TNF receptor-associated factor 6

Overview
NameTNF receptor-associated factor 6
Smed IDSMED30035455
Length (bp)439
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor 6 (SMED30035455) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor 6 (SMED30035455) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035455

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30035455SMESG000025869.1 dd_Smed_v4_11059_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000025869.1 Contig18631newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000025869.1 Contig18631uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000025869.1 SMESG000025517.1 Contig4791newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000025869.1 SMESG000025517.1 Contig4791uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000025869.1 SMESG000025517.1 Contig4792newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000025869.1 SMESG000025517.1 Contig4792uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000025869.1 Contig5638newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000025869.1 Contig5638uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000062736.1 Contig4791newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000062736.1 Contig4791uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000018712.1 Contig4792newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000018712.1 Contig4792uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000068028.1 Contig5638newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035455SMESG000068028.1 Contig5638uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor 6 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 55.8398 bits (133), Expect = 2.370e-9
Identity = 35/117 (29.91%), Postives = 51/117 (43.59%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCP 391
            ++ Y  E    ++    C +C   L  A   PCG RFC  CI   +      CP D E      + L+  +F +      I  L VKCP   C +  ELR +E+H   C++  + CP
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 55.8398 bits (133), Expect = 2.370e-9
Identity = 35/117 (29.91%), Postives = 51/117 (43.59%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCP 391
            ++ Y  E    ++    C +C   L  A   PCG RFC  CI   +      CP D E      + L+  +F +      I  L VKCP   C +  ELR +E+H   C++  + CP
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 50.8322 bits (120), Expect = 6.952e-8
Identity = 34/121 (28.10%), Postives = 55/121 (45.45%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMC-KNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLD-GNIFVEYAINVRISKLKVKC--PLMFCDYVDELRKMEEHSRTCKYRSVKCP 391
            M  + Y+      R +LC +C K +    + + CG RFC TC+  +L  G   CP D        L LD   I+ +  + V++  L ++C      C +   LR ++ H  TC +  + CP
Sbjct:    1 MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQ-------LPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCP 114          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 51.2174 bits (121), Expect = 1.058e-7
Identity = 34/121 (28.10%), Postives = 55/121 (45.45%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMC-KNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLD-GNIFVEYAINVRISKLKVKC--PLMFCDYVDELRKMEEHSRTCKYRSVKCP 391
            M  + Y+      R +LC +C K +    + + CG RFC TC+  +L  G   CP D        L LD   I+ +  + V++  L ++C      C +   LR ++ H  TC +  + CP
Sbjct:    1 MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQ-------LPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCP 114          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 48.1358 bits (113), Expect = 6.273e-7
Identity = 31/121 (25.62%), Postives = 54/121 (44.63%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMC-KNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCK-LEILNLDGNIFVEYAINVRISKLKVKC--PLMFCDYVDELRKMEEHSRTCKYRSVKCP 391
            M  + Y+      R +LC +C K +    + + CG RFC TC+  +L  G   CP D       +  +    I+ +  + V++  L ++C      C +   LR ++ H  TC +  + CP
Sbjct:    1 MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKFPHPYPQIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCP 121          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 55.0694 bits (131), Expect = 2.062e-9
Identity = 33/120 (27.50%), Postives = 55/120 (45.83%), Query Frame = 2
Query:   74 IDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCP--LMFCDYVDELRKMEEHSRTCKYR------SVKCPYSNIGC 409
            +D    C +C + L       CG RFC +C++ ++ + N+ CP D +      L+ + +IF +      I +LK  CP   + C  V    ++  H  +C YR        KCP++ I C
Sbjct:   98 LDSRYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNKR-----LSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKC 212          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Zebrafish
Match: traf1 (TNF receptor-associated factor 1 [Source:ZFIN;Acc:ZDB-GENE-071120-4])

HSP 1 Score: 60.4622 bits (145), Expect = 3.773e-11
Identity = 40/113 (35.40%), Postives = 55/113 (48.67%), Query Frame = 2
Query:   89 LCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNK-----FCPGDTEDCKLEILNLDGN-IFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGC 409
            LC  C N+L  AR   CG R+C  C++ +L R NK      C G+  + + +   L  N  F + AIN  I  LKV C    C +   L+  E+H   C+Y  + C   NIGC
Sbjct:   41 LCSNCNNVLNKARQTVCGHRYCLACVN-WLVRNNKDLVCTKCKGEDSNVESDTSVLTPNQFFNDVAINKEILDLKVHCANQGCPWRSTLKNFEDHQSQCEYALIPC---NIGC 149          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 53.9138 bits (128), Expect = 8.252e-9
Identity = 34/116 (29.31%), Postives = 52/116 (44.83%), Query Frame = 2
Query:   44 RNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCP 391
            + Y  E    ++    C +C   L +A   PCG RFC +CI   +    + CP D E      + L+  +F +      I  L VKC    C    ELR++E+H   C++ +  CP
Sbjct:   55 QGYDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNE------VLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCP 164          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 53.9138 bits (128), Expect = 8.252e-9
Identity = 34/116 (29.31%), Postives = 52/116 (44.83%), Query Frame = 2
Query:   44 RNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCP 391
            + Y  E    ++    C +C   L +A   PCG RFC +CI   +    + CP D E      + L+  +F +      I  L VKC    C    ELR++E+H   C++ +  CP
Sbjct:   55 QGYDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNE------VLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCP 164          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 53.9138 bits (128), Expect = 8.252e-9
Identity = 34/116 (29.31%), Postives = 52/116 (44.83%), Query Frame = 2
Query:   44 RNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCP 391
            + Y  E    ++    C +C   L +A   PCG RFC +CI   +    + CP D E      + L+  +F +      I  L VKC    C    ELR++E+H   C++ +  CP
Sbjct:   55 QGYDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNE------VLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCP 164          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Zebrafish
Match: lnx1 (ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9439])

HSP 1 Score: 49.2914 bits (116), Expect = 2.887e-7
Identity = 33/112 (29.46%), Postives = 53/112 (47.32%), Query Frame = 2
Query:   47 NYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELR---KMEEHSRT-CK 370
            N++Y    D+D +++C +C   LI     PCG  +C  C++ +L   + FCP D     L+       +     ++  + KL V CP  F D+  E+    +ME H R  CK
Sbjct:   42 NHEYTYKEDVDDDLMCHICLQPLIRPLDTPCGHTYCQECLTNFLLESD-FCPVDRTPLMLQKCRKSSLL-----VHKLLDKLMVSCP--FADHCTEVMPRGEMEGHIRCRCK 145          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 56.6102 bits (135), Expect = 1.186e-9
Identity = 38/133 (28.57%), Postives = 56/133 (42.11%), Query Frame = 2
Query:   29 VCQIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNIS 427
            V + ++ Y  E    ++    C +C   L  A   PCG RFC  CI   +      CP D E        ++  +F +      I  L+VKCP   C    ELR +E H        V+C ++ + CS+C  S
Sbjct:   51 VLEDVQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESL------MENQLFPDNFAKREILSLRVKCPSQGCTETMELRHLERH-------LVRCDFAGVECSQCQSS 170          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 49.2914 bits (116), Expect = 3.771e-7
Identity = 32/121 (26.45%), Postives = 55/121 (45.45%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMC-KNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLD-GNIFVEYAINVRISKLKVKC--PLMFCDYVDELRKMEEHSRTCKYRSVKCP 391
            M  Y Y+    + R  LC +C K +    + + CG RFC TC+  +L  G   CP D        L LD   I+ +  +  ++  L ++C      C +  +L++++ H   C +  + CP
Sbjct:    1 MPGYDYKFLEKLRRKFLCPLCGKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQ-------LPLDYAKIYPDRDLETQVMGLSIRCIHSEEGCRWSGQLKQLQPHLNICAFNVIPCP 114          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Xenopus
Match: LNX1 (ligand of numb-protein X 1 [Source:NCBI gene;Acc:100487348])

HSP 1 Score: 49.2914 bits (116), Expect = 4.555e-7
Identity = 36/132 (27.27%), Postives = 62/132 (46.97%), Query Frame = 2
Query:    2 EMDVSKLENVCQIM-------RNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLM-FCDYVDELRKMEEHSRT-CK 370
            E+D  K +++C +         N+ Y    ++D ++LC +C + LI     PCG  +C  C++ +L   + FCP D +   L+       I V+  ++    KL V CP    C  + +   +EEH +  CK
Sbjct:    9 ELDNEKPQSLCTVCGQLHSEEENHSYTYTEEVDDDLLCNICLHALIQPLDTPCGHTYCTLCLTSFLVHED-FCPVDRKHILLQTCK-KSTILVKNLLD----KLPVICPFKEHCTDIVQRCDLEEHFQNRCK 134          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Xenopus
Match: ddx54 (DEAD-box helicase 54 [Source:Xenbase;Acc:XB-GENE-1011576])

HSP 1 Score: 48.521 bits (114), Expect = 8.090e-7
Identity = 31/116 (26.72%), Postives = 51/116 (43.97%), Query Frame = 2
Query:   47 NYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPL-MFCDYVDELRKMEEHSRTCKYRSVKCP 391
            N+ Y    ++D +++C +C   L+     PCG  FCF C+  +L +   FCP D +    ++     +I V   ++    KL V CP    C    +   ME H +       +CP
Sbjct:   33 NHLYNYQNEVDDDLVCHICLQPLLQPLDTPCGHTFCFKCLRNFL-QEKDFCPLDRKRLHFKLCK-KSSILVHKLLD----KLVVSCPYSAACKETMQRCDMEAHLKN------RCP 136          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 57.7658 bits (138), Expect = 4.200e-10
Identity = 38/129 (29.46%), Postives = 54/129 (41.86%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNIS 427
            ++ Y  E    ++    C +C   L  A   PCG RFC  CI   +      CP D E      + L+  +F +      I  L VKCP   C    ELR +E+H   C++  V CP       KC ++
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVN 175          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Mouse
Match: Traf4 (TNF receptor associated factor 4 [Source:MGI Symbol;Acc:MGI:1202880])

HSP 1 Score: 48.9062 bits (115), Expect = 4.793e-7
Identity = 35/121 (28.93%), Postives = 55/121 (45.45%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMC-KNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLD-GNIFVEYAINVRISKLKVKC--PLMFCDYVDELRKMEEHSRTCKYRSVKCP 391
            M  + Y+      R +LC +C K +    + + CG RFC TC+  +L  G   CP D        L LD   I+ +  + V++  L ++C      C +   LR ++ H  TC +  V CP
Sbjct:    1 MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQ-------LPLDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCP 114          
BLAST of TNF receptor-associated factor 6 vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 3.737e-10
Identity = 37/116 (31.90%), Postives = 51/116 (43.97%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKC 388
            ++ Y  E    ++    C +C   L  A   PCG RFC  CI   L      CP D E      + ++  +F +      I  LKVKCP   C    ELR +E H   C++ SV+C
Sbjct:   55 VQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIVKSLRDAGHKCPVDNE------ILMENQLFPDNFAKREILSLKVKCPSQGCTETMELRHLERHLGQCQFASVEC 164          
BLAST of TNF receptor-associated factor 6 vs. UniProt/SwissProt
Match: sp|Q3ZCC3|TRAF6_BOVIN (TNF receptor-associated factor 6 OS=Bos taurus OX=9913 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 8.683e-10
Identity = 38/129 (29.46%), Postives = 56/129 (43.41%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNIS 427
            ++ Y  E    ++    C +C   L  A   PCG RFC  CI   +      CP D E      + L+  +F +      I  L VKCP   C +  ELR +EEH   C++  + CP       KC+++
Sbjct:   54 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEEHQAHCEFALMSCPQCQRPFQKCHLN 176          
BLAST of TNF receptor-associated factor 6 vs. UniProt/SwissProt
Match: sp|B5DF45|TRAF6_RAT (TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.247e-9
Identity = 39/130 (30.00%), Postives = 56/130 (43.08%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQ 430
            ++ Y  E    ++    C +C   L  A   PCG RFC  CI+  +      CP D E      + L+  +F +      I  L VKCP   C    ELR +E+H   C++  V CP       KC I++
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACITKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLTVKCPNKGCVQKMELRHLEDHQVHCEFALVICPQCQRFFQKCQINK 176          
BLAST of TNF receptor-associated factor 6 vs. UniProt/SwissProt
Match: sp|A7XUJ6|TRAF6_PIG (TNF receptor-associated factor 6 OS=Sus scrofa OX=9823 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.474e-9
Identity = 37/129 (28.68%), Postives = 56/129 (43.41%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNIS 427
            ++ Y  E    ++    C +C   L  A   PCG RFC  CI   +      CP D E      + L+  +F +      I  L VKCP + C +  ELR +E+H   C++  + CP       KC ++
Sbjct:   54 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLTVKCPNVGCLHKMELRHLEDHQAHCEFALMNCPQCQRPFQKCQLN 176          
BLAST of TNF receptor-associated factor 6 vs. UniProt/SwissProt
Match: sp|Q3MV19|TRF6A_XENLA (TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.600e-9
Identity = 36/116 (31.03%), Postives = 52/116 (44.83%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKC 388
            ++ Y  E    ++    C +C   L  A   PCG RFC  CI   L      CP D E      + ++  +F +      I  L+VKCP + C    ELR +E H   C++ SV+C
Sbjct:   55 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSLRNAGHKCPVDNE------ILMEKQLFPDNFAKREILSLRVKCPNLGCTDTMELRHLEHHLVQCQFASVEC 164          
BLAST of TNF receptor-associated factor 6 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 4.232e-29
Identity = 55/131 (41.98%), Postives = 82/131 (62.60%), Query Frame = 2
Query:   23 ENVCQIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSK 415
            E + +++  Y +E+   +  N+ C +CKNLL+NA  + CGCRFC  CI  Y+ RGN +CPG T +CK E L +  NI  +Y +N +I+K++VKCP   C    EL  +EEH R C  +S  CP+  +GC++
Sbjct:    4 EKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQ 134          
BLAST of TNF receptor-associated factor 6 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 7.267e-27
Identity = 53/143 (37.06%), Postives = 93/143 (65.03%), Query Frame = 2
Query:   14 SKLENVCQIMRNYKYE-IATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKV 439
            SKL+NV +++  Y  + +   ++ ++LC++C  L+ +A  + CGC +C+TCI  YL + + +CPGD  +CK + LNL+G++F    ++ RIS++ VKCP + C+Y  EL +++EH   C   SV+CP   IGC +  + +D++
Sbjct:    4 SKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEM 146          
BLAST of TNF receptor-associated factor 6 vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 5.861e-26
Identity = 50/67 (74.63%), Postives = 58/67 (86.57%), Query Frame = 2
Query:  239 LDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKV 439
            L+ NI V+Y +N++I+KL+VKC    CDYVDELRKME+HSRTCKYRSV CPYSNIGC KCNISQDKV
Sbjct:   12 LNENICVDYPMNMKIAKLQVKCKEKSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKV 78          
BLAST of TNF receptor-associated factor 6 vs. TrEMBL
Match: A0A2B4SJ65 (TNF receptor-associated factor 4 OS=Stylophora pistillata OX=50429 GN=Traf4 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.587e-12
Identity = 42/122 (34.43%), Postives = 63/122 (51.64%), Query Frame = 2
Query:   35 QIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSN 400
            ++   Y Y+  ++ID + +C +C   L NA    CG RFC  C++ +  R +  CP D E      L+ D ++F + A   RI    +KCP   C +V ELR +E H + C Y  V+CP  N
Sbjct:    9 ELPTGYDYDFVSEIDEDFICQICHLPLRNAVLTRCGHRFCVDCLNEHFRRNSPNCPLDREK-----LDKDKDVFPDKASQRRILSYLIKCPDK-CQWVGELRDVEGHKKKCPYVIVQCPNHN 124          
BLAST of TNF receptor-associated factor 6 vs. TrEMBL
Match: A0A1B0AN13 (Uncharacterized protein OS=Glossina palpalis gambiensis OX=67801 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.500e-11
Identity = 43/130 (33.08%), Postives = 65/130 (50.00%), Query Frame = 2
Query:   44 RNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCP--LMFCDYVDELRKMEEHSRTCKYRS------VKCPYSNIGC 409
            R+   E  TD D   LC +C N L       CG RFC +C+S +LG   ++CP D E      ++ D ++F +      I ++K+KCP   + CD V    ++E H   C YR+       KCP+++I C
Sbjct:   66 RSSSLEDHTDPDGRYLCAICINWLNEPVLTSCGHRFCKSCLSSWLGPERQWCPMDNEK-----ISGDQDVFPDNFTRREIEQIKLKCPNANLGCDLVASPIEVERHRYNCPYRTNEDSAEEKCPFASIKC 190          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 59.3066 bits (142), Expect = 8.778e-11
Identity = 41/117 (35.04%), Postives = 57/117 (48.72%), Query Frame = 2
Query:   83 NMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNK--FC------PGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGC 409
            + LC  C N+L  A    CG R+C  C+  +L R NK   C      PG   D  + +L LD + F + AIN  I +L+V C    C +   L+  E+H   C+Y  + C   NIGC
Sbjct:   26 HFLCSSCNNVLNEAHQTQCGHRYCRACVM-WLLRNNKDLICTKCKEDPGSESDSSM-MLTLD-HFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGC 136          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 58.9214 bits (141), Expect = 1.126e-10
Identity = 41/117 (35.04%), Postives = 57/117 (48.72%), Query Frame = 2
Query:   83 NMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNK--FC------PGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGC 409
            + LC  C N+L  A    CG R+C  C+  +L R NK   C      PG   D  + +L LD + F + AIN  I +L+V C    C +   L+  E+H   C+Y  + C   NIGC
Sbjct:   26 HFLCSSCNNVLNEAHQTQCGHRYCRACVM-WLLRNNKDLICTKCKEDPGSESDSSM-MLTLD-HFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGC 136          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Cavefish
Match: lnx2b (ligand of Numb protein X 2-like [Source:NCBI gene;Acc:103036791])

HSP 1 Score: 50.8322 bits (120), Expect = 7.125e-8
Identity = 26/85 (30.59%), Postives = 42/85 (49.41%), Query Frame = 2
Query:   56 YEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPL 310
            YE   D+D  ++C +C   L+     PCG  +C+ C+S +L R   FCP D +  +L+      ++ V   ++    KL V CP 
Sbjct:   34 YEYQDDVDDELVCHICLQPLLQPMDTPCGHTYCYQCLSSFL-RDQDFCPVDRQRLQLQQCR-SSSLLVRNLLD----KLTVLCPF 112          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Cavefish
Match: lnx2b (ligand of Numb protein X 2-like [Source:NCBI gene;Acc:103036791])

HSP 1 Score: 50.8322 bits (120), Expect = 7.192e-8
Identity = 26/85 (30.59%), Postives = 42/85 (49.41%), Query Frame = 2
Query:   56 YEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPL 310
            YE   D+D  ++C +C   L+     PCG  +C+ C+S +L R   FCP D +  +L+      ++ V   ++    KL V CP 
Sbjct:   34 YEYQDDVDDELVCHICLQPLLQPMDTPCGHTYCYQCLSSFL-RDQDFCPVDRQRLQLQQCR-SSSLLVRNLLD----KLTVLCPF 112          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Cavefish
Match: lnx2b (ligand of Numb protein X 2-like [Source:NCBI gene;Acc:103036791])

HSP 1 Score: 50.8322 bits (120), Expect = 7.192e-8
Identity = 26/85 (30.59%), Postives = 42/85 (49.41%), Query Frame = 2
Query:   56 YEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPL 310
            YE   D+D  ++C +C   L+     PCG  +C+ C+S +L R   FCP D +  +L+      ++ V   ++    KL V CP 
Sbjct:   34 YEYQDDVDDELVCHICLQPLLQPMDTPCGHTYCYQCLSSFL-RDQDFCPVDRQRLQLQQCR-SSSLLVRNLLD----KLTVLCPF 112          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 50.8322 bits (120), Expect = 1.416e-8
Identity = 35/117 (29.91%), Postives = 51/117 (43.59%), Query Frame = 2
Query:   44 RNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCI--SGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKC 388
            + Y+ +    ++    C +C   L      PCG RFC  CI  S  L      CP D       +L+ +G +F +      I  L V+CP   C +  ELR ++EH   C+Y  V C
Sbjct:   49 QGYEADFEPPLESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCPVDNA-----VLH-EGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPC 159          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Sea Lamprey
Match: rnf41l (ring finger protein 41, like [Source:ZFIN;Acc:ZDB-GENE-030131-9441])

HSP 1 Score: 42.3578 bits (98), Expect = 4.356e-6
Identity = 30/114 (26.32%), Postives = 49/114 (42.98%), Query Frame = 2
Query:   74 IDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSN-IGCS 412
            +   +LC +C+++L +   APC   FC  CI G+L   N  CP D +      L     +F     ++   +L        C+ V  L  +  H + C Y    CP++  + CS
Sbjct:   12 VKDGLLCCVCRDVLEDPLQAPCEHAFCSACIHGWLVH-NHTCPEDRQPLDASELR---PLFRYMRNDLNALRLHCTHRARGCEGVCALETIAIHEQQCPYTPTPCPHTGELACS 121          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 58.9214 bits (141), Expect = 4.299e-11
Identity = 37/116 (31.90%), Postives = 57/116 (49.14%), Query Frame = 2
Query:   74 IDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCP--LMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSK 415
            +D    C +C N L +    PCG RFC  C+   L RG   CP D E+ K++       +F +      I  L   CP   + C+++ +L+ +EEH   C+Y+ V+C   N GC +
Sbjct:   15 LDPKYRCPVCGNALKHPVQTPCGHRFCEGCLEPIL-RGPSKCPVDGEELKID------GVFKDVCCRREILCLACYCPNRQLGCEWMKDLQYLEEHRANCEYKGVQC--HNPGCQE 121          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 55.4546 bits (132), Expect = 6.032e-10
Identity = 40/126 (31.75%), Postives = 54/126 (42.86%), Query Frame = 2
Query:   38 IMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKF-CPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCS 412
            +   Y  E    +     C +C   L       CG RFC  C+     R ++  CP D E      L+L  ++F++ A    I    VKCP   C +  ELR +E H+R C Y  V C  SN  CS
Sbjct:    7 VPSGYDSEFVIAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDREP-----LDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCDYELVTC--SNPMCS 125          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Nematostella
Match: EDO46837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP22])

HSP 1 Score: 51.6026 bits (122), Expect = 2.982e-9
Identity = 37/125 (29.60%), Postives = 59/125 (47.20%), Query Frame = 2
Query:   74 IDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGN-KFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLM--FCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKV 439
            ID+N+LC +C  +L NA +  CG  FC +C+  +L R   + CP     C+  +L+LD  +   +AI   +  L V C      CD V  +  M+ H  +C       PY  + C  C +   ++
Sbjct:   12 IDQNLLCNICVGVLENAITTICGHSFCESCLETWLSRPEVQSCP----SCRSHVLSLD--LIPVHAIRGLVDGLLVHCENADNGCDIVTRMDNMKSHLESC-------PYGLVQCKACEVKVKRI 123          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Nematostella
Match: EDO43806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXN6])

HSP 1 Score: 49.6766 bits (117), Expect = 1.618e-8
Identity = 31/110 (28.18%), Postives = 51/110 (46.36%), Query Frame = 2
Query:   74 IDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRG---NKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLM--FCDYVDELRKMEEHSRTCKYRSVKC 388
            +D N+LC +C  +L  A   PCG  FC  C+  ++      N+ CP     C+ ++    G+     A+   +  L V CP     C  V +L  +E H ++C +  V+C
Sbjct:   12 VDPNLLCGICAEVLERAVLTPCGHSFCGVCLETWMNAKLGENEKCPASCPSCRADLYQ--GDTIPVLALRGIVDGLIVHCPNADNGCKLVLKLEGVEGHLKSCSHAPVQC 119          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Nematostella
Match: EDO34728 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG3])

HSP 1 Score: 45.8246 bits (107), Expect = 7.221e-7
Identity = 32/115 (27.83%), Postives = 52/115 (45.22%), Query Frame = 2
Query:   68 TDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPL--MFCDYVDELRKMEEHSRTCKYRSVKCPYSNIG 406
             D+   ++C +C  +L +   +PC   FC  CIS +L + N  CP     C+ ++   +    +    N+ ISKLK+ C      C  +  L  +  H+  C    V C Y+N G
Sbjct:    9 VDVSPELVCCICTGVLEDPVESPCRHVFCSECISKWL-QNNSNCP----TCRSQVRAKNLKPVLPLVRNI-ISKLKIHCDFKTQGCKAIVSLESLRRHATICVMAPVTCTYANCG 117          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 52.7582 bits (125), Expect = 1.763e-8
Identity = 35/116 (30.17%), Postives = 53/116 (45.69%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKC 388
            ++ Y  E    ++    C +C   L NA    CG RFC +CI   +    + CP D      E+L+ D  +F +      I  L V+CP   C    ELR +E+H   C++ +V C
Sbjct:   61 LQGYDVEFDPPLESKYECPICLMALRNAIQTRCGHRFCKSCIEKSIRDTGQRCPVDN-----EMLSED-QLFPDNFAKREILSLTVRCPNSDCGEKMELRHLEKHLAQCQFATVPC 170          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 49.2914 bits (116), Expect = 2.865e-7
Identity = 34/118 (28.81%), Postives = 57/118 (48.31%), Query Frame = 2
Query:   74 IDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLD-GNIFVEYAINVRISKLKVKC---PLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSK 415
            +    +C +CK +++N +   CG  +CF C+ G L       P     C +E   +    +F +      IS L+V C   PL  C  V  L +++EH ++C+Y  + C  SN GC++
Sbjct:   62 LKEEFICPICKGVVLNPQQNSCGHIYCFHCLQGLLESSLLSGP----VCPVEKAAITPSEVFQDNCCKREISSLEVYCTNSPL--CTSVLALNQLQEHLKSCQYEQLLC--SNPGCTE 171          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Medaka
Match: lnx2b (ligand of Numb protein X 2 [Source:NCBI gene;Acc:101170936])

HSP 1 Score: 48.1358 bits (113), Expect = 7.584e-7
Identity = 29/111 (26.13%), Postives = 48/111 (43.24%), Query Frame = 2
Query:   56 YEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKC 388
            YE   ++D  ++C +C   L+     PCG  +CF C+S +L +   FCP D +  + E                R S L V+      + +D+L  M  H   C+ +  +C
Sbjct:   37 YEYLDEVDDELICHICLQPLLKPMDTPCGHTYCFYCLSNFL-KDQDFCPVDRQYLEFE--------------QCRPSSLLVR------NLLDKLTVMCPHYAECQQQMQRC 126          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 46.9802 bits (110), Expect = 1.733e-6
Identity = 31/121 (25.62%), Postives = 54/121 (44.63%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMC-KNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLD-GNIFVEYAINVRISKLKVKC--PLMFCDYVDELRKMEEHSRTCKYRSVKCP 391
            M  + Y+      R   C +C K +    + + CG RFC TC+  +L  G   CP D        L LD   I+ +  +  +I  L ++C      C +  ++++++ H  TC +  + CP
Sbjct:    1 MPGFDYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQ-------LPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCP 114          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 46.9802 bits (110), Expect = 1.823e-6
Identity = 31/121 (25.62%), Postives = 54/121 (44.63%), Query Frame = 2
Query:   41 MRNYKYEIATDIDRNMLCLMC-KNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLD-GNIFVEYAINVRISKLKVKC--PLMFCDYVDELRKMEEHSRTCKYRSVKCP 391
            M  + Y+      R   C +C K +    + + CG RFC TC+  +L  G   CP D        L LD   I+ +  +  +I  L ++C      C +  ++++++ H  TC +  + CP
Sbjct:    1 MPGFDYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQ-------LPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCP 114          
BLAST of TNF receptor-associated factor 6 vs. Planmine SMEST
Match: SMESG000025869.1 (SMESG000025869.1)

HSP 1 Score: 304.294 bits (778), Expect = 3.285e-105
Identity = 145/145 (100.00%), Postives = 145/145 (100.00%), Query Frame = 2
Query:    5 MDVSKLENVCQIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKV 439
            MDVSKLENVCQIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKV
Sbjct:    1 MDVSKLENVCQIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKV 145          
BLAST of TNF receptor-associated factor 6 vs. Planmine SMEST
Match: SMESG000025869.1 (SMESG000025869.1)

HSP 1 Score: 305.449 bits (781), Expect = 2.142e-103
Identity = 145/145 (100.00%), Postives = 145/145 (100.00%), Query Frame = 2
Query:    5 MDVSKLENVCQIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKV 439
            MDVSKLENVCQIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKV
Sbjct:    1 MDVSKLENVCQIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKV 145          
BLAST of TNF receptor-associated factor 6 vs. Planmine SMEST
Match: SMESG000025794.1 (SMESG000025794.1)

HSP 1 Score: 213.386 bits (542), Expect = 2.675e-68
Identity = 102/145 (70.34%), Postives = 118/145 (81.38%), Query Frame = 2
Query:    5 MDVSKLENVCQIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKV 439
            M  SKLENV QIMR+Y YE  T+I  +MLC +CK LL+NAR APCGCRFCFTCIS +L    K CPGDTE+CK E+L+L+ NI V+Y +N++ISKL+VKC  M C YVDELRKME+HSRTCKYRSV CPYSNIGC KCNISQDKV
Sbjct:    1 MSGSKLENVWQIMRDYNYESVTEIQNDMLCFLCKKLLVNARCAPCGCRFCFTCISDFLDHKEKICPGDTEECKQEMLHLNENICVDYPMNIKISKLQVKCKEMSCVYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKV 145          
BLAST of TNF receptor-associated factor 6 vs. Planmine SMEST
Match: SMESG000025934.1 (SMESG000025934.1)

HSP 1 Score: 196.823 bits (499), Expect = 3.122e-62
Identity = 103/145 (71.03%), Postives = 119/145 (82.07%), Query Frame = 2
Query:    5 MDVSKLENVCQIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKV 439
            M  SKLENV QIMR+Y YE  T+I  +MLCL+CK LL+NAR APC CRFCFTCIS YL + N+ CPG+TEDCK E+L L+ NI+V+  +N++ISKL+VKC  M CDYVDELRKMEEHSR CKYRSV CPYSNIGC KCNISQDKV
Sbjct:    1 MSGSKLENVWQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDK-NEICPGNTEDCKQEVLYLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRACKYRSVACPYSNIGCDKCNISQDKV 144          
BLAST of TNF receptor-associated factor 6 vs. Planmine SMEST
Match: SMESG000025518.1 (SMESG000025518.1)

HSP 1 Score: 189.889 bits (481), Expect = 3.171e-62
Identity = 100/145 (68.97%), Postives = 119/145 (82.07%), Query Frame = 2
Query:    5 MDVSKLENVCQIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRFCFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVKCPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKV 439
            M VSK +N+ QIMRNY  E  T+I  +MLCL+CK LL+NARS PCGCRFCF+CISG+L   NK CPG TE+CKLEILNLD NI+V+  +N++IS+L VKCP   C++VDELRKME+HSRTCKYRS  CPYSNIGC KCNIS+DKV
Sbjct:    1 MAVSKFKNLWQIMRNY--ESVTEIQHDMLCLLCKKLLLNARSVPCGCRFCFSCISGFLDGENKICPGFTEECKLEILNLDENIYVDQPMNIKISRLNVKCPEKSCEFVDELRKMEDHSRTCKYRSAACPYSNIGCDKCNISRDKV 143          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF62.370e-929.91TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF62.370e-929.91TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF46.952e-828.10TNF receptor associated factor 4 [Source:HGNC Symb... [more]
TRAF41.058e-728.10TNF receptor associated factor 4 [Source:HGNC Symb... [more]
TRAF46.273e-725.62TNF receptor associated factor 4 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf62.062e-927.50gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf13.773e-1135.40TNF receptor-associated factor 1 [Source:ZFIN;Acc:... [more]
traf68.252e-929.31TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf68.252e-929.31TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf68.252e-929.31TNF receptor-associated factor 6 [Source:NCBI gene... [more]
lnx12.887e-729.46ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
egf1.186e-928.57epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
sytl23.771e-726.45synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
LNX14.555e-727.27ligand of numb-protein X 1 [Source:NCBI gene;Acc:1... [more]
ddx548.090e-726.72DEAD-box helicase 54 [Source:Xenbase;Acc:XB-GENE-1... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Traf64.200e-1029.46TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf44.793e-728.93TNF receptor associated factor 4 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DJN2|TRF6B_XENLA3.737e-1031.90TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|Q3ZCC3|TRAF6_BOVIN8.683e-1029.46TNF receptor-associated factor 6 OS=Bos taurus OX=... [more]
sp|B5DF45|TRAF6_RAT1.247e-930.00TNF receptor-associated factor 6 OS=Rattus norvegi... [more]
sp|A7XUJ6|TRAF6_PIG1.474e-928.68TNF receptor-associated factor 6 OS=Sus scrofa OX=... [more]
sp|Q3MV19|TRF6A_XENLA1.600e-931.03TNF receptor-associated factor 6-A OS=Xenopus laev... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID84.232e-2941.98TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1017.267e-2737.06TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A0F7GWW35.861e-2674.63TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
A0A2B4SJ651.587e-1234.43TNF receptor-associated factor 4 OS=Stylophora pis... [more]
A0A1B0AN131.500e-1133.08Uncharacterized protein OS=Glossina palpalis gambi... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf18.778e-1135.04TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf11.126e-1035.04TNF receptor-associated factor 1-like [Source:NCBI... [more]
lnx2b7.125e-830.59ligand of Numb protein X 2-like [Source:NCBI gene;... [more]
lnx2b7.192e-830.59ligand of Numb protein X 2-like [Source:NCBI gene;... [more]
lnx2b7.192e-830.59ligand of Numb protein X 2-like [Source:NCBI gene;... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
traf61.416e-829.91TNF receptor-associated factor 6 [Source:NCBI gene... [more]
rnf41l4.356e-626.32ring finger protein 41, like [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494644.299e-1131.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412436.032e-1031.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468372.982e-929.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438061.618e-828.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347287.221e-727.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf61.763e-830.17TNF receptor associated factor 6 [Source:NCBI gene... [more]
ENSORLT00000001369.22.865e-728.81TNF receptor-associated factor 5 [Source:NCBI gene... [more]
lnx2b7.584e-726.13ligand of Numb protein X 2 [Source:NCBI gene;Acc:1... [more]
traf4a1.733e-625.62TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a1.823e-625.62TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025869.13.285e-105100.00SMESG000025869.1[more]
SMESG000025869.12.142e-103100.00SMESG000025869.1[more]
SMESG000025794.12.675e-6870.34SMESG000025794.1[more]
SMESG000025934.13.122e-6271.03SMESG000025934.1[more]
SMESG000025518.13.171e-6268.97SMESG000025518.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035455 ID=SMED30035455|Name=TNF receptor-associated factor 6|organism=Schmidtea mediterranea sexual|type=transcript|length=439bp
AGAAATGGATGTTTCAAAATTAGAAAATGTTTGTCAAATAATGAGAAATT
ATAAATATGAAATTGCAACAGATATCGATCGCAATATGTTATGCTTAATG
TGTAAAAATTTATTGATTAATGCTCGAAGTGCTCCATGTGGTTGTAGGTT
TTGTTTCACTTGCATTTCAGGATATTTAGGAAGAGGGAATAAATTTTGCC
CTGGCGACACAGAGGATTGTAAGCTGGAAATTCTCAATTTGGATGGAAAT
ATTTTTGTAGAATATGCAATTAATGTCAGAATATCAAAGTTAAAAGTGAA
ATGTCCATTAATGTTTTGTGATTACGTTGATGAGTTAAGAAAAATGGAAG
AACATTCACGGACGTGCAAATATCGGTCAGTTAAATGTCCTTATTCCAAT
ATCGGATGTAGTAAATGCAATATATCCCAGGATAAAGTT
back to top

protein sequence of SMED30035455-orf-1

>SMED30035455-orf-1 ID=SMED30035455-orf-1|Name=SMED30035455-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=146bp
EMDVSKLENVCQIMRNYKYEIATDIDRNMLCLMCKNLLINARSAPCGCRF
CFTCISGYLGRGNKFCPGDTEDCKLEILNLDGNIFVEYAINVRISKLKVK
CPLMFCDYVDELRKMEEHSRTCKYRSVKCPYSNIGCSKCNISQDKV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
IPR008974TRAF-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 4..134
e-value: 7.7E-17
score: 63.4
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 11..137
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 11..137
NoneNo IPR availableCDDcd16449RING-HCcoord: 31..67
e-value: 2.00214E-4
score: 35.1357
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 23..79
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 31..70
score: 9.052
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 96..137