SMED30035436

Overview
NameSMED30035436
Smed IDSMED30035436
Length (bp)2644
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30035436 (SMED30035436) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30035436 (SMED30035436) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30035436 (SMED30035436) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30035436 (SMED30035436) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035436

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035436SMESG000022942.1 Contig5676GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30035436SMESG000022942.1 dd_Smed_v4_2773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035436SMESG000022942.1 dd_Smed_v4_2773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035436SMESG000022942.1 dd_Smed_v4_2773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035436SMESG000022942.1 dd_Smed_v4_2773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035436SMESG000022942.1 dd_Smed_v4_2773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035436SMESG000022942.1 dd_Smed_v4_2773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035436SMESG000022942.1 dd_Smed_v4_2773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035436SMESG000022942.1 dd_Smed_v4_2773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035436SMESG000022942.1 dd_Smed_v4_2773_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30035436 vs. Ensembl Human
Match: TMCC1 (transmembrane and coiled-coil domain family 1 [Source:HGNC Symbol;Acc:HGNC:29116])

HSP 1 Score: 63.5438 bits (153), Expect = 1.331e-9
Identity = 116/532 (21.80%), Postives = 204/532 (38.35%), Query Frame = 3
Query:  741 SETDKNAIATDKVDGVNDNIVVSSGDSKISRWNPTIVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSA-CNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE-----KRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW-HRLCLFLSDSGYLPRFL 2315
            S TD  +I TD VDG  D                     + T+  +  L + I    E+I    + +D  V + +     N+ D + + ++ + FE KN+ + +++ + Q +LE    K   V QNGIP   +P D V     +            S G +      +S  S +  + +    S    IAS +   F    D++   KD L + +  D    L +  +   SPK  S   C+S  +GS  A S        G  A     SK+N++                +S  F  L+                         E+ E+R    R +   + L+     +  L  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E     ++  QL  + N   +N    +   L N++++++A +++ +S+       V N    + + RN     + +   +        LW H   LF     Y+ RF 
Sbjct:  210 SSTD-GSIHTDSVDGTPDP--------------------QRTKAAIAHLQQKILKLTEQIKIAQTARDDNVAEYLK--LANSADKQQAARIKQVFEKKNQKSAQTILQLQKKLEHYHRKLREVEQNGIPR--QPKD-VFRDMHQGLKDVGAKVTGFSEGVVDSVKGGFSSFSQATHSAAGAVVSKPREIASLIRNKF-GSADNIPNLKDSLEEGQVDDAGKALGVISNFQSSPKYGSEEDCSSATSGSVGANSTT------GGIAVGASSSKTNTLD--------------MQSSGFDALLH------------------------EIQEIRETQARLEESFETLKEHYQRDYSLIMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARN----LLGKLINILLAVMAVLLVFVST-------VANCVVPLMKTRNRTFSTLFLVVFIAF------LWKHWDALF----SYVERFF 649          
BLAST of SMED30035436 vs. Ensembl Human
Match: TMCC1 (transmembrane and coiled-coil domain family 1 [Source:HGNC Symbol;Acc:HGNC:29116])

HSP 1 Score: 63.1586 bits (152), Expect = 1.416e-9
Identity = 107/495 (21.62%), Postives = 194/495 (39.19%), Query Frame = 3
Query:  852 DIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSA-CNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE-----KRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW-HRLCLFLSDSGYLPRFL 2315
            D + T+  +  L + I    E+I    + +D  V + +     N+ D + + ++ + FE KN+ + +++ + Q +LE    K   V QNGIP   +P D V     +            S G +      +S  S +  + +    S    IAS +   F    D++   KD L + +  D    L +  +   SPK  S   C+S  +GS  A S        G  A     SK+N++                +S  F  L+                         E+ E+R    R +   + L+     +  L  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E     ++  QL  + N   +N    +   L N++++++A +++ +S+       V N    + + RN     + +   +        LW H   LF     Y+ RF 
Sbjct:  112 DPQRTKAAIAHLQQKILKLTEQIKIAQTARDDNVAEYLK--LANSADKQQAARIKQVFEKKNQKSAQTILQLQKKLEHYHRKLREVEQNGIPR--QPKD-VFRDMHQGLKDVGAKVTGFSEGVVDSVKGGFSSFSQATHSAAGAVVSKPREIASLIRNKF-GSADNIPNLKDSLEEGQVDDAGKALGVISNFQSSPKYGSEEDCSSATSGSVGANSTT------GGIAVGASSSKTNTLD--------------MQSSGFDALLH------------------------EIQEIRETQARLEESFETLKEHYQRDYSLIMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARN----LLGKLINILLAVMAVLLVFVST-------VANCVVPLMKTRNRTFSTLFLVVFIAF------LWKHWDALF----SYVERFF 535          
BLAST of SMED30035436 vs. Ensembl Human
Match: TMCC1 (transmembrane and coiled-coil domain family 1 [Source:HGNC Symbol;Acc:HGNC:29116])

HSP 1 Score: 63.1586 bits (152), Expect = 1.416e-9
Identity = 107/495 (21.62%), Postives = 194/495 (39.19%), Query Frame = 3
Query:  852 DIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSA-CNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE-----KRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW-HRLCLFLSDSGYLPRFL 2315
            D + T+  +  L + I    E+I    + +D  V + +     N+ D + + ++ + FE KN+ + +++ + Q +LE    K   V QNGIP   +P D V     +            S G +      +S  S +  + +    S    IAS +   F    D++   KD L + +  D    L +  +   SPK  S   C+S  +GS  A S        G  A     SK+N++                +S  F  L+                         E+ E+R    R +   + L+     +  L  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E     ++  QL  + N   +N    +   L N++++++A +++ +S+       V N    + + RN     + +   +        LW H   LF     Y+ RF 
Sbjct:  112 DPQRTKAAIAHLQQKILKLTEQIKIAQTARDDNVAEYLK--LANSADKQQAARIKQVFEKKNQKSAQTILQLQKKLEHYHRKLREVEQNGIPR--QPKD-VFRDMHQGLKDVGAKVTGFSEGVVDSVKGGFSSFSQATHSAAGAVVSKPREIASLIRNKF-GSADNIPNLKDSLEEGQVDDAGKALGVISNFQSSPKYGSEEDCSSATSGSVGANSTT------GGIAVGASSSKTNTLD--------------MQSSGFDALLH------------------------EIQEIRETQARLEESFETLKEHYQRDYSLIMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARN----LLGKLINILLAVMAVLLVFVST-------VANCVVPLMKTRNRTFSTLFLVVFIAF------LWKHWDALF----SYVERFF 535          
BLAST of SMED30035436 vs. Ensembl Human
Match: TMCC3 (transmembrane and coiled-coil domain family 3 [Source:HGNC Symbol;Acc:HGNC:29199])

HSP 1 Score: 53.5286 bits (127), Expect = 1.296e-6
Identity = 91/439 (20.73%), Postives = 175/439 (39.86%), Query Frame = 3
Query:  846 IVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVK--PADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSACNSRKAGSASATSAISLDQQYGEKASI---PKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSI--QNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE-KRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSS 2138
            I+D    ++   SL + I    E+I  + + +D  V + +     N  D + + ++ + FE KN+ +  S+ + Q +LEQ   K   + QNG     K    DH+K                     + + +KD   KS +A +   + +S + +    L                + +K+R   +  R     +  GS   I+   NS +     A++     + YG  A+I   PK    +  SSGT                  G  D   N+        ++  Q  ++ +  EL E++    +   + + L++         SQ +Q    R +RLE  L  L    Q E    K +  ++EEK+ Y+     RD+Q+ ++SC   +S +E  + EQ    ++     + K++     N++++ +  I++ +S+
Sbjct:   58 ILDFHKVKLTADSLKQKILKVTEQIKIEQTSRDGNVAEYLK--LVNNADKQQAGRIKQVFEKKNQKSAHSIAQLQKKLEQYHRKLREIEQNGASRSSKDISKDHLK--------------------DIHRSLKDAHVKSRTAPHC--MESSKSGMPGVSLTPPVF-----------VFNKSREFANLIR-----NKFGSADNIAHLKNSLEEFRPEASA-----RAYGGSATIVNKPKYGSDDECSSGTS-----------------GSADSNGNQSFGAGGASTLDSQGKLAVILEELREIKDTQAQLAEDIEALKVQFKREYGFISQTLQEERYRYERLEDQLHDLTDLHQHETANLKQELASIEEKVAYQAYERSRDIQEALESCQTRISKLELHQQEQQALQTDTV---NAKVLLGRCINVILAFMTVILVCVST 431          
BLAST of SMED30035436 vs. Ensembl Human
Match: TMCC1 (transmembrane and coiled-coil domain family 1 [Source:HGNC Symbol;Acc:HGNC:29116])

HSP 1 Score: 52.7582 bits (125), Expect = 1.387e-6
Identity = 48/210 (22.86%), Postives = 93/210 (44.29%), Query Frame = 3
Query: 1704 SLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE-----KRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW-HRLCLFLSDSGYLPRFL 2315
            +L  E+ E+R    R +   + L+     +  L  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E     ++  QL  + N   +N    +   L N++++++A +++ +S+       V N    + + RN     + +   +        LW H   LF     Y+ RF 
Sbjct:  137 ALLHEIQEIRETQARLEESFETLKEHYQRDYSLIMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARN----LLGKLINILLAVMAVLLVFVST-------VANCVVPLMKTRNRTFSTLFLVVFIAF------LWKHWDALF----SYVERFF 325          
BLAST of SMED30035436 vs. Ensembl Zebrafish
Match: tmcc1b (transmembrane and coiled-coil domain family 1b [Source:ZFIN;Acc:ZDB-GENE-061013-154])

HSP 1 Score: 59.6918 bits (143), Expect = 1.202e-8
Identity = 92/446 (20.63%), Postives = 181/446 (40.58%), Query Frame = 3
Query:  849 VDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQK-SASAENISRLANSDNNLIASQ------LNKSFIHKHDDVTKSKDILSKTRTLDDTS-------RLVIPFDNAGSPKVISS-ACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKN-DVKIITDHLCNLVVSLIAFIMLLLSS 2138
            +D + T+  +  L + I    E+I  + + +D  V + +     N  D + S ++ + FE KN+ + +++++ Q +LE    K   V  NGIP   +P D ++                     + + +KD   K +    +IS+  +S    + S+      L ++ +   +++   KD L + +  D  S       R   P     SPK  S   C+S  +GSA A S              P  SK N++  G G                                     +   +L  E+ E++ +  R +   DNL+     +     Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E + +Q   +     +N   + +   L N++++++A +++ +S+
Sbjct:  232 LDPQRTKQAIAQLQQKILKLTEQIKIEQTARDDNVAEYLK--LANNADKQQSTRIKQVFEKKNQKSAQTIQQLQRKLEHYHRKLREVEHNGIPR--QPKDVLR--------------------DMHQGLKDVGAKVTGGLSSISQATHSAAGAVVSKPREFASLIRNKLGSTENIPALKDSLDEQQGDDPVSSTGVAGTRTPGPGQLQSSPKYGSEDDCSSATSGSAGANSTTG-------APGGPPSSKGNTLEHGQG-------------------------------------SGFDTLLHEIQELKDNQSRLEESFDNLKSHYQRDYTDIMQALQEERFRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARTLLGKLINVLLAVMAVLLVFVST 609          
BLAST of SMED30035436 vs. Ensembl Zebrafish
Match: tmcc1b (transmembrane and coiled-coil domain family 1b [Source:ZFIN;Acc:ZDB-GENE-061013-154])

HSP 1 Score: 59.6918 bits (143), Expect = 1.202e-8
Identity = 92/446 (20.63%), Postives = 181/446 (40.58%), Query Frame = 3
Query:  849 VDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQK-SASAENISRLANSDNNLIASQ------LNKSFIHKHDDVTKSKDILSKTRTLDDTS-------RLVIPFDNAGSPKVISS-ACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKN-DVKIITDHLCNLVVSLIAFIMLLLSS 2138
            +D + T+  +  L + I    E+I  + + +D  V + +     N  D + S ++ + FE KN+ + +++++ Q +LE    K   V  NGIP   +P D ++                     + + +KD   K +    +IS+  +S    + S+      L ++ +   +++   KD L + +  D  S       R   P     SPK  S   C+S  +GSA A S              P  SK N++  G G                                     +   +L  E+ E++ +  R +   DNL+     +     Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E + +Q   +     +N   + +   L N++++++A +++ +S+
Sbjct:  232 LDPQRTKQAIAQLQQKILKLTEQIKIEQTARDDNVAEYLK--LANNADKQQSTRIKQVFEKKNQKSAQTIQQLQRKLEHYHRKLREVEHNGIPR--QPKDVLR--------------------DMHQGLKDVGAKVTGGLSSISQATHSAAGAVVSKPREFASLIRNKLGSTENIPALKDSLDEQQGDDPVSSTGVAGTRTPGPGQLQSSPKYGSEDDCSSATSGSAGANSTTG-------APGGPPSSKGNTLEHGQG-------------------------------------SGFDTLLHEIQELKDNQSRLEESFDNLKSHYQRDYTDIMQALQEERFRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARTLLGKLINVLLAVMAVLLVFVST 609          
BLAST of SMED30035436 vs. Ensembl Zebrafish
Match: tmcc1b (transmembrane and coiled-coil domain family 1b [Source:ZFIN;Acc:ZDB-GENE-061013-154])

HSP 1 Score: 59.6918 bits (143), Expect = 1.202e-8
Identity = 92/446 (20.63%), Postives = 181/446 (40.58%), Query Frame = 3
Query:  849 VDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQK-SASAENISRLANSDNNLIASQ------LNKSFIHKHDDVTKSKDILSKTRTLDDTS-------RLVIPFDNAGSPKVISS-ACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKN-DVKIITDHLCNLVVSLIAFIMLLLSS 2138
            +D + T+  +  L + I    E+I  + + +D  V + +     N  D + S ++ + FE KN+ + +++++ Q +LE    K   V  NGIP   +P D ++                     + + +KD   K +    +IS+  +S    + S+      L ++ +   +++   KD L + +  D  S       R   P     SPK  S   C+S  +GSA A S              P  SK N++  G G                                     +   +L  E+ E++ +  R +   DNL+     +     Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E + +Q   +     +N   + +   L N++++++A +++ +S+
Sbjct:  232 LDPQRTKQAIAQLQQKILKLTEQIKIEQTARDDNVAEYLK--LANNADKQQSTRIKQVFEKKNQKSAQTIQQLQRKLEHYHRKLREVEHNGIPR--QPKDVLR--------------------DMHQGLKDVGAKVTGGLSSISQATHSAAGAVVSKPREFASLIRNKLGSTENIPALKDSLDEQQGDDPVSSTGVAGTRTPGPGQLQSSPKYGSEDDCSSATSGSAGANSTTG-------APGGPPSSKGNTLEHGQG-------------------------------------SGFDTLLHEIQELKDNQSRLEESFDNLKSHYQRDYTDIMQALQEERFRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARTLLGKLINVLLAVMAVLLVFVST 609          
BLAST of SMED30035436 vs. Ensembl Zebrafish
Match: tmcc2 (transmembrane and coiled-coil domain family 2 [Source:ZFIN;Acc:ZDB-GENE-091202-2])

HSP 1 Score: 50.8322 bits (120), Expect = 5.432e-6
Identity = 45/201 (22.39%), Postives = 93/201 (46.27%), Query Frame = 3
Query: 1719 LHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKN-DVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSL----------WHRLCLFLS 2288
            L E++      +   D+++  + ++    +Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ ++SC   ++ +E + +Q   +     +N + + +   L N++++L+A +++ +S+  + +                   P+M T A V A+V L+L          W  LCL  S
Sbjct:  285 LQEIKVGQVHMEDAIDDMKAQLQSDYSYMTQCLQEERYRYERLEEQLNDLTELHQNEMSNLKQELASMEEKVAYQSYERARDIQEAVESCLTRITKLELQQQQQQVVQLEGVENANARALLGKLINVILALMAVLLVFVSTMANFIT------------------PLMKTRARVGATVALALFLVTLWKHWDWLELCLLPS 467          
BLAST of SMED30035436 vs. Ensembl Xenopus
Match: tmcc3 (transmembrane and coiled-coil domain family 3 [Source:NCBI gene;Acc:779714])

HSP 1 Score: 56.225 bits (134), Expect = 1.963e-7
Identity = 45/189 (23.81%), Postives = 88/189 (46.56%), Query Frame = 3
Query: 1692 NDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE-KRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIML-----------LLSSGFHLLIRVLNIG--ATICRHRNMILPPV 2216
             ++S    EL E++    +   + + L++    +  L SQ +Q    R +RLE  L+ L    Q E    K D  ++EEK+ Y+     RD+Q+ ++SC   +S +E  + EQL   S      + K++     N++++LI  I++           ++ S  H++     +   A +C++ + I+  V
Sbjct:  281 GNLSVFLEELREIKDAQSQLAEDIETLKVHFKRDYSLISQTLQEERYRYERLEDQLNDLTDLHQHETTNLKQDLASIEEKVAYQAYERSRDIQEALESCQTRVSKLELHQQEQLAIQSETV---NAKVLLGKCINILLALITVILVCVSTIAKFVAPMMKSRLHIIFTFFAVTLLAVVCKNWDHIVCAV 466          
BLAST of SMED30035436 vs. Ensembl Mouse
Match: Tmcc1 (transmembrane and coiled coil domains 1 [Source:MGI Symbol;Acc:MGI:2442368])

HSP 1 Score: 62.003 bits (149), Expect = 2.597e-9
Identity = 105/486 (21.60%), Postives = 191/486 (39.30%), Query Frame = 3
Query:  846 IVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSA-CNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE-----KRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW-HRLCLF 2282
            I D + T+  +  L + I    E+I    + +D  V + +     N+ D + + ++ + FE KN+ + +++ + Q +LE    K   V QNGIP   +P D V     +            S G +      +S  S +  + +    S    IAS +   F    D++   KD L + +  D    L +  +   SPK  S   C+S  +GS  A S        G  A     SK+N++                +S  F  L+                         E+ E+R    R +   + L+     +  L  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E     ++  QL  + N   +N    +   L N++++++A +++ +S+       V N    + + RN     + +   +        LW H   LF
Sbjct:  261 IPDPQRTKAAIAHLQQKILKLTEQIKIAQTARDDNVAEYLK--LANSADKQQAARIKQVFEKKNQKSAQTILQLQKKLEHYHRKLREVEQNGIPR--QPKD-VFRDMHQGLKDVGAKVTGFSEGVVDSVKGGFSSFSQATHSAAGAVVSKPREIASLIRNKF-GSADNIPNLKDSLEEGQVDDGGKALGVISNFQSSPKYGSEEDCSSATSGSVGANSTT------GGIAVGASSSKTNTLD--------------MQSSGFDALLH------------------------EVQEIRETQARLEDSFETLKEHYQRDYSLIMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARN----LLGKLINILLAVMAVLLVFVST-------VANCVVPLMKTRNRTFSTLFLVAFIAF------LWKHWDALF 679          
BLAST of SMED30035436 vs. Ensembl Mouse
Match: Tmcc1 (transmembrane and coiled coil domains 1 [Source:MGI Symbol;Acc:MGI:2442368])

HSP 1 Score: 62.003 bits (149), Expect = 2.898e-9
Identity = 105/486 (21.60%), Postives = 191/486 (39.30%), Query Frame = 3
Query:  846 IVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSA-CNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE-----KRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW-HRLCLF 2282
            I D + T+  +  L + I    E+I    + +D  V + +     N+ D + + ++ + FE KN+ + +++ + Q +LE    K   V QNGIP   +P D V     +            S G +      +S  S +  + +    S    IAS +   F    D++   KD L + +  D    L +  +   SPK  S   C+S  +GS  A S        G  A     SK+N++                +S  F  L+                         E+ E+R    R +   + L+     +  L  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E     ++  QL  + N   +N    +   L N++++++A +++ +S+       V N    + + RN     + +   +        LW H   LF
Sbjct:  220 IPDPQRTKAAIAHLQQKILKLTEQIKIAQTARDDNVAEYLK--LANSADKQQAARIKQVFEKKNQKSAQTILQLQKKLEHYHRKLREVEQNGIPR--QPKD-VFRDMHQGLKDVGAKVTGFSEGVVDSVKGGFSSFSQATHSAAGAVVSKPREIASLIRNKF-GSADNIPNLKDSLEEGQVDDGGKALGVISNFQSSPKYGSEEDCSSATSGSVGANSTT------GGIAVGASSSKTNTLD--------------MQSSGFDALLH------------------------EVQEIRETQARLEDSFETLKEHYQRDYSLIMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARN----LLGKLINILLAVMAVLLVFVST-------VANCVVPLMKTRNRTFSTLFLVAFIAF------LWKHWDALF 638          
BLAST of SMED30035436 vs. Ensembl Mouse
Match: Tmcc1 (transmembrane and coiled coil domains 1 [Source:MGI Symbol;Acc:MGI:2442368])

HSP 1 Score: 61.6178 bits (148), Expect = 3.115e-9
Identity = 105/486 (21.60%), Postives = 191/486 (39.30%), Query Frame = 3
Query:  846 IVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSA-CNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE-----KRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW-HRLCLF 2282
            I D + T+  +  L + I    E+I    + +D  V + +     N+ D + + ++ + FE KN+ + +++ + Q +LE    K   V QNGIP   +P D V     +            S G +      +S  S +  + +    S    IAS +   F    D++   KD L + +  D    L +  +   SPK  S   C+S  +GS  A S        G  A     SK+N++                +S  F  L+                         E+ E+R    R +   + L+     +  L  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E     ++  QL  + N   +N    +   L N++++++A +++ +S+       V N    + + RN     + +   +        LW H   LF
Sbjct:   41 IPDPQRTKAAIAHLQQKILKLTEQIKIAQTARDDNVAEYLK--LANSADKQQAARIKQVFEKKNQKSAQTILQLQKKLEHYHRKLREVEQNGIPR--QPKD-VFRDMHQGLKDVGAKVTGFSEGVVDSVKGGFSSFSQATHSAAGAVVSKPREIASLIRNKF-GSADNIPNLKDSLEEGQVDDGGKALGVISNFQSSPKYGSEEDCSSATSGSVGANSTT------GGIAVGASSSKTNTLD--------------MQSSGFDALLH------------------------EVQEIRETQARLEDSFETLKEHYQRDYSLIMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARN----LLGKLINILLAVMAVLLVFVST-------VANCVVPLMKTRNRTFSTLFLVAFIAF------LWKHWDALF 459          
BLAST of SMED30035436 vs. Ensembl Mouse
Match: Tmcc1 (transmembrane and coiled coil domains 1 [Source:MGI Symbol;Acc:MGI:2442368])

HSP 1 Score: 61.2326 bits (147), Expect = 3.341e-9
Identity = 105/486 (21.60%), Postives = 191/486 (39.30%), Query Frame = 3
Query:  846 IVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSA-CNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE-----KRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW-HRLCLF 2282
            I D + T+  +  L + I    E+I    + +D  V + +     N+ D + + ++ + FE KN+ + +++ + Q +LE    K   V QNGIP   +P D V     +            S G +      +S  S +  + +    S    IAS +   F    D++   KD L + +  D    L +  +   SPK  S   C+S  +GS  A S        G  A     SK+N++                +S  F  L+                         E+ E+R    R +   + L+     +  L  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E     ++  QL  + N   +N    +   L N++++++A +++ +S+       V N    + + RN     + +   +        LW H   LF
Sbjct:   45 IPDPQRTKAAIAHLQQKILKLTEQIKIAQTARDDNVAEYLK--LANSADKQQAARIKQVFEKKNQKSAQTILQLQKKLEHYHRKLREVEQNGIPR--QPKD-VFRDMHQGLKDVGAKVTGFSEGVVDSVKGGFSSFSQATHSAAGAVVSKPREIASLIRNKF-GSADNIPNLKDSLEEGQVDDGGKALGVISNFQSSPKYGSEEDCSSATSGSVGANSTT------GGIAVGASSSKTNTLD--------------MQSSGFDALLH------------------------EVQEIRETQARLEDSFETLKEHYQRDYSLIMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARN----LLGKLINILLAVMAVLLVFVST-------VANCVVPLMKTRNRTFSTLFLVAFIAF------LWKHWDALF 463          
BLAST of SMED30035436 vs. Ensembl Mouse
Match: Tmcc3 (transmembrane and coiled coil domains 3 [Source:MGI Symbol;Acc:MGI:2442900])

HSP 1 Score: 52.373 bits (124), Expect = 2.403e-6
Identity = 82/392 (20.92%), Postives = 154/392 (39.29%), Query Frame = 3
Query:  978 TNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSACNSRKAGSASATSAISLDQQYGEKASI---PKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSI--QNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSS 2138
             ++ D + + ++ + FE KN+ +  S+ + Q +LEQ   K   + QNG+    K                     K S   +   +KD   KS +A +   L +S +++    L                + +K+R   +  R     +  GS   I+   NS +     A+      + YG  A+I   PK    +  SSGT                  G  D   N+        ++  Q  I+ +  EL E++    +   + + L++         SQ +Q    R +RLE  L  L +  Q E    K +  + EEK+ Y+     RD+Q+ ++SC   +S +E   ++   +   A   + K++     N+V++ +  I++ +S+
Sbjct:  100 VSSADKQQAGRIKQVFEKKNQKSAHSIAQLQKKLEQYHRKLREIEQNGVTRSSKDIS------------------KDSLKEIHHSLKDAHVKSRTAPHC--LESSKSSMPGVSLTPPVF-----------VFNKSREFANLIR-----NKFGSADNIAHLKNSLEEFRPEASP-----RAYGGSATIVNKPKYGSDDECSSGTS-----------------GSADSNGNQSFGAGGTSTLDSQGKIAKIMEELREIKVTQTQLAEDIEALKVQFKREYGFISQTLQEERYRYERLEDQLHDLTELHQHETANLKQELASAEEKVAYQAYERSRDIQEALESCQTRISKLELHQQEQQTLQTDA--VNAKVLLGKCINVVLAFMTVILVCVST 431          
BLAST of SMED30035436 vs. UniProt/SwissProt
Match: sp|O94876|TMCC1_HUMAN (Transmembrane and coiled-coil domains protein 1 OS=Homo sapiens OX=9606 GN=TMCC1 PE=1 SV=3)

HSP 1 Score: 63.5438 bits (153), Expect = 6.390e-9
Identity = 116/532 (21.80%), Postives = 204/532 (38.35%), Query Frame = 3
Query:  741 SETDKNAIATDKVDGVNDNIVVSSGDSKISRWNPTIVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSA-CNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE-----KRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW-HRLCLFLSDSGYLPRFL 2315
            S TD  +I TD VDG  D                     + T+  +  L + I    E+I    + +D  V + +     N+ D + + ++ + FE KN+ + +++ + Q +LE    K   V QNGIP   +P D V     +            S G +      +S  S +  + +    S    IAS +   F    D++   KD L + +  D    L +  +   SPK  S   C+S  +GS  A S        G  A     SK+N++                +S  F  L+                         E+ E+R    R +   + L+     +  L  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E     ++  QL  + N   +N    +   L N++++++A +++ +S+       V N    + + RN     + +   +        LW H   LF     Y+ RF 
Sbjct:  210 SSTD-GSIHTDSVDGTPDP--------------------QRTKAAIAHLQQKILKLTEQIKIAQTARDDNVAEYLK--LANSADKQQAARIKQVFEKKNQKSAQTILQLQKKLEHYHRKLREVEQNGIPR--QPKD-VFRDMHQGLKDVGAKVTGFSEGVVDSVKGGFSSFSQATHSAAGAVVSKPREIASLIRNKF-GSADNIPNLKDSLEEGQVDDAGKALGVISNFQSSPKYGSEEDCSSATSGSVGANSTT------GGIAVGASSSKTNTLD--------------MQSSGFDALLH------------------------EIQEIRETQARLEESFETLKEHYQRDYSLIMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARN----LLGKLINILLAVMAVLLVFVST-------VANCVVPLMKTRNRTFSTLFLVVFIAF------LWKHWDALF----SYVERFF 649          
BLAST of SMED30035436 vs. UniProt/SwissProt
Match: sp|Q69ZZ6|TMCC1_MOUSE (Transmembrane and coiled-coil domains protein 1 OS=Mus musculus OX=10090 GN=Tmcc1 PE=1 SV=2)

HSP 1 Score: 62.003 bits (149), Expect = 2.027e-8
Identity = 105/486 (21.60%), Postives = 191/486 (39.30%), Query Frame = 3
Query:  846 IVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSA-CNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE-----KRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW-HRLCLF 2282
            I D + T+  +  L + I    E+I    + +D  V + +     N+ D + + ++ + FE KN+ + +++ + Q +LE    K   V QNGIP   +P D V     +            S G +      +S  S +  + +    S    IAS +   F    D++   KD L + +  D    L +  +   SPK  S   C+S  +GS  A S        G  A     SK+N++                +S  F  L+                         E+ E+R    R +   + L+     +  L  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E     ++  QL  + N   +N    +   L N++++++A +++ +S+       V N    + + RN     + +   +        LW H   LF
Sbjct:  220 IPDPQRTKAAIAHLQQKILKLTEQIKIAQTARDDNVAEYLK--LANSADKQQAARIKQVFEKKNQKSAQTILQLQKKLEHYHRKLREVEQNGIPR--QPKD-VFRDMHQGLKDVGAKVTGFSEGVVDSVKGGFSSFSQATHSAAGAVVSKPREIASLIRNKF-GSADNIPNLKDSLEEGQVDDGGKALGVISNFQSSPKYGSEEDCSSATSGSVGANSTT------GGIAVGASSSKTNTLD--------------MQSSGFDALLH------------------------EVQEIRETQARLEDSFETLKEHYQRDYSLIMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARN----LLGKLINILLAVMAVLLVFVST-------VANCVVPLMKTRNRTFSTLFLVAFIAF------LWKHWDALF 638          
BLAST of SMED30035436 vs. UniProt/SwissProt
Match: sp|Q9ULS5|TMCC3_HUMAN (Transmembrane and coiled-coil domain protein 3 OS=Homo sapiens OX=9606 GN=TMCC3 PE=1 SV=3)

HSP 1 Score: 53.5286 bits (127), Expect = 6.223e-6
Identity = 91/439 (20.73%), Postives = 175/439 (39.86%), Query Frame = 3
Query:  846 IVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVK--PADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSACNSRKAGSASATSAISLDQQYGEKASI---PKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSI--QNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE-KRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSS 2138
            I+D    ++   SL + I    E+I  + + +D  V + +     N  D + + ++ + FE KN+ +  S+ + Q +LEQ   K   + QNG     K    DH+K                     + + +KD   KS +A +   + +S + +    L                + +K+R   +  R     +  GS   I+   NS +     A++     + YG  A+I   PK    +  SSGT                  G  D   N+        ++  Q  ++ +  EL E++    +   + + L++         SQ +Q    R +RLE  L  L    Q E    K +  ++EEK+ Y+     RD+Q+ ++SC   +S +E  + EQ    ++     + K++     N++++ +  I++ +S+
Sbjct:   58 ILDFHKVKLTADSLKQKILKVTEQIKIEQTSRDGNVAEYLK--LVNNADKQQAGRIKQVFEKKNQKSAHSIAQLQKKLEQYHRKLREIEQNGASRSSKDISKDHLK--------------------DIHRSLKDAHVKSRTAPHC--MESSKSGMPGVSLTPPVF-----------VFNKSREFANLIR-----NKFGSADNIAHLKNSLEEFRPEASA-----RAYGGSATIVNKPKYGSDDECSSGTS-----------------GSADSNGNQSFGAGGASTLDSQGKLAVILEELREIKDTQAQLAEDIEALKVQFKREYGFISQTLQEERYRYERLEDQLHDLTDLHQHETANLKQELASIEEKVAYQAYERSRDIQEALESCQTRISKLELHQQEQQALQTDTV---NAKVLLGRCINVILAFMTVILVCVST 431          
BLAST of SMED30035436 vs. TrEMBL
Match: A0A564YRS9 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS8816 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 5.232e-18
Identity = 68/215 (31.63%), Postives = 120/215 (55.81%), Query Frame = 3
Query: 1686 IQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLWHRLC------LFLSDSGYLPRF 2312
            I+ +++SL+SEL E R+  +    E D L  DM T  ++ +QK+ +++ R+++L+   + LRQ  Q +  T +++ ++  E L Y+L T  RDL+D   + +N ++++EK  E+L  + +R     ++ I + L +L+VSL+AFI  L+     +LIR LN GAT+  +R ++     +   L   +  LS W   C      +F+ D  YLP F
Sbjct:  549 IKEELNSLRSELTETRNFVNTLTVEVDALTRDMQTKEEVANQKLGDAVARLEQLDASAEKLRQNVQQDLITIRNEQKHALEPLKYQLATETRDLRDMFTTLSNKVTILEK-CERLSNL-DRDQPQMLRSIANTLTDLLVSLVAFITTLI----QMLIRFLNAGATVTNNRALVW---RVHLVLQPMNSVLSCWFTHCTRVSLDVFVLD--YLPMF 752          
BLAST of SMED30035436 vs. TrEMBL
Match: A0A5K3ENP6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.316e-17
Identity = 64/214 (29.91%), Postives = 117/214 (54.67%), Query Frame = 3
Query: 1686 IQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALV------IASVKLSLWHRL-CLFLSDSGYLP 2306
            ++ ++++L+ +L E R+  +    E + LR DM T  D+ S  + N+I R+++L+   + LRQ  Q +  + +++ ++  E L Y+L T  RDL+D   + +N ++++EK  E+L  + +R     +++I + + NLVVSL AFI  L+     +LIR LN GAT+  +R   +  V+  C LV      +A      W+R   ++ S   + P
Sbjct:  662 LREELTNLRQDLMETRNMVNTITVEVEALRRDMQTKEDVQSHTLSNAIARLEQLDASAEKLRQNVQQDLISIRNEQKHALEPLKYQLATETRDLRDMFTTLSNKVTIMEK-CERLSNL-DRDQPQALRLIANTMTNLVVSLFAFITALI----QILIRFLNAGATVTNNRVSAI--VLNVCILVFLLVIFLAEPLFRWWNRTDAIYPSSPAFQP 867          
BLAST of SMED30035436 vs. TrEMBL
Match: A0A5K3EP34 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.696e-17
Identity = 64/214 (29.91%), Postives = 117/214 (54.67%), Query Frame = 3
Query: 1686 IQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALV------IASVKLSLWHRL-CLFLSDSGYLP 2306
            ++ ++++L+ +L E R+  +    E + LR DM T  D+ S  + N+I R+++L+   + LRQ  Q +  + +++ ++  E L Y+L T  RDL+D   + +N ++++EK  E+L  + +R     +++I + + NLVVSL AFI  L+     +LIR LN GAT+  +R   +  V+  C LV      +A      W+R   ++ S   + P
Sbjct:  794 LREELTNLRQDLMETRNMVNTITVEVEALRRDMQTKEDVQSHTLSNAIARLEQLDASAEKLRQNVQQDLISIRNEQKHALEPLKYQLATETRDLRDMFTTLSNKVTIMEK-CERLSNL-DRDQPQALRLIANTMTNLVVSLFAFITALI----QILIRFLNAGATVTNNRVSAI--VLNVCILVFLLVIFLAEPLFRWWNRTDAIYPSSPAFQP 999          
BLAST of SMED30035436 vs. TrEMBL
Match: A0A5K3EQH6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 9.051e-17
Identity = 55/170 (32.35%), Postives = 101/170 (59.41%), Query Frame = 3
Query: 1686 IQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHR 2195
            ++ ++++L+ +L E R+  +    E + LR DM T  D+ S  + N+I R+++L+   + LRQ  Q +  + +++ ++  E L Y+L T  RDL+D   + +N ++++EK  E+L  + +R     +++I + + NLVVSL AFI  L+     +LIR LN GAT+  +R
Sbjct:  662 LREELTNLRQDLMETRNMVNTITVEVEALRRDMQTKEDVQSHTLSNAIARLEQLDASAEKLRQNVQQDLISIRNEQKHALEPLKYQLATETRDLRDMFTTLSNKVTIMEK-CERLSNL-DRDQPQALRLIANTMTNLVVSLFAFITALI----QILIRFLNAGATVTNNR 825          
BLAST of SMED30035436 vs. TrEMBL
Match: A0A4Z2D4A1 (DNA methylase N 6 adenine specific isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_004731 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.049e-16
Identity = 61/213 (28.64%), Postives = 116/213 (54.46%), Query Frame = 3
Query: 1662 NSYSRLF-SIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKI------ITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMIL---PPVMITCALVIASVKLSLWHR 2270
            N  S++F  ++++++ + +E   ++S  +    E + +R D  T ++L +QK+ ++  R++RL+ + +  RQ    E    +++F +    ++Y++TT  RDL DNI S NN +S++EK  +Q    SN  G +  ++      +  +L +L VS  A + +LL     +LIR LN+GA +  +R + +     V+ +C LV  S  + LW R
Sbjct:  780 NQQSQIFQELRDELAVMHNETRSIQSTLNNLTTELEAIRRDATTKAELQNQKLTDASSRIERLDAIAEESRQALPHELAAIRNEFHDSLYSVEYQVTTKIRDLSDNITSINNKVSMIEKPHDQ----SNALGAHGTELDRVRRKVLHYLTDLCVSFFALVTMLL----QVLIRCLNLGAVLTENRKLAVCFSMTVLASCLLVYTSDPIILWLR 984          
BLAST of SMED30035436 vs. Ensembl Cavefish
Match: tmcc1b (transmembrane and coiled-coil domains protein 1-like [Source:NCBI gene;Acc:103025279])

HSP 1 Score: 63.1586 bits (152), Expect = 9.787e-10
Identity = 104/505 (20.59%), Postives = 205/505 (40.59%), Query Frame = 3
Query:  852 DIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQK-SASAENISRLANSDNNLIASQ------LNKSFIHKHDDVTKSKDILSKTRTLDDT--------SRLVIPFDNAGSPKVISS-ACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKN-DVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLWHRLCLFLSDSGYLPRFL 2315
            D + T+  +  L + I    E+I  + + +D  V + +     N  D + S ++ + FE KN+ + +++++ Q +LE    K   V  NGIP   +P D ++                     + + +KD   K +     IS+  ++    + S+      L ++     D+++  KD L +T+  D+T        +R++       SPK  S   C+S  +GSA A S   +          P  SK N++  G                           + + +  LF           E+ E+R +  R     ++L+     +  +  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E + +Q   +     +N   + +   L N++++++A +++ +S+       V N    + + R+  L  +++   L        LW    +    S YL RFL
Sbjct:  241 DPQRTKQAIAQLQQKILKLTEQIKIEQTARDDNVAEYLK--LANNADKQQSARIKQVFEKKNQKSAQTIQQLQRKLEHYHRKLREVEHNGIPR--QPKDVLR--------------------DMHQGLKDVGAKVTGGLSTISQATHTAAGAVVSKPREFASLIRNKFGSADNISALKDSLDETQG-DETISGPGPSGARVLASGQLQSSPKYGSEDDCSSATSGSAGANSTTGV-------PGGPPSSKGNTLEHG---------------------------QSSGFDALF----------HEIQELRENQSRLDESFESLKTHYQKDYTVIMQVLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARTLLGKLINVLLAVMAVLLVFVST-------VANCVVPLMKTRSRTLSTLLLVIFLAF------LWRNWEIL---SQYLDRFL 660          
BLAST of SMED30035436 vs. Ensembl Cavefish
Match: TMCC1 (transmembrane and coiled-coil domain family 1 [Source:NCBI gene;Acc:103027055])

HSP 1 Score: 53.9138 bits (128), Expect = 5.573e-7
Identity = 89/432 (20.60%), Postives = 169/432 (39.12%), Query Frame = 3
Query:  849 VDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSA-CNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKN-DVKIITDHLCNLVVSLIAFIMLLLSS 2138
            +D + T   +  L + I    E++  + + +D+ V + +   + NT D + S ++ + FE KN+ +  S+ + Q +LE    +       G P   +P D ++ + +  +   +      S G +       S  S +  + +    S    IAS L   F         S D +S  +   D +    P     SPK  S   C+S  +GSA A S              P  SK N+M  G                                         +  L  E+ E+R    R +   + L+     +  +  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E + +Q   +     +N   + +   L N++++L+A +++ +S+
Sbjct:   44 LDPQRTRQAIAQLQQKILKLTEQLRIEQTARDENVAEYL-KLANNTNDKQQSCRIKQVFEKKNQKSAASIAQLQRKLEHYHRRLREAEHGGAPR--QPKDVLRDVQQGLRGVGARVITGISEGVVDSVRGGLSTFSHATHSAAGAVASKPREIASLLRNRF--------GSADNISVLKDGGDEA-CSPPSHLQSSPKFGSEEDCSSATSGSAGANSVTG-------APGGPPSSKGNTMERGR-------------------------------------SGSLEMLLQEVQELREAQARLEETLEGLKSHYQRDYSMVMQALQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSNERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARTLLGKLINVLLTLMAVLLVFVST 419          
BLAST of SMED30035436 vs. Ensembl Cavefish
Match: tmcc3 (transmembrane and coiled-coil domain family 3 [Source:NCBI gene;Acc:103038178])

HSP 1 Score: 53.5286 bits (127), Expect = 6.190e-7
Identity = 48/199 (24.12%), Postives = 90/199 (45.23%), Query Frame = 3
Query: 1716 ELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW-HRLCLFLSDSGYLPR 2309
            E+ EV+        + ++LR  M  N    +Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ ++ C   +S +E + +Q   +   +   D K++     N+++++   I++ +S+            A + R R  IL   +  C L +     S W H  C   ++  +LPR
Sbjct:  273 EVREVKEAQAHLAEDIESLRSQMKRNYGFITQMLQEEKYRCERLEDQLNDLTELHQNETANLKQELASIEEKVAYQAYERARDMQEALEVCQTRISKLELQQQQQQLVQLESA--DAKVLLGKCINIMLAIATVILVCVST-------AAKFTAPLLRSRLHILGTFVCVCVLALG---WSHWEHVQC--AAERMFLPR 457          
BLAST of SMED30035436 vs. Ensembl Cavefish
Match: tmcc3 (transmembrane and coiled-coil domain family 3 [Source:NCBI gene;Acc:103038178])

HSP 1 Score: 53.5286 bits (127), Expect = 6.694e-7
Identity = 48/199 (24.12%), Postives = 90/199 (45.23%), Query Frame = 3
Query: 1716 ELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW-HRLCLFLSDSGYLPR 2309
            E+ EV+        + ++LR  M  N    +Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ ++ C   +S +E + +Q   +   +   D K++     N+++++   I++ +S+            A + R R  IL   +  C L +     S W H  C   ++  +LPR
Sbjct:  264 EVREVKEAQAHLAEDIESLRSQMKRNYGFITQMLQEEKYRCERLEDQLNDLTELHQNETANLKQELASIEEKVAYQAYERARDMQEALEVCQTRISKLELQQQQQQLVQLESA--DAKVLLGKCINIMLAIATVILVCVST-------AAKFTAPLLRSRLHILGTFVCVCVLALG---WSHWEHVQC--AAERMFLPR 448          
BLAST of SMED30035436 vs. Ensembl Cavefish
Match: tmcc3 (transmembrane and coiled-coil domain family 3 [Source:NCBI gene;Acc:103038178])

HSP 1 Score: 53.5286 bits (127), Expect = 7.227e-7
Identity = 51/227 (22.47%), Postives = 96/227 (42.29%), Query Frame = 3
Query: 1632 GLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW-HRLCLFLSDSGYLPR 2309
            G +         +SRL     ++  +K     +  D        ++LR  M  N    +Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ ++ C   +S +E + +Q   +   +   D K++     N+++++   I++ +S+            A + R R  IL   +  C L +     S W H  C   ++  +LPR
Sbjct:  277 GAVQSEAGPGEGFSRLADALEEVREVKEAQAHLAEDI-------ESLRSQMKRNYGFITQMLQEEKYRCERLEDQLNDLTELHQNETANLKQELASIEEKVAYQAYERARDMQEALEVCQTRISKLELQQQQQQLVQLESA--DAKVLLGKCINIMLAIATVILVCVST-------AAKFTAPLLRSRLHILGTFVCVCVLALG---WSHWEHVQC--AAERMFLPR 482          
BLAST of SMED30035436 vs. Ensembl Sea Lamprey
Match: tmcc2 (transmembrane and coiled-coil domain family 2 [Source:ZFIN;Acc:ZDB-GENE-091202-2])

HSP 1 Score: 53.5286 bits (127), Expect = 1.543e-7
Identity = 43/190 (22.63%), Postives = 86/190 (45.26%), Query Frame = 3
Query: 1698 ISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKN-DVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLW 2264
            + +++ ELH + S   R +     +R    T      Q +     R  RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ ++ C   +S +E + +Q   +     +N + + +   L N++++L+A +++ +S+  + +         + R RN IL   ++T  L        LW
Sbjct:  285 MEAIRRELHTIHSTHARLEGMVQEMRTQFQTEVTNFKQSLLEERFRFGRLEDQLNDLTELHQNEMSNLKQELASMEEKVAYQSYERARDVQEALEGCQTRISKLELQQQQQQVVQLEGLENANARALLGKLINVLLALMAVVLVFVSTAANFIT-------PLVRTRNRILVTALLTVMLAY------LW 461          
BLAST of SMED30035436 vs. Ensembl Medaka
Match: tmcc1b (transmembrane and coiled-coil domains protein 1 [Source:NCBI gene;Acc:101163807])

HSP 1 Score: 56.225 bits (134), Expect = 1.329e-7
Identity = 93/435 (21.38%), Postives = 181/435 (41.61%), Query Frame = 3
Query:  852 DIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDD----TSRLVIPFDNAGSPKVISSA-CNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKN-DVKIITDHLCNLVVSLIAFIMLLLSS 2138
            D + T+  +  L + I    E+I  + + +D  V + +     N  D + S ++ + FE KN+ + +++++ Q +LE    K   V  NGIP   +P D  + +++          +K     ++  +  +SQ + SA        S    IAS L   F    D++   KD L +T+  +      SR +       SPK  S   C+S  +GSA A S              P  S+ N++                               D + +  F +      +  E+ E+R +  R +   DNL+     +  +  + +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD Q+ +++C   +S +E + +Q   +     +N   + +   L N++++++A +++ +S+
Sbjct:  231 DPQRTKQAIAQLQQKILKLTEQIKIEQTARDDNVAEYLK--LANNADKQQSARIKQVFEKKNQKSAQTIQQLQRKLEHYHRKLREVEHNGIPR--QPKDVFRDMHQG---------LKDVGAKVTGGLSSFSQATHSAAGA---VVSKPREIASLLRNKF-GSADNIAALKDSLDETQGDEGVGPGASRNLGTGQLQSSPKYGSEDDCSSATSGSAGANSTPG-------APGGPPSSRVNTL-------------------------------DQAQASGFDV------VLHEIQELRENQSRLEESFDNLKAHYQRDYTMILEALQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDTQEALEACQTRISKMELQQQQQQVVQLEGLENATARTLLGKLINVLLAVMAVLLVFVST 604          
BLAST of SMED30035436 vs. Ensembl Medaka
Match: TMCC1 (transmembrane and coiled-coil domain family 1 [Source:NCBI gene;Acc:101171245])

HSP 1 Score: 53.5286 bits (127), Expect = 7.234e-7
Identity = 92/416 (22.12%), Postives = 159/416 (38.22%), Query Frame = 3
Query:  804 VSSG-DSKISRWNPTIVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDIL-----------SKTRTLDDTSRLVIPFDNAGSPKVISS-ACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE 2012
            VS G D   S       D + T+ ++  L + I    E+I  + + +D  V + +     N  D   S ++ + FE KN+ + +++++ Q +LE    K   V  NGIP   + +  V    ++            S G +       S  S +    +    S   +IAS++   F    D++   KD L           +  R+L  T+  ++      SPK  S   C+S  +GSA A S              P  SK N++     + QS                                 + +  L  EL E+R    R +   D L+     +  +  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E
Sbjct:   31 VSCGTDGSFSTAEDGTPDPQRTKQVIAQLQQKILKLTEQIKIEQTARDDNVAEYLK--LANNADKLQSTRIKQVFEKKNQKSAQTIQQLQRKLEHYHRKLREVEHNGIP---RHSKDVLRDMQQGLKDVGAKVTGFSEGVVDSVKGGLSSFSQATHTAAGAVVSKPWVIASRIRNKF-GSADNIPSLKDSLDDPSIEEGVTGAGGRSLGSTAHHLLS-----SPKYGSEDDCSSATSGSAGANSTTG-------APGGPPSSKGNTLE----RSQS---------------------------------SSLDMLLQELQELREGQARLEESLDGLKTHYQRDYTVAMQALQEERFRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKME 391          
BLAST of SMED30035436 vs. Ensembl Medaka
Match: TMCC1 (transmembrane and coiled-coil domain family 1 [Source:NCBI gene;Acc:101171245])

HSP 1 Score: 53.9138 bits (128), Expect = 7.809e-7
Identity = 101/458 (22.05%), Postives = 175/458 (38.21%), Query Frame = 3
Query:  681 PMIKSASIGVLFDPKTFGPNSETDKNAIATDKVDGVNDNIV-VSSG-DSKISRWNPTIVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDIL-----------SKTRTLDDTSRLVIPFDNAGSPKVISS-ACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE 2012
            P   S  +G+      +    ETD+  I   +V G+    + VS G D   S       D + T+ ++  L + I    E+I  + + +D  V + +     N  D   S ++ + FE KN+ + +++++ Q +LE    K   V  NGIP   + +  V    ++            S G +       S  S +    +    S   +IAS++   F    D++   KD L           +  R+L  T+  ++      SPK  S   C+S  +GSA A S              P  SK N++     + QS                                 + +  L  EL E+R    R +   D L+     +  +  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E
Sbjct:  199 PGYSSGDVGL---SSGYQSTEETDR--IDRLEVTGLGQTPLNVSCGTDGSFSTAEDGTPDPQRTKQVIAQLQQKILKLTEQIKIEQTARDDNVAEYLK--LANNADKLQSTRIKQVFEKKNQKSAQTIQQLQRKLEHYHRKLREVEHNGIP---RHSKDVLRDMQQGLKDVGAKVTGFSEGVVDSVKGGLSSFSQATHTAAGAVVSKPWVIASRIRNKF-GSADNIPSLKDSLDDPSIEEGVTGAGGRSLGSTAHHLLS-----SPKYGSEDDCSSATSGSAGANSTTG-------APGGPPSSKGNTLE----RSQS---------------------------------SSLDMLLQELQELREGQARLEESLDGLKTHYQRDYTVAMQALQEERFRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKME 596          
BLAST of SMED30035436 vs. Ensembl Medaka
Match: TMCC1 (transmembrane and coiled-coil domain family 1 [Source:NCBI gene;Acc:101171245])

HSP 1 Score: 53.5286 bits (127), Expect = 8.253e-7
Identity = 92/416 (22.12%), Postives = 159/416 (38.22%), Query Frame = 3
Query:  804 VSSG-DSKISRWNPTIVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDIL-----------SKTRTLDDTSRLVIPFDNAGSPKVISS-ACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE 2012
            VS G D   S       D + T+ ++  L + I    E+I  + + +D  V + +     N  D   S ++ + FE KN+ + +++++ Q +LE    K   V  NGIP   + +  V    ++            S G +       S  S +    +    S   +IAS++   F    D++   KD L           +  R+L  T+  ++      SPK  S   C+S  +GSA A S              P  SK N++     + QS                                 + +  L  EL E+R    R +   D L+     +  +  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E
Sbjct:   27 VSCGTDGSFSTAEDGTPDPQRTKQVIAQLQQKILKLTEQIKIEQTARDDNVAEYLK--LANNADKLQSTRIKQVFEKKNQKSAQTIQQLQRKLEHYHRKLREVEHNGIP---RHSKDVLRDMQQGLKDVGAKVTGFSEGVVDSVKGGLSSFSQATHTAAGAVVSKPWVIASRIRNKF-GSADNIPSLKDSLDDPSIEEGVTGAGGRSLGSTAHHLLS-----SPKYGSEDDCSSATSGSAGANSTTG-------APGGPPSSKGNTLE----RSQS---------------------------------SSLDMLLQELQELREGQARLEESLDGLKTHYQRDYTVAMQALQEERFRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKME 387          
BLAST of SMED30035436 vs. Ensembl Medaka
Match: TMCC1 (transmembrane and coiled-coil domain family 1 [Source:NCBI gene;Acc:101171245])

HSP 1 Score: 52.7582 bits (125), Expect = 1.427e-6
Identity = 92/416 (22.12%), Postives = 159/416 (38.22%), Query Frame = 3
Query:  804 VSSG-DSKISRWNPTIVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDIL-----------SKTRTLDDTSRLVIPFDNAGSPKVISS-ACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVE 2012
            VS G D   S       D + T+ ++  L + I    E+I  + + +D  V + +     N  D   S ++ + FE KN+ + +++++ Q +LE    K   V  NGIP   + +  V    ++            S G +       S  S +    +    S   +IAS++   F    D++   KD L           +  R+L  T+  ++      SPK  S   C+S  +GSA A S              P  SK N++     + QS                                 + +  L  EL E+R    R +   D L+     +  +  Q +Q    R +RLE  L+ L +  Q E    K +  ++EEK+ Y+     RD+Q+ +++C   +S +E
Sbjct:   29 VSCGTDGSFSTAEDGTPDPQRTKQVIAQLQQKILKLTEQIKIEQTARDDNVAEYLK--LANNADKLQSTRIKQVFEKKNQKSAQTIQQLQRKLEHYHRKLREVEHNGIP---RHSKDVLRDMQQGLKDVGAKVTGFSEGVVDSVKGGLSSFSQATHTAAGAVVSKPWVIASRIRNKF-GSADNIPSLKDSLDDPSIEEGVTGAGGRSLGSTAHHLLS-----SPKYGSEDDCSSATSGSAGANSTTG-------APGGPPSSKGNTLE----RSQS---------------------------------SSLDMLLQELQELREGQARLEESLDGLKTHYQRDYTVAMQALQEERFRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACQTRISKME 389          
BLAST of SMED30035436 vs. Planmine SMEST
Match: SMESG000022942.1 (SMESG000022942.1)

HSP 1 Score: 1389.02 bits (3594), Expect = 0.000e+0
Identity = 723/729 (99.18%), Postives = 724/729 (99.31%), Query Frame = 3
Query:  132 MSFSQKKKRSILPIAGGYIEEEVVLETQKPRTNKSLLDFKSPKLNRLKNFIKSPVQKSHNKYKQFQDNDDDNLSAENHSTIEQTAREESIDSKNTDFSTEESAANHESKDISQTSLLTAISIVPPENFPKSDFDSVSGRRSTFGEMSLNTNIVVSESPKSDEVXXXXXXXXXXXXXXXEVHQKPMIKSASIGVLFDPKTFGPNSETDKNAIATDKVDGVNDNIVVSSGDSKISRWNPTIVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLWHRLCLFLSDSGYLPRFLD 2318
            MSFSQKKKRSILPIAGGYIEEEVVLETQKPRTNKSLLDFKSPKLNRLKNFIKSPVQKSHNKYKQFQDNDDDNLSAENHSTIEQTAREESID KNTDFSTEESAANHESKDISQTSLLTAISIVPPENFPKSDFDSVSGRRSTFGEMSLNTNIVVSES KSDEVFDKNSKSKYSSFKNDEVHQKPMIKSASIGVLFDPKTFGPNSETDKNAIATDKVDGVNDNIVVSSGDSKISRWNPTIVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKAS+KLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVKSINKKNKNKKSIPEVKQSPG LSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSK RTLDDTSRLVIPFDNAGSPKVI SACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLWHRLCLFLSDSGYLPRFLD
Sbjct:    1 MSFSQKKKRSILPIAGGYIEEEVVLETQKPRTNKSLLDFKSPKLNRLKNFIKSPVQKSHNKYKQFQDNDDDNLSAENHSTIEQTAREESIDFKNTDFSTEESAANHESKDISQTSLLTAISIVPPENFPKSDFDSVSGRRSTFGEMSLNTNIVVSESTKSDEVFDKNSKSKYSSFKNDEVHQKPMIKSASIGVLFDPKTFGPNSETDKNAIATDKVDGVNDNIVVSSGDSKISRWNPTIVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASKKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVKSINKKNKNKKSIPEVKQSPGPLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKIRTLDDTSRLVIPFDNAGSPKVILSACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLWHRLCLFLSDSGYLPRFLD 729          
BLAST of SMED30035436 vs. Planmine SMEST
Match: SMESG000022942.1 (SMESG000022942.1)

HSP 1 Score: 1360.9 bits (3521), Expect = 0.000e+0
Identity = 722/778 (92.80%), Postives = 724/778 (93.06%), Query Frame = 3
Query:  132 MSFSQKKKRSILPIAGGYIEEEVVLETQKPRTNKSLLDFKSPKLNRLKNFIKSPVQKSHNKYKQFQDNDDDNLSAENHSTIE-------------------------------------------------QTAREESIDSKNTDFSTEESAANHESKDISQTSLLTAISIVPPENFPKSDFDSVSGRRSTFGEMSLNTNIVVSESPKSDEVXXXXXXXXXXXXXXXEVHQKPMIKSASIGVLFDPKTFGPNSETDKNAIATDKVDGVNDNIVVSSGDSKISRWNPTIVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVXXXXXXXXXXXXXPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLWHRLCLFLSDSGYLPRFLD 2318
            MSFSQKKKRSILPIAGGYIEEEVVLETQKPRTNKSLLDFKSPKLNRLKNFIKSPVQKSHNKYKQFQDNDDDNLSAENHSTIE                                                 +TAREESID KNTDFSTEESAANHESKDISQTSLLTAISIVPPENFPKSDFDSVSGRRSTFGEMSLNTNIVVSES KSDEVFDKNSKSKYSSFKNDEVHQKPMIKSASIGVLFDPKTFGPNSETDKNAIATDKVDGVNDNIVVSSGDSKISRWNPTIVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKAS+KLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVKSINKKNKNKKSIPEVKQSPG LSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSK RTLDDTSRLVIPFDNAGSPKVI SACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLWHRLCLFLSDSGYLPRFLD
Sbjct:    1 MSFSQKKKRSILPIAGGYIEEEVVLETQKPRTNKSLLDFKSPKLNRLKNFIKSPVQKSHNKYKQFQDNDDDNLSAENHSTIEHRNHGNRYLAVPYYHCQCNGMKMSESENISIKSFPIEEGLPISENYINYRTAREESIDFKNTDFSTEESAANHESKDISQTSLLTAISIVPPENFPKSDFDSVSGRRSTFGEMSLNTNIVVSESTKSDEVFDKNSKSKYSSFKNDEVHQKPMIKSASIGVLFDPKTFGPNSETDKNAIATDKVDGVNDNIVVSSGDSKISRWNPTIVDIETTEIMLQSLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASKKLCKEFEVKNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVKSINKKNKNKKSIPEVKQSPGPLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSFIHKHDDVTKSKDILSKIRTLDDTSRLVIPFDNAGSPKVILSACNSRKAGSASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQGLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLDMNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEKLDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITDHLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCALVIASVKLSLWHRLCLFLSDSGYLPRFLD 778          
The following BLAST results are available for this feature:
BLAST of SMED30035436 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMCC11.331e-921.80transmembrane and coiled-coil domain family 1 [Sou... [more]
TMCC11.416e-921.62transmembrane and coiled-coil domain family 1 [Sou... [more]
TMCC11.416e-921.62transmembrane and coiled-coil domain family 1 [Sou... [more]
TMCC31.296e-620.73transmembrane and coiled-coil domain family 3 [Sou... [more]
TMCC11.387e-622.86transmembrane and coiled-coil domain family 1 [Sou... [more]
back to top
BLAST of SMED30035436 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035436 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035436 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tmcc1b1.202e-820.63transmembrane and coiled-coil domain family 1b [So... [more]
tmcc1b1.202e-820.63transmembrane and coiled-coil domain family 1b [So... [more]
tmcc1b1.202e-820.63transmembrane and coiled-coil domain family 1b [So... [more]
tmcc25.432e-622.39transmembrane and coiled-coil domain family 2 [Sou... [more]
back to top
BLAST of SMED30035436 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmcc31.963e-723.81transmembrane and coiled-coil domain family 3 [Sou... [more]
back to top
BLAST of SMED30035436 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmcc12.597e-921.60transmembrane and coiled coil domains 1 [Source:MG... [more]
Tmcc12.898e-921.60transmembrane and coiled coil domains 1 [Source:MG... [more]
Tmcc13.115e-921.60transmembrane and coiled coil domains 1 [Source:MG... [more]
Tmcc13.341e-921.60transmembrane and coiled coil domains 1 [Source:MG... [more]
Tmcc32.403e-620.92transmembrane and coiled coil domains 3 [Source:MG... [more]
back to top
BLAST of SMED30035436 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|O94876|TMCC1_HUMAN6.390e-921.80Transmembrane and coiled-coil domains protein 1 OS... [more]
sp|Q69ZZ6|TMCC1_MOUSE2.027e-821.60Transmembrane and coiled-coil domains protein 1 OS... [more]
sp|Q9ULS5|TMCC3_HUMAN6.223e-620.73Transmembrane and coiled-coil domain protein 3 OS=... [more]
back to top
BLAST of SMED30035436 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YRS95.232e-1831.63Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A5K3ENP61.316e-1729.91Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3EP341.696e-1729.91Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3EQH69.051e-1732.35Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4Z2D4A11.049e-1628.64DNA methylase N 6 adenine specific isoform 2 OS=Sc... [more]
back to top
BLAST of SMED30035436 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmcc1b9.787e-1020.59transmembrane and coiled-coil domains protein 1-li... [more]
TMCC15.573e-720.60transmembrane and coiled-coil domain family 1 [Sou... [more]
tmcc36.190e-724.12transmembrane and coiled-coil domain family 3 [Sou... [more]
tmcc36.694e-724.12transmembrane and coiled-coil domain family 3 [Sou... [more]
tmcc37.227e-722.47transmembrane and coiled-coil domain family 3 [Sou... [more]
back to top
BLAST of SMED30035436 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmcc21.543e-722.63transmembrane and coiled-coil domain family 2 [Sou... [more]
back to top
BLAST of SMED30035436 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035436 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035436 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmcc1b1.329e-721.38transmembrane and coiled-coil domains protein 1 [S... [more]
TMCC17.234e-722.12transmembrane and coiled-coil domain family 1 [Sou... [more]
TMCC17.809e-722.05transmembrane and coiled-coil domain family 1 [Sou... [more]
TMCC18.253e-722.12transmembrane and coiled-coil domain family 1 [Sou... [more]
TMCC11.427e-622.12transmembrane and coiled-coil domain family 1 [Sou... [more]
back to top
BLAST of SMED30035436 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000022942.10.000e+099.18SMESG000022942.1[more]
SMESG000022942.10.000e+092.80SMESG000022942.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035436 ID=SMED30035436|Name=SMED30035436|organism=Schmidtea mediterranea sexual|type=transcript|length=2644bp
TTAACTAAATCTTTACTTAATAGTATTTTTTAAATAATTTATTTTTATTT
CGCAATTTCGCTTAATCTTTAGTAGAAAATAAGTCGTTTTCTGTAAATAA
TTATTGATTCGTGTATCAGTTTATTGAGCATATGTCATTTTCTCAAAAAA
AGAAACGTTCAATTCTTCCAATAGCTGGGGGGTACATAGAAGAAGAAGTA
GTTTTAGAAACTCAGAAGCCGAGAACTAATAAATCATTGTTGGATTTCAA
ATCACCAAAGTTGAACCGTTTGAAAAACTTTATAAAATCTCCTGTACAAA
AATCACATAACAAATACAAACAGTTTCAAGATAATGACGATGACAATTTA
TCAGCCGAAAATCATTCTACAATTGAACAGACTGCGAGAGAGGAATCGAT
TGATTCCAAAAATACTGACTTTTCCACAGAAGAATCCGCAGCTAATCATG
AAAGTAAAGATATTTCACAAACATCTTTATTAACCGCAATCTCAATAGTA
CCTCCTGAAAATTTTCCAAAATCCGACTTTGATTCAGTAAGTGGTCGAAG
ATCAACATTTGGTGAAATGAGTTTAAATACTAATATTGTCGTTTCGGAAA
GCCCAAAATCCGATGAAGTATTTGATAAGAATTCTAAATCAAAATACAGT
TCATTTAAAAATGATGAAGTACATCAAAAACCTATGATCAAATCTGCTTC
GATTGGAGTACTTTTCGATCCAAAGACATTTGGTCCAAATTCGGAAACAG
ATAAAAATGCAATCGCAACTGATAAAGTTGACGGAGTTAATGATAATATT
GTCGTTTCGTCTGGCGATAGTAAAATATCTCGATGGAATCCAACAATTGT
CGATATTGAAACCACAGAAATCATGCTTCAATCTCTGGATGAACATATCA
AAAATGCAAAAGAGAAAATTCTAAAAGATCTCTCAGTCAAAGATCAAATG
GTCGATAAACTGATTACAAATTTTTCCACCAACACTCCAGATAACAAAGC
TTCAAGAAAGCTCTGTAAAGAATTTGAAGTGAAAAATAAAAACGCCGAAA
AATCTCTCGAAAAGTCTCAAATGGAATTAGAACAATTAGAATACAAGAGA
CTATTAGTGAGTCAAAATGGTATTCCGTGGGGAGTTAAACCAGCTGATCA
TGTCAAAAGCATTAATAAGAAAAATAAAAATAAAAAATCCATTCCAGAAG
TCAAACAGAGTCCAGGGTCTCTTTCAAAATTTATCAAAGATTATTCTCAA
AAATCAGCAAGTGCCGAAAATATTAGTAGACTTGCTAATTCCGATAATAA
TTTGATAGCAAGCCAATTAAACAAATCATTTATTCATAAACATGATGATG
TGACAAAATCCAAAGATATTTTATCAAAAACAAGGACATTAGACGACACA
TCACGACTCGTAATTCCTTTCGATAATGCAGGCTCACCGAAAGTAATTTC
ATCAGCTTGCAACTCAAGGAAAGCAGGATCGGCTAGTGCAACTAGTGCTA
TATCGCTGGATCAACAATATGGTGAGAAAGCTAGCATTCCAAAGAAAAGT
AAATCCAACTCAATGTCTAGCGGTACAGGGAAAGATCAATCGCATGAACA
TGCTGATATTCACGAATCCCCAAAATTTCAAGGTCTCATTGATGAAGGTA
AAAATGAGGATAATTCATATTCACGTCTGTTTTCAATTCAAAATGACATT
AGTTCTCTTAAAAGTGAATTGCATGAAGTTCGTTCGGATTTCCATCGGTT
TCAGTGTGAAGCAGACAATTTAAGATTGGACATGAATACGAATTCAGATT
TGAATTCTCAGAAAATGCAAAATTCTATTGAAAGAGTAGACAGATTAGAG
AGAATGTTAGACTTGCTACGACAGCAGTGCCAAATTGAATTTTGTACATG
GAAAGATGACTTTAGAAATTTGGAAGAGAAGCTTGATTATAGGCTAACCA
CGACTCGTAGGGATCTCCAGGATAACATTGATTCCTGCAATAATAGTTTA
AGTCTGGTTGAGAAGAGAACAGAACAGCTCCCTTTCATTTCTAATAGAGC
CGGGAAAAATGATGTGAAAATAATTACCGATCATTTGTGTAATTTAGTCG
TTTCCTTAATTGCGTTCATTATGCTCTTGCTGTCCTCTGGATTTCACCTG
TTAATCCGAGTGCTAAATATCGGGGCAACAATTTGCCGTCACAGAAACAT
GATCTTGCCCCCTGTGATGATAACGTGCGCCTTGGTTATTGCCTCAGTCA
AACTGTCTCTCTGGCATCGATTGTGCCTCTTTCTCTCAGACTCGGGATAT
CTGCCGAGGTTCCTCGACGGATCCTGACGAGGATCAGTTTAACAGCGCCG
ATCATGATTAATATATATTGATACTTTATAATTGCCATTGTAATTATTTT
TGTATAAATTTATTTGTTCCTTTCAAGATGTTATCAATTATATTTCGATT
TGGTTTGATTTTATCGGAAATCTGGTTTTTGTTGTTTTATTGATTTATTA
AACTTTAGCAGCACATTTGATAATCAGGATTTATGAGCAATTATTATTTA
TTGATTCATTTTCAATTACAATTACTTATCAGGTCAATTAATCAATTACT
AATATCGATTATTTGTGTCGGGTTTTATTTTGGTTTTATGCTAG
back to top

protein sequence of SMED30035436-orf-1

>SMED30035436-orf-1 ID=SMED30035436-orf-1|Name=SMED30035436-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=732bp
MSFSQKKKRSILPIAGGYIEEEVVLETQKPRTNKSLLDFKSPKLNRLKNF
IKSPVQKSHNKYKQFQDNDDDNLSAENHSTIEQTAREESIDSKNTDFSTE
ESAANHESKDISQTSLLTAISIVPPENFPKSDFDSVSGRRSTFGEMSLNT
NIVVSESPKSDEVFDKNSKSKYSSFKNDEVHQKPMIKSASIGVLFDPKTF
GPNSETDKNAIATDKVDGVNDNIVVSSGDSKISRWNPTIVDIETTEIMLQ
SLDEHIKNAKEKILKDLSVKDQMVDKLITNFSTNTPDNKASRKLCKEFEV
KNKNAEKSLEKSQMELEQLEYKRLLVSQNGIPWGVKPADHVKSINKKNKN
KKSIPEVKQSPGSLSKFIKDYSQKSASAENISRLANSDNNLIASQLNKSF
IHKHDDVTKSKDILSKTRTLDDTSRLVIPFDNAGSPKVISSACNSRKAGS
ASATSAISLDQQYGEKASIPKKSKSNSMSSGTGKDQSHEHADIHESPKFQ
GLIDEGKNEDNSYSRLFSIQNDISSLKSELHEVRSDFHRFQCEADNLRLD
MNTNSDLNSQKMQNSIERVDRLERMLDLLRQQCQIEFCTWKDDFRNLEEK
LDYRLTTTRRDLQDNIDSCNNSLSLVEKRTEQLPFISNRAGKNDVKIITD
HLCNLVVSLIAFIMLLLSSGFHLLIRVLNIGATICRHRNMILPPVMITCA
LVIASVKLSLWHRLCLFLSDSGYLPRFLDGS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR019394TEX28/TMCC
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0032259methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 562..582
NoneNo IPR availableCOILSCoilCoilcoord: 242..262
NoneNo IPR availableCOILSCoilCoilcoord: 609..629
NoneNo IPR availableCOILSCoilCoilcoord: 295..322
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 460..484
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 460..500
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 485..500
NoneNo IPR availablePANTHERPTHR17613:SF14DEMENTIN, ISOFORM Hcoord: 243..674
NoneNo IPR availableTMHMMTMhelixcoord: 690..712
NoneNo IPR availableTMHMMTMhelixcoord: 656..678
IPR019394Testis-specific protein TEX28/transmembrane and coiled-coil domains proteinPFAMPF10267Tmemb_cc2coord: 248..703
e-value: 5.2E-21
score: 75.2
IPR019394Testis-specific protein TEX28/transmembrane and coiled-coil domains proteinPANTHERPTHR17613CEREBRAL PROTEIN-11-RELATEDcoord: 243..674