SMED30035458
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30035458 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 1
Alignments
SMED30035458 aligns in the following genomic locations:
Homology
BLAST of SMED30035458 vs. Ensembl Human
Match: TRIAP1 (TP53 regulated inhibitor of apoptosis 1 [Source:HGNC Symbol;Acc:HGNC:26937]) HSP 1 Score: 43.8986 bits (102), Expect = 6.212e-6 Identity = 24/63 (38.10%), Postives = 35/63 (55.56%), Query Frame = 2 Query: 110 MPSFSKECDQYKKTYDACFSEFFP-KFLSGD-KNDPCGDKLAVYVSCVRKDLEKLNLDIKELD 292 M S + C K+ YD CF+ +F KFL GD DPC D Y CV+K +++ + I+ L+ Sbjct: 1 MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLE 63
BLAST of SMED30035458 vs. Ensembl Celegans
Match: mdmh-35 (MitochonDrial interMembrane space protein Homolog [Source:RefSeq peptide;Acc:NP_495651]) HSP 1 Score: 46.595 bits (109), Expect = 3.455e-7 Identity = 27/75 (36.00%), Postives = 38/75 (50.67%), Query Frame = 2 Query: 104 RHMPSFSKECDQYKKTYDACFSEFFPKFLSGDKN-----DPCGDKLAVYVSCVRKDL---EKLNLDIKELDQSKL 304 RHM S ECD K+ YD CF+EFF KF++ + +PC VY CV + L +D+ E+ + L Sbjct: 4 RHMSSIFPECDHLKQIYDKCFTEFFQKFITPNYRHQYAVNPCERLHDVYKRCVEERLATQRPFEIDLDEIRKEYL 78
BLAST of SMED30035458 vs. Ensembl Fly
Match: CG30108 (gene:FBgn0050108 transcript:FBtr0273298) HSP 1 Score: 47.7506 bits (112), Expect = 1.483e-7 Identity = 22/63 (34.92%), Postives = 40/63 (63.49%), Query Frame = 2 Query: 110 MPSFSKECDQYKKTYDACFSEFFP-KFLSGDKND-PCGDKLAVYVSCVRKDLEKLNLDIKELD 292 M S ++C++ K+ YDACF+ +F +FL G +D C VY CV++ +++ +D++E+D Sbjct: 1 MSSVGEDCNELKQQYDACFNSWFSERFLKGQMDDSACAPIFRVYQECVKRAIKEKKIDLQEID 63
BLAST of SMED30035458 vs. Ensembl Fly
Match: CG30109 (gene:FBgn0050109 transcript:FBtr0340271) HSP 1 Score: 44.669 bits (104), Expect = 2.263e-6 Identity = 21/62 (33.87%), Postives = 38/62 (61.29%), Query Frame = 2 Query: 110 MPSFSKECDQYKKTYDACFSEFFPK-FLSGDKNDP-CGDKLAVYVSCVRKDLEKLNLDIKEL 289 M S ++C++ KK YDACF+ +F + FL G +D C VY CV++ + + ++++E+ Sbjct: 1 MNSIGEDCNELKKQYDACFNSWFSEGFLKGQTDDSGCAPIFRVYQECVKRAMREQKIELREV 62
BLAST of SMED30035458 vs. Ensembl Zebrafish
Match: triap1 (TP53 regulated inhibitor of apoptosis 1 [Source:ZFIN;Acc:ZDB-GENE-050417-161]) HSP 1 Score: 43.8986 bits (102), Expect = 3.306e-6 Identity = 22/63 (34.92%), Postives = 40/63 (63.49%), Query Frame = 2 Query: 110 MPSFSKECDQYKKTYDACFSEFFP-KFLSGDKN-DPCGDKLAVYVSCVRKDLEKLNLDIKELD 292 M S + C + K+ YD CF+ +F KFL GD++ DPC + Y +CV+K +++ ++ I+ ++ Sbjct: 1 MNSVGEGCTELKREYDQCFNRWFAEKFLKGDRSADPCSELFNKYHTCVQKAIKEKDIPIEGVE 63
BLAST of SMED30035458 vs. Ensembl Mouse
Match: Triap1 (TP53 regulated inhibitor of apoptosis 1 [Source:MGI Symbol;Acc:MGI:1916326]) HSP 1 Score: 43.8986 bits (102), Expect = 4.583e-6 Identity = 24/63 (38.10%), Postives = 35/63 (55.56%), Query Frame = 2 Query: 110 MPSFSKECDQYKKTYDACFSEFFP-KFLSGD-KNDPCGDKLAVYVSCVRKDLEKLNLDIKELD 292 M S + C K+ YD CF+ +F KFL GD DPC D Y CV+K +++ + I+ L+ Sbjct: 1 MNSVGEACTDMKREYDQCFNRWFAEKFLKGDGSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLE 63
BLAST of SMED30035458 vs. UniProt/SwissProt
Match: sp|P45967|MIS35_CAEEL (Uncharacterized protein mdmh-35 OS=Caenorhabditis elegans OX=6239 GN=mdmh-35 PE=3 SV=1) HSP 1 Score: 46.595 bits (109), Expect = 4.394e-6 Identity = 27/75 (36.00%), Postives = 38/75 (50.67%), Query Frame = 2 Query: 104 RHMPSFSKECDQYKKTYDACFSEFFPKFLSGDKN-----DPCGDKLAVYVSCVRKDL---EKLNLDIKELDQSKL 304 RHM S ECD K+ YD CF+EFF KF++ + +PC VY CV + L +D+ E+ + L Sbjct: 4 RHMSSIFPECDHLKQIYDKCFTEFFQKFITPNYRHQYAVNPCERLHDVYKRCVEERLATQRPFEIDLDEIRKEYL 78
BLAST of SMED30035458 vs. TrEMBL
Match: A0A183A0W5 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS600 PE=4 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 2.243e-17 Identity = 36/65 (55.38%), Postives = 43/65 (66.15%), Query Frame = 2 Query: 110 MPSFSKECDQYKKTYDACFSEFFPKFLSGDKNDPCGDKLAVYVSCVRKDLEKLNLDIKELDQSKL 304 + S ECD K YDACF EFFPKFL G NDPCG KL Y C+R LE + +D+KELD S++ Sbjct: 26 LGSLVPECDSVKSAYDACFQEFFPKFLRGSTNDPCGPKLKAYQQCLRGTLESMGIDMKELDASRV 90
BLAST of SMED30035458 vs. TrEMBL
Match: A0A504YH30 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_09350 PE=4 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 1.183e-16 Identity = 34/65 (52.31%), Postives = 42/65 (64.62%), Query Frame = 2 Query: 110 MPSFSKECDQYKKTYDACFSEFFPKFLSGDKNDPCGDKLAVYVSCVRKDLEKLNLDIKELDQSKL 304 + S + ECD K YDACF EFFPKFL G DPCG KL Y C+R LE + +D+ ELD S++ Sbjct: 29 LGSLAPECDSVKSAYDACFQEFFPKFLRGSTADPCGPKLRAYQQCLRGTLESIGIDMTELDASRM 93
BLAST of SMED30035458 vs. TrEMBL
Match: A0A2H1C2G1 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_11419 PE=4 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 1.360e-16 Identity = 34/65 (52.31%), Postives = 42/65 (64.62%), Query Frame = 2 Query: 110 MPSFSKECDQYKKTYDACFSEFFPKFLSGDKNDPCGDKLAVYVSCVRKDLEKLNLDIKELDQSKL 304 + S + ECD K YDACF EFFPKFL G DPCG KL Y C+R LE + +D+ ELD S++ Sbjct: 29 LGSLAPECDSVKSAYDACFQEFFPKFLRGSTADPCGPKLRAYQQCLRGTLESIGIDMTELDASRM 93
BLAST of SMED30035458 vs. TrEMBL
Match: A0A5J4NHL6 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0009325 PE=4 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 6.120e-15 Identity = 33/68 (48.53%), Postives = 42/68 (61.76%), Query Frame = 2 Query: 101 QRHMPSFSKECDQYKKTYDACFSEFFPKFLSGDKNDPCGDKLAVYVSCVRKDLEKLNLDIKELDQSKL 304 Q +PS + ECD K YDACF +FF KFL G DPCG KL Y C+R L L +D+ E+D S++ Sbjct: 53 QTKLPSLAPECDPLKAAYDACFQDFFQKFLHGSTTDPCGPKLKAYQKCLRSTLVSLGIDLTEVDASRM 120
BLAST of SMED30035458 vs. TrEMBL
Match: G7YGS6 (Uncharacterized protein T09A5.7 OS=Clonorchis sinensis OX=79923 GN=T09A5.7 PE=4 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 2.478e-12 Identity = 31/65 (47.69%), Postives = 39/65 (60.00%), Query Frame = 2 Query: 110 MPSFSKECDQYKKTYDACFSEFFPKFLSGDKNDPCGDKLAVYVSCVRKDLEKLNLDIKELDQSKL 304 + S + ECD K YDACF EFF KFL G DPCG KL Y C+R L L LD+ ++D + + Sbjct: 24 LRSLAPECDSLKAAYDACFQEFFEKFLHGYSVDPCGQKLKAYQKCLRGALSNLGLDMTKIDSTHM 88
BLAST of SMED30035458 vs. Ensembl Nematostella
Match: EDO32160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVU1]) HSP 1 Score: 48.9062 bits (115), Expect = 1.489e-8 Identity = 25/70 (35.71%), Postives = 42/70 (60.00%), Query Frame = 2 Query: 110 MPSFSKECDQYKKTYDACFSEFFPK-FLSGDK-NDPCGDKLAVYVSCVRKDLEKLNLDIKELDQSKLLRG 313 M S +EC++ K+ YDACF+ ++ FL GD+ PC + Y +CV K +++ N+ I E++ + L G Sbjct: 1 MNSVGEECNELKREYDACFNVWYTDYFLKGDRQTTPCKEMFEKYRTCVMKAIKEKNISIDEINDNTLGTG 70
BLAST of SMED30035458 vs. Ensembl Medaka
Match: triap1 (TP53 regulated inhibitor of apoptosis 1 [Source:NCBI gene;Acc:101164329]) HSP 1 Score: 43.1282 bits (100), Expect = 6.611e-6 Identity = 21/59 (35.59%), Postives = 35/59 (59.32%), Query Frame = 2 Query: 110 MPSFSKECDQYKKTYDACFSEFFP-KFLSGDK-NDPCGDKLAVYVSCVRKDLEKLNLDI 280 M S + C + K+ YD CF+ +F KFL GD+ DPC + Y CV+K +++ ++ + Sbjct: 1 MNSVGEACTELKREYDQCFNRWFAEKFLKGDRSGDPCTETFRRYQRCVQKAIKEKDIPV 59
BLAST of SMED30035458 vs. Planmine SMEST
Match: SMESG000021176.1 (SMESG000021176.1) HSP 1 Score: 179.104 bits (453), Expect = 6.261e-59 Identity = 91/103 (88.35%), Postives = 91/103 (88.35%), Query Frame = 2 Query: 23 MQCNSXXXXXXXXXXXADKKPTNIADQRHMPSFSKECDQYKKTYDACFSEFFPKFLSGDKNDPCGDKLAVYVSCVRKDLEKLNLDIKELDQSKLLRGDRSDIK 331 MQCN ADKKPTNIADQRHMPSFSKECDQYKKTYDACFSEFFPKFLSGDKNDPCGDKLAVYVSCVRKDLEKLNLDIKELDQSKLLRGDRSDIK Sbjct: 1 MQCN------------ADKKPTNIADQRHMPSFSKECDQYKKTYDACFSEFFPKFLSGDKNDPCGDKLAVYVSCVRKDLEKLNLDIKELDQSKLLRGDRSDIK 91 The following BLAST results are available for this feature:
BLAST of SMED30035458 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 1
BLAST of SMED30035458 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 1
BLAST of SMED30035458 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 2
BLAST of SMED30035458 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 1
BLAST of SMED30035458 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30035458 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 1
BLAST of SMED30035458 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 1
BLAST of SMED30035458 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of SMED30035458 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30035458 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30035458 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30035458 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 1
BLAST of SMED30035458 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 1
BLAST of SMED30035458 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 1
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30035458 ID=SMED30035458|Name=SMED30035458|organism=Schmidtea mediterranea sexual|type=transcript|length=526bpback to top protein sequence of SMED30035458-orf-1 >SMED30035458-orf-1 ID=SMED30035458-orf-1|Name=SMED30035458-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp LSIIENAMQCNSIIQXIXINLIXADKKPTNIADQRHMPSFSKECDQYKKTback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|