Superoxide dismutase [Cu-Zn]

Overview
NameSuperoxide dismutase [Cu-Zn]
Smed IDSMED30035441
Length (bp)616
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Superoxide dismutase [Cu-Zn] (SMED30035441) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Superoxide dismutase [Cu-Zn] (SMED30035441) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035441

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30035441SMESG000051067.1 SmedASXL_005796SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30035441SMESG000051067.1 dd_Smed_v4_9810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035441SMESG000051067.1 dd_Smed_v6_9810_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Human
Match: SOD1 (superoxide dismutase 1 [Source:HGNC Symbol;Acc:HGNC:11179])

HSP 1 Score: 97.8265 bits (242), Expect = 1.512e-25
Identity = 44/104 (42.31%), Postives = 65/104 (62.50%), Query Frame = 1
Query:  262 IHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            +HG H+HEFGD    C  AG H+NP  ++HG P  ++RH+GDLGNV +D  G   ++  D+VI L+G + +IGR++++H+  D            +GNAG RLA
Sbjct:   24 LHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA 127          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Human
Match: SOD1 (superoxide dismutase 1 [Source:HGNC Symbol;Acc:HGNC:11179])

HSP 1 Score: 97.4413 bits (241), Expect = 2.806e-25
Identity = 44/104 (42.31%), Postives = 65/104 (62.50%), Query Frame = 1
Query:  262 IHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            +HG H+HEFGD    C  AG H+NP  ++HG P  ++RH+GDLGNV +D  G   ++  D+VI L+G + +IGR++++H+  D            +GNAG RLA
Sbjct:   43 LHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA 146          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Human
Match: CCS (copper chaperone for superoxide dismutase [Source:HGNC Symbol;Acc:HGNC:1613])

HSP 1 Score: 85.8853 bits (211), Expect = 1.054e-19
Identity = 48/110 (43.64%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDK-----YPF-QPSGNAGGRLA 555
            GL P  +HGLH+H++GDL  +CN  G H+NP    HG P   DRH GDLGNV +D  G+      D  +K   +  VIGRS+I+ + ED      +P  + +GN+G RLA
Sbjct:  121 GLEPG-LHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLK---VWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLA 226          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Human
Match: CCS (copper chaperone for superoxide dismutase [Source:HGNC Symbol;Acc:HGNC:1613])

HSP 1 Score: 85.5001 bits (210), Expect = 1.066e-19
Identity = 48/110 (43.64%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDK-----YPF-QPSGNAGGRLA 555
            GL P  +HGLH+H++GDL  +CN  G H+NP    HG P   DRH GDLGNV +D  G+      D  +K   +  VIGRS+I+ + ED      +P  + +GN+G RLA
Sbjct:  102 GLEPG-LHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLK---VWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLA 207          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Human
Match: SOD3 (superoxide dismutase 3 [Source:HGNC Symbol;Acc:HGNC:11181])

HSP 1 Score: 62.003 bits (149), Expect = 2.953e-11
Identity = 40/113 (35.40%), Postives = 55/113 (48.67%), Query Frame = 1
Query:  241 YGLHPNSI-HGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGN-VVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            +   PNS    +H+H+FGDL + C   G HYNP    H       +H GD GN  V D  G +   +      L G +S++GR+V++H  ED            +GNAG RLA
Sbjct:  102 FPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPH------PQHPGDFGNFAVRD--GSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLA 206          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Celegans
Match: sod-1 (Superoxide dismutase [Cu-Zn] [Source:UniProtKB/Swiss-Prot;Acc:P34697])

HSP 1 Score: 95.1301 bits (235), Expect = 8.704e-25
Identity = 48/113 (42.48%), Postives = 66/113 (58.41%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY---------PFQPSGNAGGRLA 555
            GL P  +HG H+H++GD    C  AG H+NPF K HG P S+ RH+GDLGNV +   G   I   DT++ L G N+V+GRS+++H  +D             + +GNAG R A
Sbjct:   37 GLTPG-LHGFHVHQYGDSTNGCISAGPHFNPFGKTHGGPKSEIRHVGDLGNVEAGADGVAKIKLTDTLVTLYGPNTVVGRSMVVHAGQDDLGEGVGDKAEESKKTGNAGARAA 148          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Celegans
Match: sod-1 (Superoxide dismutase [Cu-Zn] [Source:UniProtKB/Swiss-Prot;Acc:P34697])

HSP 1 Score: 95.1301 bits (235), Expect = 8.704e-25
Identity = 48/113 (42.48%), Postives = 66/113 (58.41%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY---------PFQPSGNAGGRLA 555
            GL P  +HG H+H++GD    C  AG H+NPF K HG P S+ RH+GDLGNV +   G   I   DT++ L G N+V+GRS+++H  +D             + +GNAG R A
Sbjct:   37 GLTPG-LHGFHVHQYGDSTNGCISAGPHFNPFGKTHGGPKSEIRHVGDLGNVEAGADGVAKIKLTDTLVTLYGPNTVVGRSMVVHAGQDDLGEGVGDKAEESKKTGNAGARAA 148          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Celegans
Match: sod-1 (Superoxide dismutase [Cu-Zn] [Source:UniProtKB/Swiss-Prot;Acc:P34697])

HSP 1 Score: 95.9005 bits (237), Expect = 9.995e-25
Identity = 48/113 (42.48%), Postives = 66/113 (58.41%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY---------PFQPSGNAGGRLA 555
            GL P  +HG H+H++GD    C  AG H+NPF K HG P S+ RH+GDLGNV +   G   I   DT++ L G N+V+GRS+++H  +D             + +GNAG R A
Sbjct:   59 GLTPG-LHGFHVHQYGDSTNGCISAGPHFNPFGKTHGGPKSEIRHVGDLGNVEAGADGVAKIKLTDTLVTLYGPNTVVGRSMVVHAGQDDLGEGVGDKAEESKKTGNAGARAA 170          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Celegans
Match: sod-4 (Extracellular superoxide dismutase [Cu-Zn] [Source:UniProtKB/Swiss-Prot;Acc:P34461])

HSP 1 Score: 91.6633 bits (226), Expect = 3.458e-23
Identity = 48/103 (46.60%), Postives = 61/103 (59.22%), Query Frame = 1
Query:  265 HGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            HG HIHE GD    C  AG HYNP +  HGAP   +RHIGDLGN+ S   G   I+  D++  L+G  S+IGRSV++H+  D          + +GNAG RLA
Sbjct:   67 HGFHIHEKGDTGNGCLSAGGHYNPHKLSHGAPDDSNRHIGDLGNIESPASGDTLISVSDSLASLSGQYSIIGRSVVIHEKTDDLGRGTSDQSKTTGNAGSRLA 169          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Celegans
Match: sod-4 (Extracellular superoxide dismutase [Cu-Zn] [Source:UniProtKB/Swiss-Prot;Acc:P34461])

HSP 1 Score: 90.8929 bits (224), Expect = 1.885e-22
Identity = 48/103 (46.60%), Postives = 61/103 (59.22%), Query Frame = 1
Query:  265 HGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            HG HIHE GD    C  AG HYNP +  HGAP   +RHIGDLGN+ S   G   I+  D++  L+G  S+IGRSV++H+  D          + +GNAG RLA
Sbjct:   67 HGFHIHEKGDTGNGCLSAGGHYNPHKLSHGAPDDSNRHIGDLGNIESPASGDTLISVSDSLASLSGQYSIIGRSVVIHEKTDDLGRGTSDQSKTTGNAGSRLA 169          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Fly
Match: Sod1 (gene:FBgn0003462 transcript:FBtr0076229)

HSP 1 Score: 93.9745 bits (232), Expect = 3.391e-24
Identity = 55/153 (35.95%), Postives = 81/153 (52.94%), Query Frame = 1
Query:  121 NEDSKKAICLMNQNSNLHLKISGQIELEXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNV--VSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYP------FQPSGNAGGRLA 555
            N D+K  +    ++S   +K+SG++                GL    +HG H+HEFGD    C  +G H+NP+ K HGAP  ++RH+GDLGN+    D   KV IT  D+ I L G +S+IGR+V++H   D          + +GNAG R+ 
Sbjct:   10 NGDAKGTVFFEQESSGTPVKVSGEV---------------CGL-AKGLHGFHVHEFGDNTNGCMSSGPHFNPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNIT--DSKITLFGADSIIGRTVVVHADADDLGQGGHELSKSTGNAGARIG 144          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Fly
Match: Sod3 (gene:FBgn0033631 transcript:FBtr0089938)

HSP 1 Score: 94.3597 bits (233), Expect = 4.921e-24
Identity = 48/103 (46.60%), Postives = 63/103 (61.17%), Query Frame = 1
Query:  265 HGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPF------QPSGNAGGRLA 555
            HG HIHE GDL   C   GAHYNP +  HG P  + RH+GDLGN+ ++  G + +T  D VI LTG   +IGR V++H+ ED          + +GNAGGR+A
Sbjct:   72 HGFHIHEKGDLTNGCISMGAHYNPDKVDHGGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDDLGLGNHTDSKKTGNAGGRIA 174          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Fly
Match: Sod3 (gene:FBgn0033631 transcript:FBtr0433531)

HSP 1 Score: 94.3597 bits (233), Expect = 4.921e-24
Identity = 48/103 (46.60%), Postives = 63/103 (61.17%), Query Frame = 1
Query:  265 HGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPF------QPSGNAGGRLA 555
            HG HIHE GDL   C   GAHYNP +  HG P  + RH+GDLGN+ ++  G + +T  D VI LTG   +IGR V++H+ ED          + +GNAGGR+A
Sbjct:   72 HGFHIHEKGDLTNGCISMGAHYNPDKVDHGGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDDLGLGNHTDSKKTGNAGGRIA 174          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Fly
Match: Sod3 (gene:FBgn0033631 transcript:FBtr0089939)

HSP 1 Score: 94.3597 bits (233), Expect = 4.921e-24
Identity = 48/103 (46.60%), Postives = 63/103 (61.17%), Query Frame = 1
Query:  265 HGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPF------QPSGNAGGRLA 555
            HG HIHE GDL   C   GAHYNP +  HG P  + RH+GDLGN+ ++  G + +T  D VI LTG   +IGR V++H+ ED          + +GNAGGR+A
Sbjct:   72 HGFHIHEKGDLTNGCISMGAHYNPDKVDHGGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDDLGLGNHTDSKKTGNAGGRIA 174          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Fly
Match: Sod3 (gene:FBgn0033631 transcript:FBtr0110897)

HSP 1 Score: 94.3597 bits (233), Expect = 9.588e-24
Identity = 48/103 (46.60%), Postives = 63/103 (61.17%), Query Frame = 1
Query:  265 HGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPF------QPSGNAGGRLA 555
            HG HIHE GDL   C   GAHYNP +  HG P  + RH+GDLGN+ ++  G + +T  D VI LTG   +IGR V++H+ ED          + +GNAGGR+A
Sbjct:   72 HGFHIHEKGDLTNGCISMGAHYNPDKVDHGGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDDLGLGNHTDSKKTGNAGGRIA 174          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Zebrafish
Match: sod1 (superoxide dismutase 1, soluble [Source:NCBI gene;Acc:30553])

HSP 1 Score: 96.2857 bits (238), Expect = 4.631e-25
Identity = 57/148 (38.51%), Postives = 82/148 (55.41%), Query Frame = 1
Query:  136 KAICLMNQNSNLHLKISGQIEL--EXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            KA+C++        +++G +    E + K + +   I GL P   HG H+H FGD    C  AG H+NP  K HG PT   RH+GDLGNV +D  G   I   D ++ L+G +S+IGR++++H+ ED            +GNAGGRLA
Sbjct:    4 KAVCVLKGTG----EVTGTVYFNQEGEKKPVKVTGEITGLTPGK-HGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLA 146          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Zebrafish
Match: ccs (copper chaperone for superoxide dismutase [Source:ZFIN;Acc:ZDB-GENE-050417-322])

HSP 1 Score: 95.1301 bits (235), Expect = 1.981e-23
Identity = 49/110 (44.55%), Postives = 69/110 (62.73%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDK-----YPF-QPSGNAGGRLA 555
            GL P + HGLH+HE GDL + C   G H+NPF+K+HGAP   DRH+GDLGN+ +   G+ +    D+ IK   +  VIGRS+++   ED      +P  + +GN+G RLA
Sbjct:  115 GLSPGA-HGLHVHELGDLTQDCRSCGDHFNPFRKQHGAPQDSDRHVGDLGNISAGPDGRASFRLEDSQIK---VWDVIGRSLVVDSGEDDLGRGNHPLSKTTGNSGERLA 220          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Zebrafish
Match: ccs (copper chaperone for superoxide dismutase [Source:ZFIN;Acc:ZDB-GENE-050417-322])

HSP 1 Score: 94.7449 bits (234), Expect = 2.269e-23
Identity = 49/110 (44.55%), Postives = 69/110 (62.73%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDK-----YPF-QPSGNAGGRLA 555
            GL P + HGLH+HE GDL + C   G H+NPF+K+HGAP   DRH+GDLGN+ +   G+ +    D+ IK   +  VIGRS+++   ED      +P  + +GN+G RLA
Sbjct:  115 GLSPGA-HGLHVHELGDLTQDCRSCGDHFNPFRKQHGAPQDSDRHVGDLGNISAGPDGRASFRLEDSQIK---VWDVIGRSLVVDSGEDDLGRGNHPLSKTTGNSGERLA 220          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Zebrafish
Match: sod3b (superoxide dismutase 3, extracellular b [Source:ZFIN;Acc:ZDB-GENE-030131-8743])

HSP 1 Score: 70.8626 bits (172), Expect = 5.442e-15
Identity = 57/169 (33.73%), Postives = 82/169 (48.52%), Query Frame = 1
Query:   88 CKSQNEAYKSQNEDSKKAICLMNQNSNLHL---KISGQIELEXX--XXXXXXXXXXYGLHPNS--IHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            C S +    + N DS +A+C M  N+ L     ++ G I   Q    + +S+   +YGL  +S     +HIHE+GDL   C+  G HYNP    H       +H GD GN V     K     L++   L G  S++GRSV++H+ +D            +GNAGGRLA
Sbjct:   21 CGSGSGLAYASNSDSLQAVCRMQPNTRLEPGMPRVYGHILFRQSGPKEKLSVTFRLYGLPADSQQPRAMHIHEYGDLSRGCDSTGGHYNPLNVNH------PQHPGDFGNFVPV--NKKIRQSLESPATLFGKLSIVGRSVVIHEGKDDLGRGGNVGSLLNGNAGGRLA 181          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Zebrafish
Match: sod3a (superoxide dismutase 3, extracellular a [Source:ZFIN;Acc:ZDB-GENE-050309-208])

HSP 1 Score: 64.3142 bits (155), Expect = 2.265e-12
Identity = 41/106 (38.68%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  256 NSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPF------QPSGNAGGRLA 555
            N +  +HIH++GDL + C  AG HYNP    H        H GD+GN +          KL  V KL G  SV+GR+V++H+ ED          + SGNAG R+A
Sbjct:   90 NQVRAIHIHQYGDLSQGCVTAGPHYNPQDVPH------PNHPGDMGNFMPKQGLIRRFLKLPEV-KLFGGQSVLGRAVVVHEKEDDLGMGADEESKRSGNAGRRIA 188          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Xenopus
Match: sod1 (superoxide dismutase 1 [Source:NCBI gene;Acc:549006])

HSP 1 Score: 88.1965 bits (217), Expect = 8.098e-22
Identity = 51/111 (45.95%), Postives = 63/111 (56.76%), Query Frame = 1
Query:  241 YGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            YGL  +  HG HIHEFGD    C  AG H+NP  K HGAP    RH+GDLGNV +   G       D++I L G +S+IGR  ++H+ ED            +GNAGGRLA
Sbjct:   35 YGL-TDGKHGFHIHEFGDNTNGCISAGPHFNPESKTHGAPEDAVRHVGDLGNVTAK-DGVAEFKLTDSLISLKGNHSIIGRCAVVHEKEDDLGKGGNDESLKTGNAGGRLA 143          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Xenopus
Match: ccs (copper chaperone for superoxide dismutase [Source:NCBI gene;Acc:496429])

HSP 1 Score: 87.4261 bits (215), Expect = 2.075e-20
Identity = 44/110 (40.00%), Postives = 67/110 (60.91%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDK-----YPF-QPSGNAGGRLA 555
            GL P  +HG+H+HEFGD+   C   G HYNP +  HG P   DRH+GDLGN+ +  +G+ +   +D  +K   +  +IGRS+++ + ED      +P  + +GN+G RLA
Sbjct:  120 GLSPG-LHGIHVHEFGDISNGCESCGEHYNPHRNSHGGPGEDDRHVGDLGNIFAADNGRASFRLMDERLK---VYDIIGRSLVVDEGEDDLGHGCHPLSKITGNSGRRLA 225          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Xenopus
Match: sh3rf2 (SH3 domain containing ring finger 2 [Source:Xenbase;Acc:XB-GENE-5763588])

HSP 1 Score: 62.7734 bits (151), Expect = 1.761e-11
Identity = 46/106 (43.40%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  259 SIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNV-VSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHED---KYPFQPS---GNAGGRLA 555
            S   +HIH +GDL   C+ AG HYNP    H       +H GD GN  V D   +     LD    L G  SVIGRSV++HK  D   K   Q S   GNAG RLA
Sbjct:  108 SARAIHIHTYGDLTNGCDSAGGHYNPMSVDH------PQHPGDFGNFRVRDGKIQKFFANLDAT--LFGPFSVIGRSVVVHKQADDLGKGNNQASLENGNAGKRLA 205          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Xenopus
Match: ccs (copper chaperone for superoxide dismutase [Source:NCBI gene;Acc:496429])

HSP 1 Score: 60.8474 bits (146), Expect = 9.003e-11
Identity = 32/86 (37.21%), Postives = 51/86 (59.30%), Query Frame = 1
Query:  316 AGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDK-----YPF-QPSGNAGGRLA 555
             G HYNP +  HG P   DRH+GDLGN+ +  +G+ +   +D  +K   +  +IGRS+++ + ED      +P  + +GN+G RLA
Sbjct:  135 CGEHYNPHRNSHGGPGEDDRHVGDLGNIFAADNGRASFRLMDERLK---VYDIIGRSLVVDEGEDDLGHGCHPLSKITGNSGRRLA 217          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Xenopus
Match: ccs (copper chaperone for superoxide dismutase [Source:NCBI gene;Acc:496429])

HSP 1 Score: 57.3806 bits (137), Expect = 1.448e-9
Identity = 35/110 (31.82%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDK-----YPF-QPSGNAGGRLA 555
            GL P  +HG+H+HEFGD+   C   G HYNP +  HG P   DR                             +  +IGRS+++ + ED      +P  + +GN+G RLA
Sbjct:  120 GLSPG-LHGIHVHEFGDISNGCESCGEHYNPHRNSHGGPGEDDR-----------------------------VYDIIGRSLVVDEGEDDLGHGCHPLSKITGNSGRRLA 199          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Mouse
Match: Sod1 (superoxide dismutase 1, soluble [Source:MGI Symbol;Acc:MGI:98351])

HSP 1 Score: 93.9745 bits (232), Expect = 3.941e-24
Identity = 43/103 (41.75%), Postives = 65/103 (63.11%), Query Frame = 1
Query:  265 HGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            HG H+H++GD  + C  AG H+NP  K+HG P  ++RH+GDLGNV +   G   ++  D VI L+G +S+IGR++++H+ +D            +GNAG RLA
Sbjct:   44 HGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLA 146          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Mouse
Match: Ccs (copper chaperone for superoxide dismutase [Source:MGI Symbol;Acc:MGI:1333783])

HSP 1 Score: 85.5001 bits (210), Expect = 4.548e-20
Identity = 47/110 (42.73%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDK-----YPF-QPSGNAGGRLA 555
            GL P  +HGLH+H++GDL   CN  G H+NP    HG P   DRH GDLGNV ++  G+ T    D  +K   +  VIGRS+++ + ED      +P  + +GN+G RLA
Sbjct:   75 GLEPG-LHGLHVHQYGDLTRDCNSCGDHFNPDGASHGGPQDTDRHRGDLGNVRAEAGGRATFRIEDKQLK---VWDVIGRSLVIDEGEDDLGRGGHPLSKITGNSGKRLA 180          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Mouse
Match: Ccs (copper chaperone for superoxide dismutase [Source:MGI Symbol;Acc:MGI:1333783])

HSP 1 Score: 85.1149 bits (209), Expect = 6.156e-20
Identity = 47/110 (42.73%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDK-----YPF-QPSGNAGGRLA 555
            GL P  +HGLH+H++GDL   CN  G H+NP    HG P   DRH GDLGNV ++  G+ T    D  +K   +  VIGRS+++ + ED      +P  + +GN+G RLA
Sbjct:   75 GLEPG-LHGLHVHQYGDLTRDCNSCGDHFNPDGASHGGPQDTDRHRGDLGNVRAEAGGRATFRIEDKQLK---VWDVIGRSLVIDEGEDDLGRGGHPLSKITGNSGKRLA 180          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Mouse
Match: Ccs (copper chaperone for superoxide dismutase [Source:MGI Symbol;Acc:MGI:1333783])

HSP 1 Score: 85.5001 bits (210), Expect = 8.890e-20
Identity = 47/110 (42.73%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDK-----YPF-QPSGNAGGRLA 555
            GL P  +HGLH+H++GDL   CN  G H+NP    HG P   DRH GDLGNV ++  G+ T    D  +K   +  VIGRS+++ + ED      +P  + +GN+G RLA
Sbjct:  121 GLEPG-LHGLHVHQYGDLTRDCNSCGDHFNPDGASHGGPQDTDRHRGDLGNVRAEAGGRATFRIEDKQLK---VWDVIGRSLVIDEGEDDLGRGGHPLSKITGNSGKRLA 226          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Mouse
Match: Ccs (copper chaperone for superoxide dismutase [Source:MGI Symbol;Acc:MGI:1333783])

HSP 1 Score: 85.5001 bits (210), Expect = 9.141e-20
Identity = 47/110 (42.73%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDK-----YPF-QPSGNAGGRLA 555
            GL P  +HGLH+H++GDL   CN  G H+NP    HG P   DRH GDLGNV ++  G+ T    D  +K   +  VIGRS+++ + ED      +P  + +GN+G RLA
Sbjct:  114 GLEPG-LHGLHVHQYGDLTRDCNSCGDHFNPDGASHGGPQDTDRHRGDLGNVRAEAGGRATFRIEDKQLK---VWDVIGRSLVIDEGEDDLGRGGHPLSKITGNSGKRLA 219          
BLAST of Superoxide dismutase [Cu-Zn] vs. UniProt/SwissProt
Match: sp|P00443|SODC_HORSE (Superoxide dismutase [Cu-Zn] OS=Equus caballus OX=9796 GN=SOD1 PE=1 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 5.198e-28
Identity = 59/148 (39.86%), Postives = 89/148 (60.14%), Query Frame = 1
Query:  136 KAICLMNQNSNLHLKISGQIELEXXXXXXXXXXXXY--GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            KA+C++  +  +H    G I  EQQ +   + +  +  GL     HG H+HEFGD  + C  AGAH+NP  K+HG P  ++RH+GDLGNV +D +GK  +   D+VI L+G +S+IGR++++H+ +D            +GNAG RLA
Sbjct:    4 KAVCVLKGDGPVH----GVIHFEQQQEGGPVVLKGFIEGLTKGD-HGFHVHEFGDNTQGCTTAGAHFNPLSKKHGGPKDEERHVGDLGNVTADENGKADVDMKDSVISLSGKHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLA 146          
BLAST of Superoxide dismutase [Cu-Zn] vs. UniProt/SwissProt
Match: sp|Q6C662|SODC_YARLI (Superoxide dismutase [Cu-Zn] OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SOD1 PE=3 SV=3)

HSP 1 Score: 104.76 bits (260), Expect = 2.127e-27
Identity = 60/148 (40.54%), Postives = 86/148 (58.11%), Query Frame = 1
Query:  136 KAICLMNQNSNLHLKISGQIELEXXXXXXXXXXX--XYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            KA+ ++  +S    K+SG +  EQ ++   + +   I G  PN+  G H+HEFGD    C  AG H+NPF+K HG PT  +RH+GDLGNV +D  G       D+++KLTG NS++GR+V++H  ED            +GNAG R A
Sbjct:    3 KAVAVLRGDS----KVSGTVTFEQDSESGPVTVTYDIKGNDPNAERGFHVHEFGDNTNGCTSAGPHFNPFKKNHGGPTDSERHVGDLGNVKTDSEGVAKGVLKDSLLKLTGDNSIVGRTVVIHGGEDDLGKGGHADSLKTGNAGPRPA 146          
BLAST of Superoxide dismutase [Cu-Zn] vs. UniProt/SwissProt
Match: sp|O59924|SODC_CANAX (Superoxide dismutase [Cu-Zn] OS=Candida albicans OX=5476 GN=SOD1 PE=3 SV=3)

HSP 1 Score: 104.76 bits (260), Expect = 2.473e-27
Identity = 58/146 (39.73%), Postives = 87/146 (59.59%), Query Frame = 1
Query:  136 KAICLMNQNSNLHLKISGQIELEXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY---PFQPS---GNAGGRLA 555
            KA+ ++  +S +   +    E E ++   +I   I G  PN++ G HIH+FGD    C  AG H+NPF K+HGAP   +RH+GDLGN+ +D +G    TK D +IKL G +S++GR++++H   D Y    F+ S   G+AG R A
Sbjct:    3 KAVAVVRGDSKVQGTV--HFEQESESAPTTISWEIEGNDPNALRGFHIHQFGDNTNGCTSAGPHFNPFGKQHGAPEDDERHVGDLGNISTDGNGVAKGTKQDLLIKLIGKDSILGRTIVVHAGTDDYGKGGFEDSKTTGHAGARPA 146          
BLAST of Superoxide dismutase [Cu-Zn] vs. UniProt/SwissProt
Match: sp|Q751L8|SODC_ASHGO (Superoxide dismutase [Cu-Zn] OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=SOD1 PE=3 SV=4)

HSP 1 Score: 103.99 bits (258), Expect = 3.564e-27
Identity = 55/146 (37.67%), Postives = 87/146 (59.59%), Query Frame = 1
Query:  136 KAICLMNQNSNLHLKISGQIELEXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            KAI ++  ++ +   +    E E    + +I  NI G  PN+ HG HIHEFGD+   C  +G+H+NPF+K HG+P  ++RH+GD+GNV++D +G    +  D +IK+ G  S++GR+V++H  +D            +GNAG R A
Sbjct:    3 KAIAVLKGDAGVSGVV--HFEQEADAAVTTISWNITGFEPNTEHGFHIHEFGDVTNGCTSSGSHFNPFKKTHGSPEDENRHVGDMGNVLADANGVAVGSAKDPLIKIFGPTSILGRTVVVHAGKDDLGRGGNEESLKTGNAGPRPA 146          
BLAST of Superoxide dismutase [Cu-Zn] vs. UniProt/SwissProt
Match: sp|P81926|SODC_HALRO (Superoxide dismutase [Cu-Zn] OS=Halocynthia roretzi OX=7729 PE=1 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 1.113e-26
Identity = 51/110 (46.36%), Postives = 70/110 (63.64%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            GL P   HG HIHE+GDL   C  +G H+NPF++ HGAP    RH+GDLGN+ +D  G  T+   D +I LTG +S+IGR+V++H  ED          + +G+AGGRL+
Sbjct:   35 GLIPGK-HGFHIHEYGDLTNGCTSSGGHFNPFKQIHGAPEDDIRHVGDLGNITADSSGVATVNITDRMISLTGEHSIIGRAVVVHAGEDDLGKGGHEDSKTTGHAGGRLS 143          
BLAST of Superoxide dismutase [Cu-Zn] vs. TrEMBL
Match: A0A1X2G6V3 (Superoxide dismutase [Cu-Zn] OS=Hesseltinella vesiculosa OX=101127 GN=DM01DRAFT_1311072 PE=3 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 2.411e-30
Identity = 68/148 (45.95%), Postives = 88/148 (59.46%), Query Frame = 1
Query:  136 KAICLMNQNSNLHLKISGQIEL--EXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPF------QPSGNAGGRLA 555
            KAIC++  +S    K+SG I    E ++    I  ++ GL PN+  G HIHEFGD    C  AG H+NPF K HGAP +  RH+GDLGNV +D  G V  +  D+ IKL GI+SVIGRSV++H  ED          + +GNAG R A
Sbjct:    3 KAICVVRGDS----KVSGTITFTQESEDAPTHIVADLSGLDPNAKRGFHIHEFGDNTNGCTSAGGHFNPFGKTHGAPDAAVRHVGDLGNVTTDAQGNVAFSVADSQIKLIGIHSVIGRSVVVHAGEDDLGVTAHELSKTTGNAGLRSA 146          
BLAST of Superoxide dismutase [Cu-Zn] vs. TrEMBL
Match: A0A1I8GP50 (Superoxide dismutase [Cu-Zn] OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.533e-28
Identity = 61/148 (41.22%), Postives = 90/148 (60.81%), Query Frame = 1
Query:  130 SKKAICLMNQNSNLHLKISGQIELEXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYP------FQPSGNAGGRLA 555
            S KA+C++  ++     +SG +  EQ   ++ +  ++ GL P   HG H+HEFGD    C  AGAH+NP ++ HGAP  ++RH+GDLGNV +D  G+  +   D +I LTG NS+IGRS+++H   D          + +GNAGGRLA
Sbjct:    2 SLKAVCVLKGDAG----VSGTLHFEQAGDVVKVTGSVEGLAPGK-HGFHVHEFGDNTNGCVSAGAHFNPCKRTHGAPDDEERHVGDLGNVEADASGRAGVEITDKLINLTGPNSIIGRSLVVHADTDDLGRGGHELSKTTGNAGGRLA 144          
BLAST of Superoxide dismutase [Cu-Zn] vs. TrEMBL
Match: A0A267DDE2 (Superoxide dismutase [Cu-Zn] OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025319g1 PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.839e-28
Identity = 61/148 (41.22%), Postives = 90/148 (60.81%), Query Frame = 1
Query:  130 SKKAICLMNQNSNLHLKISGQIELEXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYP------FQPSGNAGGRLA 555
            S KA+C++  ++     +SG +  EQ   ++ +  ++ GL P   HG H+HEFGD    C  AGAH+NP ++ HGAP  ++RH+GDLGNV +D  G+  +   D +I LTG NS+IGRS+++H   D          + +GNAGGRLA
Sbjct:    2 SLKAVCVLKGDAG----VSGTLHFEQAGDVVKVTGSVEGLAPGK-HGFHVHEFGDNTNGCVSAGAHFNPCKRTHGAPDDEERHVGDLGNVEADASGRAGVEITDKLINLTGPNSIIGRSLVVHADTDDLGRGGHELSKTTGNAGGRLA 144          
BLAST of Superoxide dismutase [Cu-Zn] vs. TrEMBL
Match: A0A267G7C7 (Sod_Cu domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025319g3 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.301e-28
Identity = 61/148 (41.22%), Postives = 90/148 (60.81%), Query Frame = 1
Query:  130 SKKAICLMNQNSNLHLKISGQIELEXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYP------FQPSGNAGGRLA 555
            S KA+C++  ++     +SG +  EQ   ++ +  ++ GL P   HG H+HEFGD    C  AGAH+NP ++ HGAP  ++RH+GDLGNV +D  G+  +   D +I LTG NS+IGRS+++H   D          + +GNAGGRLA
Sbjct:   10 SLKAVCVLKGDAG----VSGTLHFEQAGDVVKVTGSVEGLAPGK-HGFHVHEFGDNTNGCVSAGAHFNPCKRTHGAPDDEERHVGDLGNVEADASGRAGVEITDKLINLTGPNSIIGRSLVVHADTDDLGRGGHELSKTTGNAGGRLA 152          
BLAST of Superoxide dismutase [Cu-Zn] vs. TrEMBL
Match: A0A267GYW8 (Sod_Cu domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025319g4 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 2.420e-28
Identity = 61/148 (41.22%), Postives = 90/148 (60.81%), Query Frame = 1
Query:  130 SKKAICLMNQNSNLHLKISGQIELEXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYP------FQPSGNAGGRLA 555
            S KA+C++  ++     +SG +  EQ   ++ +  ++ GL P   HG H+HEFGD    C  AGAH+NP ++ HGAP  ++RH+GDLGNV +D  G+  +   D +I LTG NS+IGRS+++H   D          + +GNAGGRLA
Sbjct:    6 SLKAVCVLKGDAG----VSGTLHFEQAGDVVKVTGSVEGLAPGK-HGFHVHEFGDNTNGCVSAGAHFNPCKRTHGAPDDEERHVGDLGNVEADASGRAGVEITDKLINLTGPNSIIGRSLVVHADTDDLGRGGHELSKTTGNAGGRLA 148          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Cavefish
Match: sod1 (superoxide dismutase 1 [Source:NCBI gene;Acc:103036754])

HSP 1 Score: 98.5969 bits (244), Expect = 6.455e-26
Identity = 57/158 (36.08%), Postives = 81/158 (51.27%), Query Frame = 1
Query:  136 KAICLM------------NQNSNLHLKISGQIELEXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            KA+C++             Q     +K+SG+I                GL P  +HG H+H FGD    C  AG HYNP+ K HG PT + RH+GDLGNV +   G   I   D ++ L+G +S++GR++++H+ ED            +GNAGGRLA
Sbjct:    4 KAVCVLKGTGEVTGTVFFEQGDGAPVKVSGEIT---------------GLTP-GLHGFHVHAFGDNTNGCISAGPHYNPYNKTHGGPTDEIRHVGDLGNVTAGADGVAKINIEDKMLSLSGPHSIVGRTMVIHEKEDDLGKGGDEESLKTGNAGGRLA 145          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Cavefish
Match: ccs (copper chaperone for superoxide dismutase [Source:ZFIN;Acc:ZDB-GENE-050417-322])

HSP 1 Score: 91.6633 bits (226), Expect = 1.098e-22
Identity = 49/110 (44.55%), Postives = 67/110 (60.91%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHED-----KYPF-QPSGNAGGRLA 555
            GL P + HGLH+HE GDL + C   G HYNPF K+HG P   +RH+GDLGNV +   G+ T    D+ +K   +  VIGRS+++   ED      +P  + +GN+G RLA
Sbjct:   55 GLDPGA-HGLHVHELGDLTQDCLSCGEHYNPFGKQHGGPADTERHVGDLGNVQAGSDGRATFRLEDSQLK---VWDVIGRSLVVDSGEDDLGRESHPLSKQTGNSGQRLA 160          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Cavefish
Match: sod3b (superoxide dismutase 3, extracellular b [Source:ZFIN;Acc:ZDB-GENE-030131-8743])

HSP 1 Score: 61.2326 bits (147), Expect = 1.602e-11
Identity = 39/101 (38.61%), Postives = 53/101 (52.48%), Query Frame = 1
Query:  271 LHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPFQPS------GNAGGRLA 555
            +HIH++GDL + C   G HYNP    H        H GD GN  +  +GK+    +D+   L G  SV+GR+V++H+ ED             GNAGGRLA
Sbjct:   76 IHIHQYGDLSQGCTSTGGHYNPLGYNH------PNHPGDFGN-FTPRNGKIR-RSVDSRATLFGGLSVLGRAVVIHEKEDDLGRGGDAGSLLHGNAGGRLA 168          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Cavefish
Match: sod3a (superoxide dismutase 3, extracellular a [Source:ZFIN;Acc:ZDB-GENE-050309-208])

HSP 1 Score: 55.4546 bits (132), Expect = 2.263e-9
Identity = 38/101 (37.62%), Postives = 51/101 (50.50%), Query Frame = 1
Query:  271 LHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPF------QPSGNAGGRLA 555
            +HIH++GDL E    AG HYNP    H +      H GDLGN     +G V          L G  S++GR+V++H+ ED          + SGNAG R+A
Sbjct:   91 IHIHQYGDLSEGFVTAGPHYNPLGVDHPS------HPGDLGNFFPS-NGTVRRRLNVQAATLFGGPSILGRAVVIHEKEDDLGLGSDEESKRSGNAGRRIA 184          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Sea Lamprey
Match: ccs (copper chaperone for superoxide dismutase [Source:ZFIN;Acc:ZDB-GENE-050417-322])

HSP 1 Score: 79.337 bits (194), Expect = 2.297e-18
Identity = 38/89 (42.70%), Postives = 53/89 (59.55%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHED 510
            GL P   HGLH+HEFGDL   C   G H+NP +  HG P   + H+GDLGN+++D HG+ +       IK   +  +IGRSV++ +  D
Sbjct:  114 GLSPGP-HGLHVHEFGDLTNGCFSCGGHFNPHRSNHGRPDDPNSHVGDLGNIIADEHGRASFRVNSGKIK---VGDIIGRSVVVDETAD 198          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Yeast
Match: SOD1 (Cytosolic copper-zinc superoxide dismutase; detoxifies superoxide; stabilizes Yck1p and Yck2p kinases in glucose to repress respiration; phosphorylated by Dun1p, enters nucleus under oxidative stress to promote transcription of stress response genes; human ortholog SOD1 implicated in ALS complements a null allele; abundance increases under DNA replication stress and during exposure to boric acid; localization to mitochondrial intermembrane space is modulated by MICOS complex [Source:SGD;Acc:S000003865])

HSP 1 Score: 101.293 bits (251), Expect = 5.944e-28
Identity = 46/89 (51.69%), Postives = 61/89 (68.54%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHED 510
            G  PN+  G HIHEFGD    C  AG H+NPF+K HGAPT + RH+GD+GNV +D +G    +  D++IKL G  SV+GRSV++H  +D
Sbjct:   37 GNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQD 125          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Nematostella
Match: EDO42041 (Superoxide dismutase [Cu-Zn] [Source:UniProtKB/TrEMBL;Acc:A7S2P3])

HSP 1 Score: 102.064 bits (253), Expect = 9.997e-28
Identity = 50/103 (48.54%), Postives = 66/103 (64.08%), Query Frame = 1
Query:  265 HGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPFQ------PSGNAGGRLA 555
            HG HIHEFGD    C  AGAHYNP  K HGAP  +DRH+GDLGN+ +D +G   ++  D ++ LTG  S+IGRS+++H+  D            +GNAGGR+A
Sbjct:   44 HGFHIHEFGDNTNGCTSAGAHYNPHGKMHGAPEDKDRHLGDLGNIEADANGIADVSITDCLVSLTGQCSIIGRSLVVHEGMDDLGAGGHELSLTTGNAGGRVA 146          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Nematostella
Match: EDO42040 (Superoxide dismutase [Cu-Zn] [Source:UniProtKB/TrEMBL;Acc:A7S2P2])

HSP 1 Score: 102.064 bits (253), Expect = 1.044e-27
Identity = 61/159 (38.36%), Postives = 82/159 (51.57%), Query Frame = 1
Query:   97 QNEAYKSQNEDSKKAICLMNQNSNLHLKISGQIELEXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            Q     S  E  K  I  + +      KI+G IE               GL   + HG HIH +GD    C  AG H+NPF+K HG P+ ++RH+GDLGNVV+   GK  I   D ++ L G +SV+GRSV++H  ED          + +G+AGGRLA
Sbjct:    4 QAVCCMSGTEGVKGTIKFVQEAEGKPCKITGTIE---------------GLKAGN-HGFHIHVYGDNTNGCVSAGPHFNPFKKEHGGPSDENRHVGDLGNVVAGDDGKACIDMTDALVTLVGEHSVVGRSVVVHADEDDLGRGGHEDSKTTGHAGGRLA 146          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Nematostella
Match: EDO43919 (Superoxide dismutase [Cu-Zn] [Source:UniProtKB/TrEMBL;Acc:A7RX84])

HSP 1 Score: 97.0561 bits (240), Expect = 3.349e-26
Identity = 50/114 (43.86%), Postives = 68/114 (59.65%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDL-RESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHED---------KYPFQPSGNAGGRLA 555
            G+ P ++HG HIH+ GD+  + C  A  H+NP+ K H  P  +DRH+GDLGNV SD HG V  +  D ++ L G +SVIGRS++LH   D         +     +GNAG RLA
Sbjct:    7 GVPPLTVHGFHIHKSGDIITKGCQSAKGHFNPYGKTHAGPRKRDRHVGDLGNVWSDYHGNVRTSFFDHMVSLYGPDSVIGRSIVLHAERDDLGRGIGEYRTGSLATGNAGARLA 120          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Medaka
Match: sod1 (superoxide dismutase 1 [Source:NCBI gene;Acc:101170534])

HSP 1 Score: 90.5077 bits (223), Expect = 8.988e-23
Identity = 52/146 (35.62%), Postives = 79/146 (54.11%), Query Frame = 1
Query:  136 KAICLMNQNSNLHLKISGQIELEXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            KA+C++      +  ++   E E  +  + +   I GL P   HG HIH +GD    C  AG H+NP+ K HG P   +RH+GDLGNV +  +    I   D +I+L+G +S++GR+V++H+  D            +GNAG RLA
Sbjct:    4 KAVCVLKGTGETNGVVN--FEQESDSAPVKVTGEIKGLTPGK-HGFHIHVYGDNTNGCVSAGPHFNPYNKNHGGPEDAERHVGDLGNVTAGDNNVAKIDITDKLIRLSGPDSIVGRTVVVHEKVDDLGKGGNDESLKTGNAGARLA 146          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Medaka
Match: ccs (copper chaperone for superoxide dismutase [Source:NCBI gene;Acc:101157814])

HSP 1 Score: 88.9669 bits (219), Expect = 2.964e-21
Identity = 47/110 (42.73%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHED-----KYPF-QPSGNAGGRLA 555
            GL P   HGLH+H  GDL + C   G HYNPF K+HG P   +RH+GDLGN+V+   G+ +    D  +K   +  VIGRS+++   ED      +P  + +GN+G RLA
Sbjct:  116 GLEPG-CHGLHVHTLGDLTQDCKSCGEHYNPFGKQHGGPGDSERHVGDLGNIVAGPDGRASFRLEDDQLK---VWDVIGRSLVVDGGEDDLGRGTHPLSKQTGNSGERLA 221          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Medaka
Match: ccs (copper chaperone for superoxide dismutase [Source:NCBI gene;Acc:101157814])

HSP 1 Score: 84.7297 bits (208), Expect = 1.162e-19
Identity = 45/108 (41.67%), Postives = 63/108 (58.33%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHED-----KYPF-QPSGNAGGR 549
            GL P   HGLH+H  GDL + C   G HYNPF K+HG P   +RH+GDLGN+V+   G+ +    D  +K   +  VIGRS+++   ED      +P  + +GN+G R
Sbjct:  116 GLEPGC-HGLHVHTLGDLTQDCKSCGEHYNPFGKQHGGPGDSERHVGDLGNIVAGPDGRASFRLEDDQLK---VWDVIGRSLVVDGGEDDLGRGTHPLSKQTGNSGER 219          
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Medaka
Match: sod3b (superoxide dismutase 3 [Source:NCBI gene;Acc:101169658])

HSP 1 Score: 55.0694 bits (131), Expect = 4.646e-9
Identity = 36/101 (35.64%), Postives = 54/101 (53.47%), Query Frame = 1
Query:  271 LHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPFQPS------GNAGGRLA 555
            +HIH++GDL + C   G HYNP+   H        H GD GN V+   G+++  ++++   L G  SV+GR+V++H+  D             GNAG RLA
Sbjct:   98 IHIHQYGDLSQGCISTGGHYNPYGVDH------PNHPGDFGNFVAH-EGRIS-EQIESEATLFGGLSVLGRAVVVHETIDDLGQGGDVGSLLHGNAGRRLA 190          
BLAST of Superoxide dismutase [Cu-Zn] vs. Planmine SMEST
Match: SMESG000051067.1 (SMESG000051067.1)

HSP 1 Score: 310.457 bits (794), Expect = 5.583e-109
Identity = 179/179 (100.00%), Postives = 179/179 (100.00%), Query Frame = 1
Query:   19 MFIKTRAXXXXXXXXXXXXXNEACKSQNEAYKSQNEDSKKAICLMNQNSNLHLKISGQIELEXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPFQPSGNAGGRLA 555
            MFIKTRAFISVFILLIFVIFNEACKSQNEAYKSQNEDSKKAICLMNQNSNLHLKISGQIELEQQNKIISIKINIYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPFQPSGNAGGRLA
Sbjct:    1 MFIKTRAFISVFILLIFVIFNEACKSQNEAYKSQNEDSKKAICLMNQNSNLHLKISGQIELEQQNKIISIKINIYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPFQPSGNAGGRLA 179          
BLAST of Superoxide dismutase [Cu-Zn] vs. Planmine SMEST
Match: SMESG000005021.1 (SMESG000005021.1)

HSP 1 Score: 117.472 bits (293), Expect = 3.229e-33
Identity = 64/148 (43.24%), Postives = 88/148 (59.46%), Query Frame = 1
Query:  112 KSQNEDSKKAICLMNQNSNLHLKISGQIELEXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKYPFQPSGNAGGRLA 555
            KS      KAI  +  +S     I G + L +  K + I   I GL P+++HG HIH+FGDL   C   G HYNP+ K+HG P   +RH GD GN+ ++  G++TI K D + +LTG  S IGR+ +LH+  D Y  QP G+AGGR+A
Sbjct:   21 KSPYIQVNKAISYIQGHSKFK-NIYGVVNLTEMKKSVIISGYIKGLPPSTVHGFHIHQFGDLGNFCLNTGTHYNPYNKKHGGPHDPNRHFGDFGNLRANNKGEITIHKSDNIARLTGKYSAIGRAFVLHERRDNYSAQPVGDAGGRVA 167          
BLAST of Superoxide dismutase [Cu-Zn] vs. Planmine SMEST
Match: SMESG000020880.1 (SMESG000020880.1)

HSP 1 Score: 112.079 bits (279), Expect = 2.139e-31
Identity = 63/152 (41.45%), Postives = 87/152 (57.24%), Query Frame = 1
Query:  139 AICLMNQNSNLHLKI-------SGQIELEXXXXXXXXXXXXYGLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILHKHEDKY------PFQPSGNAGGRLA 555
            A+C++   +NL+  +        G +E++ +           GL P   HG HIHEFGD    C  AG HYNP  K HGAP  ++RH+GDLGNV +D  GKV +T  D V+ L G  S+IGRS+++H++ED          + +GNAGGRLA
Sbjct:    5 AVCVLKNENNLNGTVKFMQSDAGGPVEIDVEIS---------GLTPGK-HGFHIHEFGDNTNGCISAGGHYNPHGKTHGAPCDEERHVGDLGNVTADASGKVKVTLTDKVMSLVGPLSIIGRSLVVHENEDDLGKGGHETSKTTGNAGGRLA 146          
BLAST of Superoxide dismutase [Cu-Zn] vs. Planmine SMEST
Match: SMESG000019092.1 (SMESG000019092.1)

HSP 1 Score: 46.595 bits (109), Expect = 4.038e-6
Identity = 30/85 (35.29%), Postives = 45/85 (52.94%), Query Frame = 1
Query:  244 GLHPNSIHGLHIHEFGDLRESCNKAGAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGINSVIGRSVILH 498
            G+  N  + L IHEFGDL ++ N  G  Y      H   + +    GDLG V S+  G+  I   ++ +KL    +VIGRS+++H
Sbjct:  124 GMENNEQYKLCIHEFGDLSDNANSCGDIY------HAKDSDES---GDLGIVCSNEIGQCKIDTWNSSVKLW---NVIGRSMVVH 196          
The following BLAST results are available for this feature:
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SOD11.512e-2542.31superoxide dismutase 1 [Source:HGNC Symbol;Acc:HGN... [more]
SOD12.806e-2542.31superoxide dismutase 1 [Source:HGNC Symbol;Acc:HGN... [more]
CCS1.054e-1943.64copper chaperone for superoxide dismutase [Source:... [more]
CCS1.066e-1943.64copper chaperone for superoxide dismutase [Source:... [more]
SOD32.953e-1135.40superoxide dismutase 3 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sod-18.704e-2542.48Superoxide dismutase [Cu-Zn] [Source:UniProtKB/Sw... [more]
sod-18.704e-2542.48Superoxide dismutase [Cu-Zn] [Source:UniProtKB/Sw... [more]
sod-19.995e-2542.48Superoxide dismutase [Cu-Zn] [Source:UniProtKB/Sw... [more]
sod-43.458e-2346.60Extracellular superoxide dismutase [Cu-Zn] [Sourc... [more]
sod-41.885e-2246.60Extracellular superoxide dismutase [Cu-Zn] [Sourc... [more]
back to top
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sod13.391e-2435.95gene:FBgn0003462 transcript:FBtr0076229[more]
Sod34.921e-2446.60gene:FBgn0033631 transcript:FBtr0089938[more]
Sod34.921e-2446.60gene:FBgn0033631 transcript:FBtr0433531[more]
Sod34.921e-2446.60gene:FBgn0033631 transcript:FBtr0089939[more]
Sod39.588e-2446.60gene:FBgn0033631 transcript:FBtr0110897[more]
back to top
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sod14.631e-2538.51superoxide dismutase 1, soluble [Source:NCBI gene;... [more]
ccs1.981e-2344.55copper chaperone for superoxide dismutase [Source:... [more]
ccs2.269e-2344.55copper chaperone for superoxide dismutase [Source:... [more]
sod3b5.442e-1533.73superoxide dismutase 3, extracellular b [Source:ZF... [more]
sod3a2.265e-1238.68superoxide dismutase 3, extracellular a [Source:ZF... [more]
back to top
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sod18.098e-2245.95superoxide dismutase 1 [Source:NCBI gene;Acc:54900... [more]
ccs2.075e-2040.00copper chaperone for superoxide dismutase [Source:... [more]
sh3rf21.761e-1143.40SH3 domain containing ring finger 2 [Source:Xenbas... [more]
ccs9.003e-1137.21copper chaperone for superoxide dismutase [Source:... [more]
ccs1.448e-931.82copper chaperone for superoxide dismutase [Source:... [more]
back to top
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sod13.941e-2441.75superoxide dismutase 1, soluble [Source:MGI Symbol... [more]
Ccs4.548e-2042.73copper chaperone for superoxide dismutase [Source:... [more]
Ccs6.156e-2042.73copper chaperone for superoxide dismutase [Source:... [more]
Ccs8.890e-2042.73copper chaperone for superoxide dismutase [Source:... [more]
Ccs9.141e-2042.73copper chaperone for superoxide dismutase [Source:... [more]
back to top
BLAST of Superoxide dismutase [Cu-Zn] vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P00443|SODC_HORSE5.198e-2839.86Superoxide dismutase [Cu-Zn] OS=Equus caballus OX=... [more]
sp|Q6C662|SODC_YARLI2.127e-2740.54Superoxide dismutase [Cu-Zn] OS=Yarrowia lipolytic... [more]
sp|O59924|SODC_CANAX2.473e-2739.73Superoxide dismutase [Cu-Zn] OS=Candida albicans O... [more]
sp|Q751L8|SODC_ASHGO3.564e-2737.67Superoxide dismutase [Cu-Zn] OS=Ashbya gossypii (s... [more]
sp|P81926|SODC_HALRO1.113e-2646.36Superoxide dismutase [Cu-Zn] OS=Halocynthia roretz... [more]
back to top
BLAST of Superoxide dismutase [Cu-Zn] vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1X2G6V32.411e-3045.95Superoxide dismutase [Cu-Zn] OS=Hesseltinella vesi... [more]
A0A1I8GP501.533e-2841.22Superoxide dismutase [Cu-Zn] OS=Macrostomum lignan... [more]
A0A267DDE21.839e-2841.22Superoxide dismutase [Cu-Zn] OS=Macrostomum lignan... [more]
A0A267G7C72.301e-2841.22Sod_Cu domain-containing protein (Fragment) OS=Mac... [more]
A0A267GYW82.420e-2841.22Sod_Cu domain-containing protein (Fragment) OS=Mac... [more]
back to top
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sod16.455e-2636.08superoxide dismutase 1 [Source:NCBI gene;Acc:10303... [more]
ccs1.098e-2244.55copper chaperone for superoxide dismutase [Source:... [more]
sod3b1.602e-1138.61superoxide dismutase 3, extracellular b [Source:ZF... [more]
sod3a2.263e-937.62superoxide dismutase 3, extracellular a [Source:ZF... [more]
back to top
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccs2.297e-1842.70copper chaperone for superoxide dismutase [Source:... [more]
back to top
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SOD15.944e-2851.69Cytosolic copper-zinc superoxide dismutase; detoxi... [more]
back to top
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO420419.997e-2848.54Superoxide dismutase [Cu-Zn] [Source:UniProtKB/Tr... [more]
EDO420401.044e-2738.36Superoxide dismutase [Cu-Zn] [Source:UniProtKB/Tr... [more]
EDO439193.349e-2643.86Superoxide dismutase [Cu-Zn] [Source:UniProtKB/Tr... [more]
back to top
BLAST of Superoxide dismutase [Cu-Zn] vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sod18.988e-2335.62superoxide dismutase 1 [Source:NCBI gene;Acc:10117... [more]
ccs2.964e-2142.73copper chaperone for superoxide dismutase [Source:... [more]
ccs1.162e-1941.67copper chaperone for superoxide dismutase [Source:... [more]
sod3b4.646e-935.64superoxide dismutase 3 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Superoxide dismutase [Cu-Zn] vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000051067.15.583e-109100.00SMESG000051067.1[more]
SMESG000005021.13.229e-3343.24SMESG000005021.1[more]
SMESG000020880.12.139e-3141.45SMESG000020880.1[more]
SMESG000019092.14.038e-635.29SMESG000019092.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035441 ID=SMED30035441|Name=Superoxide dismutase [Cu-Zn]|organism=Schmidtea mediterranea sexual|type=transcript|length=616bp
ATTTGAATCAACATCTAAATGTTTATTAAAACCAGAGCTTTTATATCTGT
TTTTATTTTGTTAATTTTTGTAATCTTCAATGAAGCTTGCAAATCTCAAA
ATGAAGCTTACAAATCTCAAAATGAGGATTCAAAGAAAGCTATTTGTCTG
ATGAACCAAAACTCTAACTTACATTTAAAGATTTCGGGTCAAATAGAATT
GGAACAACAAAATAAAATTATTAGTATTAAAATAAATATTTATGGACTTC
ATCCGAATTCAATTCACGGATTGCATATTCATGAATTTGGAGATCTAAGG
GAATCCTGTAATAAAGCTGGGGCGCACTACAATCCTTTCCAAAAACGTCA
CGGGGCACCGACAAGTCAGGACAGACATATTGGAGATTTAGGAAACGTAG
TATCTGATTTACATGGAAAGGTTACAATTACAAAACTTGATACTGTTATT
AAACTGACAGGGATAAATTCTGTTATCGGAAGGTCAGTAATACTCCACAA
ACACGAAGATAAATATCCATTTCAACCAAGTGGTAATGCTGGAGGAAGAC
TTGCATGTTGTGTCATTGGATTAATTTAGTGTATTATTATTTTTATTAAA
TTTCGTAGATCGGAAG
back to top

protein sequence of SMED30035441-orf-1

>SMED30035441-orf-1 ID=SMED30035441-orf-1|Name=SMED30035441-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=187bp
MFIKTRAFISVFILLIFVIFNEACKSQNEAYKSQNEDSKKAICLMNQNSN
LHLKISGQIELEQQNKIISIKINIYGLHPNSIHGLHIHEFGDLRESCNKA
GAHYNPFQKRHGAPTSQDRHIGDLGNVVSDLHGKVTITKLDTVIKLTGIN
SVIGRSVILHKHEDKYPFQPSGNAGGRLACCVIGLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016209antioxidant activity
GO:0046872metal ion binding
GO:0004784superoxide dismutase activity
GO:0016491oxidoreductase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR036423SOD-like_Cu/Zn_dom_sf
IPR024134SOD_Cu/Zn_/chaperone
IPR001424SOD_Cu_Zn_dom
IPR018152SOD_Cu/Zn_BS
Vocabulary: biological process
TermDefinition
GO:0006801superoxide metabolic process
GO:0055114oxidation-reduction process
GO:0019430removal of superoxide radicals
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001424Superoxide dismutase, copper/zinc binding domainPRINTSPR00068CUZNDISMTASEcoord: 120..129
score: 65.98
coord: 139..161
score: 43.43
coord: 84..106
score: 51.46
IPR001424Superoxide dismutase, copper/zinc binding domainPFAMPF00080Sod_Cucoord: 54..183
e-value: 2.0E-41
score: 141.5
IPR001424Superoxide dismutase, copper/zinc binding domainCDDcd00305Cu-Zn_Superoxide_Dismutasecoord: 39..180
e-value: 5.77514E-42
score: 135.851
IPR036423Superoxide dismutase-like, copper/zinc binding domain superfamilyGENE3DG3DSA:2.60.40.200coord: 28..185
e-value: 9.0E-47
score: 160.8
IPR036423Superoxide dismutase-like, copper/zinc binding domain superfamilySUPERFAMILYSSF49329Cu,Zn superoxide dismutase-likecoord: 54..185
IPR024134Superoxide dismutase (Cu/Zn) / superoxide dismutase copper chaperonePANTHERPTHR10003SUPEROXIDE DISMUTASE CU-ZN -RELATEDcoord: 28..185
NoneNo IPR availablePANTHERPTHR10003:SF71SUPEROXIDE DISMUTASE [CU-ZN]coord: 28..185
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.86
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
IPR018152Superoxide dismutase, copper/zinc, binding sitePROSITEPS00332SOD_CU_ZN_2coord: 172..183