------------KENLNPQLNHTNKPSFHASSFTNSGSLHFGENIKSSTFQKQNRKCFSKNSDFHQKNVLPNPEKDSSCSISLKSSPNTLKLTQSNAFISDKKGSNLNEEKHCLSDEIIKHTAISPKSTIGILSYSSLPNSTNISNENVEINKFSPLLPVALPPPPPPLPPPPPPPPAPMSNHFYRSIGKRSNTAMDSFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKTKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYSSFEKLLSSDKLKSVLEMVVFITQSMNPEKKIVGITLDSLAKFVDTKDNCNGNLLEFLVEQLRDLVPESLKVWDDLDSLDSASRISSDSINSVVNQFSTVLKSLQCDIENIDSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINKMQMQQFQQSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGKIFCDEDSVLNWNVQYHRRENQKNRVRNARNIRRINFNNLTPSRSRKIDFTQTMIPESI 1140          
BLAST of Diaphanous vs. Planmine SMEST
Match: SMESG000057806.1 (SMESG000057806.1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.833e-19
Identity = 114/424 (26.89%), Postives = 207/424 (48.82%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKTKFVKPLI----VLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNP---EKKIVGITLDSLAKFVDTKDNCNG-NLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTVLKSLQCDIENI----DSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNE------IHKQKMESINKMQIQQFQQS-------DQLAIILSSLDGEKSSEKK 3289
             K+ N   I E  L+E S+WL + + T+ TD I+ +L   F++K     +      ++    +LD K AQN  I L S+ M+ E++  AI +++  ++T  MI +L+  +P+  Q+ K+    D  +DL  CEQF   L  +   K R   I  Q L  +D + EV+       ++  ++L S+K+K +LE+V+ +   MN     ++ +G  L+ L K   TKD  N  +L+ FL E +        ++  DL  +D A+R++ D+  S + +  T LK+++  +++     ++     +++  V   K  +      Q +++  +Q V  YF  + S Y  E+LF+D+  FK +F  + K   E++ L E      + K++ E   +M +     S       D L  +L S DG  S +++
Sbjct:  630 MKKANWNKINEKILSENSVWLSIKEETIPTD-ILKELENNFSTKVVVVKEKTVKTTVVKEPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQ-LKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNEEKKLLEERALKAKLDKERREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRR 1051          
BLAST of Diaphanous vs. Planmine SMEST
Match: SMESG000036976.1 (SMESG000036976.1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.039e-16
Identity = 121/523 (23.14%), Postives = 228/523 (43.59%), Query Frame = 2
Query: 2093 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKK--------------AAEFKTKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNG-------------IHLQILVSNDCLKEVENSLDLLYXXXXXXXXXXXXXXVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKDNCN-GNLLEFLVEQLRDLVPESLKVWXXXXXXXXXXXXXXXXXXXXXXQFSTV-------LKSLQCDIENIDSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKII-------YERQKLNEIH-KQKMESINK--MQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGKIFCDEDSVLNWNVQYHRRENQKNRVRNARNIRRLNFNNLTPSRSRKIDFTQTMI 3517
            + ++++ L+   C     +W ++N + ++T++++ +L  +F+++               +     K VK   VLDSK+ QN  I   S  +  EEI   I +++  ++T   +  L+  +P   QL KL   +D  E+L   EQF   L  + +   R N              I   I+ +   L E+ +S + +               +LE+++     MN   K    V   ++ L K +DTKDN N G L+EF+V Q+R+  P  +   ++   LD A+++S+++INS + +   +       LK  +   +N +   +  E  V V     L+S ++ +   L S ++E+ +Y       Y  E+ F D+K+FK+ F+ + K I       + RQK  E   +++ME   +   Q +  Q+ D+                           ++N ++ ++SG  F +            R++ +K R++   NI  +N      SRSR+ DF + +I
Sbjct:  536 WNKVDIKLLDRNC-----VWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFI--------------KILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETINSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKI---LQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDK-------------------------KVLDNLLVTLNSGNAFGN------------RKDPRKKRLKKTENIVVIN-----RSRSRR-DFDKNLI 993          
BLAST of Diaphanous vs. Planmine SMEST
Match: SMESG000044336.1 (SMESG000044336.1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.876e-7
Identity = 49/164 (29.88%), Postives = 79/164 (48.17%), Query Frame = 2
Query:  503 LILKCLKSFGNNHFGILRLYE-EDAVCEMLCKLISTRYNEEIIIALDLLSVICLINENASNKIISSFT--KFTQRPECRFKPLI-------VCLMNRNKIDVQRSVMYFINTLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANIFLN 964
            L LKC ++  NN  G    +E +D +  +   L+   Y  + ++ LDLLS +CLI E    +++ +F   K   R E RF  L+          ++   ID   S M FIN ++HS      E   LR+ L+ E   LG +S+L+  +E     L+ Q + +L+
Sbjct:  243 LCLKCFRTILNNQKGCQMAFEYKDTINVITMCLVHPSYQTKSLL-LDLLSAVCLI-EGGHERVLKAFDLFKVMTREEKRFDTLMYFYRHHETLPLDDYNIDYAVSNMQFINIIVHSV-----ENINLRVYLQYEFTLLGLDSFLKKLQERPGDRLNRQVDAYLD 399          
The following BLAST results are available for this feature:
BLAST of Diaphanous vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIAPH11.117e-1427.46diaphanous related formin 1 [Source:HGNC Symbol;Ac... [more]
DIAPH12.882e-1427.46diaphanous related formin 1 [Source:HGNC Symbol;Ac... [more]
DIAPH13.398e-1427.46diaphanous related formin 1 [Source:HGNC Symbol;Ac... [more]
DIAPH13.676e-1427.46diaphanous related formin 1 [Source:HGNC Symbol;Ac... [more]
DIAPH14.025e-1427.46diaphanous related formin 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Diaphanous vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cyk-17.124e-1222.17CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q... [more]
cyk-17.561e-1222.17CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q... [more]
back to top
BLAST of Diaphanous vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dia1.826e-2023.42gene:FBgn0011202 transcript:FBtr0081410[more]
dia1.826e-2023.42gene:FBgn0011202 transcript:FBtr0335145[more]
dia1.826e-2023.42gene:FBgn0011202 transcript:FBtr0081411[more]
dia2.248e-2023.65gene:FBgn0011202 transcript:FBtr0305961[more]
form38.717e-1026.09gene:FBgn0053556 transcript:FBtr0091533[more]
back to top
BLAST of Diaphanous vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
diaph33.785e-1727.20diaphanous-related formin 3 [Source:ZFIN;Acc:ZDB-G... [more]
diaph35.490e-1727.20diaphanous-related formin 3 [Source:ZFIN;Acc:ZDB-G... [more]
diaph23.306e-1324.62diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-G... [more]
daam21.293e-1223.10dishevelled associated activator of morphogenesis ... [more]
daam21.426e-1223.10dishevelled associated activator of morphogenesis ... [more]
back to top
BLAST of Diaphanous vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIAPH19.997e-2128.50diaphanous related formin 1 [Source:NCBI gene;Acc:... [more]
DIAPH23.273e-1427.02diaphanous related formin 2 [Source:NCBI gene;Acc:... [more]
DIAPH24.569e-1427.66diaphanous related formin 2 [Source:NCBI gene;Acc:... [more]
DIAPH11.099e-1326.09diaphanous related formin 1 [Source:NCBI gene;Acc:... [more]
DIAPH12.103e-1326.70diaphanous related formin 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Diaphanous vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Diaph24.677e-1524.20diaphanous related formin 2 [Source:MGI Symbol;Acc... [more]
Diaph26.958e-1524.42diaphanous related formin 2 [Source:MGI Symbol;Acc... [more]
Diaph29.066e-1524.42diaphanous related formin 2 [Source:MGI Symbol;Acc... [more]
Diaph15.430e-1427.46diaphanous related formin 1 [Source:MGI Symbol;Acc... [more]
Diaph15.523e-1427.46diaphanous related formin 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Diaphanous vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P48608|DIA_DROME1.830e-1923.42Protein diaphanous OS=Drosophila melanogaster OX=7... [more]
sp|O70566|DIAP2_MOUSE4.867e-1424.42Protein diaphanous homolog 2 OS=Mus musculus OX=10... [more]
sp|O60610|DIAP1_HUMAN1.766e-1327.46Protein diaphanous homolog 1 OS=Homo sapiens OX=96... [more]
sp|O08808|DIAP1_MOUSE3.798e-1327.46Protein diaphanous homolog 1 OS=Mus musculus OX=10... [more]
sp|F1M775|DIAP1_RAT2.199e-1227.16Protein diaphanous homolog 1 OS=Rattus norvegicus ... [more]
back to top
BLAST of Diaphanous vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B0FIC12.365e-2125.76Uncharacterized protein OS=Glossina morsitans mors... [more]
A0A1B0ASA94.528e-2125.57Uncharacterized protein OS=Glossina palpalis gambi... [more]
A0A1B0AIR55.092e-2125.53Uncharacterized protein OS=Glossina pallidipes OX=... [more]
A0A1A9V6Y06.978e-2125.53Uncharacterized protein OS=Glossina austeni OX=739... [more]
A0A482VYJ91.246e-2029.19Diaphanous (Fragment) OS=Asbolus verrucosus OX=166... [more]
back to top
BLAST of Diaphanous vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
diaph22.596e-1424.53diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-G... [more]
daam21.365e-1222.19dishevelled associated activator of morphogenesis ... [more]
daam21.417e-1222.19dishevelled associated activator of morphogenesis ... [more]
daam21.547e-1222.19dishevelled associated activator of morphogenesis ... [more]
daam1a2.131e-927.23dishevelled associated activator of morphogenesis ... [more]
back to top
BLAST of Diaphanous vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000125.13.562e-1625.88pep scaffold:Pmarinus_7.0:GL476709:11284:97599:-1 ... [more]
daam1a1.368e-1024.68dishevelled associated activator of morphogenesis ... [more]
ENSPMAT00000010867.11.399e-1028.76pep scaffold:Pmarinus_7.0:GL477036:280430:297830:1... [more]
ENSPMAT00000001778.13.105e-628.98pep scaffold:Pmarinus_7.0:GL479130:173791:184898:-... [more]
back to top
BLAST of Diaphanous vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Diaphanous vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO273874.734e-1230.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353354.931e-1222.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328686.070e-620.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Diaphanous vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIAPH14.770e-1726.42diaphanous related formin 1 [Source:NCBI gene;Acc:... [more]
diaph34.819e-1725.97diaphanous related formin 3 [Source:NCBI gene;Acc:... [more]
DIAPH15.040e-1726.42diaphanous related formin 1 [Source:NCBI gene;Acc:... [more]
diaph35.357e-1725.97diaphanous related formin 3 [Source:NCBI gene;Acc:... [more]
diaph35.357e-1725.97diaphanous related formin 3 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Diaphanous vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000054598.10.000e+097.93SMESG000054598.1[more]
SMESG000057806.13.833e-1926.89SMESG000057806.1[more]
SMESG000036976.12.039e-1623.14SMESG000036976.1[more]
SMESG000044336.12.876e-729.88SMESG000044336.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035463 ID=SMED30035463|Name=Diaphanous|organism=Schmidtea mediterranea sexual|type=transcript|length=3703bp
ATTGGATTTGTTTTAATAAACTGTCATATTATTTGAATTTTTTAATACAA
ATAGAATGACCAATAAATTAAAAACTATATCTCGTAAGAGCATACTTAAA
TTTAACAAGACAATTAAAAAAGTGGACCATTTAAAAAAACCCTCGGTGAC
TGAAAAGGAATTGTTTTTTAAAACTCATGAATATAAATACTTGTTCGAAG
ATATTTTAAATGAATTCGAATCTGAGAAACTAAAGAGCGAGTACAGTTCA
TATTCTGAGGACCAAAGAAAGGAATTTGTTTGGAATCACCATATGATACA
AAAAAAGAATTCATTTAATTCAATGAAAATTGATTTTAAAAGCAAAAATA
TTGCCAGAGATCTATATAATTTATATCAAACTCTTACTCTGAATTGCTTA
TGTGTCATCAAAAATTTTGATAAAAGTAACGGAGTAAAAAAGCTTCTGCA
CTTATTAGACAAATGCATTAAAACCAAATGCAAAGATACAGATGTAATTG
TCCTAATCCTCAAGTGTTTAAAATCATTTGGAAATAACCACTTTGGAATT
CTGAGACTTTACGAAGAAGATGCGGTTTGTGAAATGTTGTGCAAATTAAT
AAGTACAAGATATAATGAAGAAATCATTATCGCCCTCGATCTGTTATCTG
TAATTTGTTTAATTAATGAAAATGCCAGCAACAAAATCATTTCCTCTTTT
ACAAAATTTACCCAGCGGCCTGAATGTAGATTCAAACCGCTAATTGTTTG
TTTAATGAATCGAAACAAAATAGACGTTCAACGATCAGTTATGTATTTTA
TCAACACTCTTTTACATTCAACATATAAGAAAAGAGAAGAAGGAGCCGCT
CTTCGTTTGCAACTGAGAAAAGAATTGTACAATCTTGGGTTTGAATCATA
TTTAGAATATTTCCGGGAATCCAATGACAAAATACTTAGCCACCAAGCTA
ATATCTTTCTAAACAAGAGTTACATTGATATGGAAGAATTTGATTTCGAT
TTTCTAAAATTGCAAACTCGACTTACTACATTATCGCTATGCGAAAAAGA
ATGGAACAAAATGATTCACGATGAAAATTCCAAGGAATCATCAATGATCA
GTTTTATGCATTTGATAATTTTCCTTTTCGATAAAGATAAAAAAAATATC
GATGAGATCATTTTGTATTTGAAAAATAAACTTCAAGTGACGTGCAATTT
CAATCAGGAAAAACTGTCCGATCAATTCCAAATGATAAATCTAACAGATA
ATAGTGAATCTGATGGCCACCTGGAACTAAACGATGAAACAAACATAGTA
AATTTTCCCCAAAATCGGTTCAACAAAAATAGGTCATTTTCAAGTTTATC
AGATTTGTGCTCTATCAATAGTGAATTATTGCAAAGTTTCATATCAGTTT
CTGATCTAAATAAAGATTCTGGTTTGTCTCAAAATTATGATAGAAACCAA
TCAAGTTTATTTTCCATATGTGAAACGGAAAGTTTGAATTCATTTCTATT
TGAAGAAACTGAAGTTTTAGTAAAAAGTATTTCAGAAGAAAACCTAAACC
CACAGTTAAATCATCCAAATAAACCAAGTTTCCATGCGTCATCTTTTACA
AATTCCGGTTCTCTACACTTCGGAGAAAACATTAAATCCTCAACCTTTCA
GAAACAAAATAGAAAATGTTTTTCTAAAAATTCTGATTTTCATCAAAAAA
ATGTCTTACCAAACCCAGAAAAAGACTCATCTTGCTCAATTTCGTTGAAA
TCATCTCCAAATACACTAAAACTAACACAATCTAATGCATTTATTTCCGA
TAAGAAAGGTTCGAATTTGAATGAAGAAAAACATTGTTTATCCGATGAAA
TTATCAAACATACTGCAATTTCTCCAAAATCGACAATAGGAATTTTATCT
TATTCGTCTTTGCCAAATTCTACTAATATTTCGAATGAAAATGTTGAAAT
AAACAAATTTTCTCCCTTACTTCCTGTGGCATTACCACCTCCTCCACCGC
CATTACCGCCACCACCGCCACCACCACCTGCTCCAATGTCAAATCATTTT
TATCGTTCAATTGGCAAACGCTCAAATACTGCAATGGATTCCTTTAAGCG
AATCAACGTAACACTAATACCAGAAACATGCTTAAATGAAAAATCTATCT
GGCTACAATTGAATAAAACAACTTTATCTACTGATAAAATAGTCGGGAAA
TTATTTGCTAGGTTTGCCAGTAAAAAGGCTGCAGAATTCAAAACCAAATT
CGTGAAACCATTGATAGTTTTGGATTCGAAAAATGCCCAAAATTTTGAGA
TATTTCTCCGGTCTGTCAACATGAAAAATGAAGAAATCATCAATGCTATT
AGAAAAATGAATTTTAAAGTTATTACCTTAGATATGATAAACAAATTGGT
TGCCTACATGCCTGATATCTCACAACTCGTGAAATTGGAGCCTTTCAAGG
ATAAAATTGAGGATCTGAGGTTATGTGAACAATTTATTGTGCATCTCATG
GAAGTGGACAATTATAAAATTCGGTTCAATGGAATACATTTGCAAATTCT
TGTCTCAAATGATTGCCTGAAAGAAGTGGAAAATAGTTTAGATTTGTTGT
ATAGTTCTTTTGAGAAATTGCTGTCCAGTGATAAATTGAAATCAGTTCTT
GAAATGGTCGTGTTTATAACGCAATCTATGAATCCAGAAAAGAAAATTGT
AGGAATTACATTGGATTCTCTCGCTAAGTTCGTAGACACGAAAGATAACT
GTAATGGGAATCTTTTAGAATTTCTTGTTGAACAATTGCGAGACTTAGTA
CCAGAGTCGCTAAAAGTGTGGGATGATTTGGATAGCTTAGATTCAGCATC
TCGTATATCAAGTGATAGTATAAATTCAGTAGTAAATCAATTCTCCACTG
TCTTGAAATCATTACAATGCGACATTGAAAATATCGATTCTATCAATCTT
AGATCAGAAATATCTGTTACTGTAGAACTTGCTAAGAATTTATTATCACA
TATTTCTTTCCTGCAAAACGAGTTGGATTCGAAATATCAAGAAGTCTGTG
AGTATTTCGGTATTTCAAAATCGAATTATTGTTTTGAAAAATTATTTTCC
GATTTAAAACTTTTTAAAAATCAATTTAAAAATTCTGAAAAAATAATTTA
TGAACGTCAAAAATTGAACGAAATCCACAAACAGAAAATGGAATCCATTA
ATAAAATGCAAATCCAACAGTTTCAACAGTCTGACCAATTGGCAATCATT
TTATCATCATTGGACGGAGAAAAGTCAAGTGAGAAAAAATTAAAATCTAT
TTTCAAACAATCAGCATTCATTGAAAATGCAATTATTGGAATTAGTTCGG
GGAAAATATTTTGTGACGAGGACTCAGTATTAAATTGGAACGTCCAATAT
CACCGTAGAGAAAATCAGAAAAATCGCGTGAGAAATGCCAGAAATATTCG
AAGATTAAATTTTAATAACCTTACACCATCCCGAAGCCGAAAAATAGATT
TTACCCAAACAATGATACCAGAATCAATATAATAATTCATTTTCTGCATG
TATTTATTTTATTCGTGTTTAGATTATTTGTGCTTTTATATTTTGTATAA
AATTGATGACGTAATTAATTTATTTCATATAAATCAATTTGGATTTCAGT
CTCTAATTCTATGGTTCCGTTTTTATTGATTGACATTAAGTTGGAATATG
TCC
back to top

protein sequence of SMED30035463-orf-1

>SMED30035463-orf-1 ID=SMED30035463-orf-1|Name=SMED30035463-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1159bp
MTNKLKTISRKSILKFNKTIKKVDHLKKPSVTEKELFFKTHEYKYLFEDI
LNEFESEKLKSEYSSYSEDQRKEFVWNHHMIQKKNSFNSMKIDFKSKNIA
RDLYNLYQTLTLNCLCVIKNFDKSNGVKKLLHLLDKCIKTKCKDTDVIVL
ILKCLKSFGNNHFGILRLYEEDAVCEMLCKLISTRYNEEIIIALDLLSVI
CLINENASNKIISSFTKFTQRPECRFKPLIVCLMNRNKIDVQRSVMYFIN
TLLHSTYKKREEGAALRLQLRKELYNLGFESYLEYFRESNDKILSHQANI
FLNKSYIDMEEFDFDFLKLQTRLTTLSLCEKEWNKMIHDENSKESSMISF
MHLIIFLFDKDKKNIDEIILYLKNKLQVTCNFNQEKLSDQFQMINLTDNS
ESDGHLELNDETNIVNFPQNRFNKNRSFSSLSDLCSINSELLQSFISVSD
LNKDSGLSQNYDRNQSSLFSICETESLNSFLFEETEVLVKSISEENLNPQ
LNHPNKPSFHASSFTNSGSLHFGENIKSSTFQKQNRKCFSKNSDFHQKNV
LPNPEKDSSCSISLKSSPNTLKLTQSNAFISDKKGSNLNEEKHCLSDEII
KHTAISPKSTIGILSYSSLPNSTNISNENVEINKFSPLLPVALPPPPPPL
PPPPPPPPAPMSNHFYRSIGKRSNTAMDSFKRINVTLIPETCLNEKSIWL
QLNKTTLSTDKIVGKLFARFASKKAAEFKTKFVKPLIVLDSKNAQNFEIF
LRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDK
IEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYS
SFEKLLSSDKLKSVLEMVVFITQSMNPEKKIVGITLDSLAKFVDTKDNCN
GNLLEFLVEQLRDLVPESLKVWDDLDSLDSASRISSDSINSVVNQFSTVL
KSLQCDIENIDSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEY
FGISKSNYCFEKLFSDLKLFKNQFKNSEKIIYERQKLNEIHKQKMESINK
MQIQQFQQSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGK
IFCDEDSVLNWNVQYHRRENQKNRVRNARNIRRLNFNNLTPSRSRKIDFT
QTMIPESI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR010473GTPase-bd
IPR015425FH2_Formin
IPR010472FH3_dom
IPR014768GBD/FH3_dom
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0017048Rho GTPase binding
GO:0003779actin binding
GO:0005488binding
Vocabulary: biological process
TermDefinition
GO:0030036actin cytoskeleton organization
GO:0016043cellular component organization
GO:0007015actin filament organization
GO:0007049cell cycle