SMED30035435

Overview
NameSMED30035435
Smed IDSMED30035435
Length (bp)1867
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30035435 (SMED30035435) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30035435 (SMED30035435) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30035435 (SMED30035435) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30035435 (SMED30035435) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035435

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30035435h1SMcG0000797 dd_Smed_v4_5757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035435h1SMcG0000797 dd_Smed_v4_5757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035435h1SMcG0000797 Contig38007newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035435h1SMcG0000797 Contig38007uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30035435h1SMcG0000797 dd_Smed_v4_5757_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30035435h1SMcG0000797 dd_Smed_v4_5757_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30035435 vs. TrEMBL
Match: A0A5J4NUP0 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0004351 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 6.880e-7
Identity = 60/253 (23.72%), Postives = 104/253 (41.11%), Query Frame = 3
Query:  387 LPNAKYKLTIDIVKTIKGSLGEWKSPILMAGEFSTFRDSNNF--CQFQSQANAEQVYFLEAVSIKNGEFKVLFNPEIYNDLQLDNIYTSICPGCGKTPSVTVKDIS-KSVDFLVAECMSDGYPAPVTKWKIQKKYAATI-----IETIKGGVRLIQPINNSTNEVQV------CEAVNVIGSASYSIVVKPVIFKTQVVK-------IKESQIIPCSTNDEKFCNGKGKCYEDKSEKNSKFCRCNKGYMGPNC 1082
            L + K+  T+ +    K  + E +  I +   F+   DS++   C      N++ ++FL      +  + V +NP  Y +    NI    C  C       + D+  K    L   C + G P+P   W    K    +     IE IK     ++ +   +N +++      C A N +G AS        +F  Q+ +       + +++++PCS  D  +C   G+CY  KS++N   CRC   Y G  C
Sbjct:  135 LADQKFNATVLVTNVYKSFVHE-QDQITVGSFFTPTVDSHDGPGCLDAFYRNSKYIFFLRRNMNADNFYDVTYNPHPYTEELDQNIQAKQCVNCFAPKIQPLNDLMLKPGSKLAVTCSASGKPSPELVWVKNGKSLNLVDKSISIEMIKVSEDNVESVLEISNLIRIDSGEYKCLATNPLGKASE-------LFNLQITQPEKSGQLLMDTELVPCSDEDRDYCLNGGQCYMLKSDRNVLQCRCPHQYFGDRC 379          
BLAST of SMED30035435 vs. TrEMBL
Match: A0A5K4EN02 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 6.061e-6
Identity = 57/217 (26.27%), Postives = 79/217 (36.41%), Query Frame = 3
Query:  636 IYTSICPGCGKTPSVTVKDISKSV----DFLVAECMSDGYPAPVTKW-----KIQKKYAATIIETIK---GGVRLIQPINN----STNEVQVCEAVNVIGSASYSIVVKPVIFKTQVVKIKESQIIPCSTNDEKFCNGKGKCYEDKSEKNSKFCRCNKGYMGPNCASVSRSVSNNLVERLKNMDKIFCNNQGISLKNYTTQTIYCECYLNFFGNHCE 1238
            IY   C  C K    T++ I   V      L   C++ G P P   W      I        +ET +   G V  I  INN     T E   C A N +G A     +K         K+   +++PCS  D+ +C   G+CY  K+E+ S  CRC   Y G  C                               ++ T  +Y  CY  +FG+ CE
Sbjct:  193 IYGLYCHNCVKP---TIESIPNQVLEYGHSLTTSCLATGTPTPTIMWIRDGKSINLADKGLTVETFERSPGYVESILEINNLILIDTGEYW-CYAENALGLAKEKFTLKVQPNNRTEEKLMVDELVPCSDEDKDYCLNGGQCYTYKNERVSFQCRCLDHYFGDRC-------------------------------HFHTDGLYGNCYTPYFGSKCE 374          
BLAST of SMED30035435 vs. TrEMBL
Match: A0A4S2L7F9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009321 PE=4 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 9.649e-6
Identity = 49/198 (24.75%), Postives = 89/198 (44.95%), Query Frame = 3
Query:  534 NAEQVYFLEAVSIKNGEFKVLFNPEIYNDLQLDNIYTSICPGCGKTPSVTVKDIS-KSVDFLVAECMSDGYPAPVTKWKIQKKYAATI-----IETIKGGVRLIQPINNSTNEVQV------CEAVNVIGSASYSI---VVKPVIFKTQVVKIKESQIIPCSTNDEKFCNGKGKCYEDKSEKNSKFCRCNKGYMGPNC 1082
            N++ ++FL+ V    G + +  NP+++ +    +IY   C  C       + ++  K  + L   C++ G P P   W    K    +     +E IK      + I   ++ +++      C A N +G AS S    V +P   K + V + ++++I C      +C   G+CY  KS++N   CRC++ Y G  C
Sbjct:  168 NSKYMFFLKKVGTPAGYYAMTHNPQLFTEKLAYSIYARRCSSCYAPKIEPISNLEMKPGEQLTITCVAMGKPLPEVTWIKNGKSLNLVDKSVRVEEIKISDEQTESILEISSLIRIDSGEYKCLAHNSLGEASVSFSLQVSQPD--KPEQVSM-DTELIECPEEHRDYCLNGGQCYMLKSDRNVLQCRCSQQYFGDRC 362          
BLAST of SMED30035435 vs. Planmine SMEST
Match: SMESG000040472.1 (SMESG000040472.1)

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 472/473 (99.79%), Postives = 472/473 (99.79%), Query Frame = 3
Query:  225 MNIITLFLYQCCFAFYQIKAGNLCDKLNDFGDNIQTKAILAPXXXXXXXXXXXDLPNAKYKLTIDIVKTIKGSLGEWKSPILMAGEFSTFRDSNNFCQFQSQANAEQVYFLEAVSIKNGEFKVLFNPEIYNDLQLDNIYTSICPGCGKTPSVTVKDISKSVDFLVAECMSDGYPAPVTKWKIQKKYAATIIETIKGGVRLIQPINNSTNEVQVCEAVNVIGSASYSIVVKPVIFKTQVVKIKESQIIPCSTNDEKFCNGKGKCYEDKSEKNSKFCRCNKGYMGPNCASVSRSVSNNLVERLKNMDKIFCNNQGISLKNYTTQTIYCECYLNFFGNHCENRYYMKAPVNEGLKEFITEQNSKLAVKYXXXXXXXXXXXXXXXXXXXXXXWRFYLTKQRKRIIQIKGDKRSENETKISNSDNIIMPIPPNEENSLLLTNIKPKNFQNNDNSIQDKEIRLKNPNLISGNGIYDNTY 1643
            MNIITLFLYQCCFAFYQIKAGNLCDKLNDFGDNIQTKAILAPIIIIGKGGMKIDLPNAKYKLTIDIVKTIKGSLGEWKSPILMAGEFSTFRDSNN CQFQSQANAEQVYFLEAVSIKNGEFKVLFNPEIYNDLQLDNIYTSICPGCGKTPSVTVKDISKSVDFLVAECMSDGYPAPVTKWKIQKKYAATIIETIKGGVRLIQPINNSTNEVQVCEAVNVIGSASYSIVVKPVIFKTQVVKIKESQIIPCSTNDEKFCNGKGKCYEDKSEKNSKFCRCNKGYMGPNCASVSRSVSNNLVERLKNMDKIFCNNQGISLKNYTTQTIYCECYLNFFGNHCENRYYMKAPVNEGLKEFITEQNSKLAVKYIIIGCLIVLAGCILIVIVIVCLWRFYLTKQRKRIIQIKGDKRSENETKISNSDNIIMPIPPNEENSLLLTNIKPKNFQNNDNSIQDKEIRLKNPNLISGNGIYDNTY
Sbjct:    1 MNIITLFLYQCCFAFYQIKAGNLCDKLNDFGDNIQTKAILAPIIIIGKGGMKIDLPNAKYKLTIDIVKTIKGSLGEWKSPILMAGEFSTFRDSNNSCQFQSQANAEQVYFLEAVSIKNGEFKVLFNPEIYNDLQLDNIYTSICPGCGKTPSVTVKDISKSVDFLVAECMSDGYPAPVTKWKIQKKYAATIIETIKGGVRLIQPINNSTNEVQVCEAVNVIGSASYSIVVKPVIFKTQVVKIKESQIIPCSTNDEKFCNGKGKCYEDKSEKNSKFCRCNKGYMGPNCASVSRSVSNNLVERLKNMDKIFCNNQGISLKNYTTQTIYCECYLNFFGNHCENRYYMKAPVNEGLKEFITEQNSKLAVKYIIIGCLIVLAGCILIVIVIVCLWRFYLTKQRKRIIQIKGDKRSENETKISNSDNIIMPIPPNEENSLLLTNIKPKNFQNNDNSIQDKEIRLKNPNLISGNGIYDNTY 473          
BLAST of SMED30035435 vs. Planmine SMEST
Match: SMESG000040472.1 (SMESG000040472.1)

HSP 1 Score: 855.899 bits (2210), Expect = 0.000e+0
Identity = 472/525 (89.90%), Postives = 472/525 (89.90%), Query Frame = 3
Query:  225 MNIITLFLYQCCFAFYQIKAGNLCDKLNDFGDNIQTKAILAPXXXXXXXXXXXDLPNAKYKLTIDIVKTIKGSLGEWKSPILMAGEFSTFRDSNNFCQFQSQANAEQVYFLEAVSIKNGEFKVLFNPEIYNDLQLDNIYTSICPGCGKTPSVTVKDISKSVDFLVAECMSDGYPAPVTKWKIQKKYAATIIETIKGGVRLIQPINNSTNEVQVCEAVNVIGSASYSIVVKPVIFKTQVVKIKESQIIPCSTNDEKFCNGKGKCYEDKSEKNSKFCRCNKGYMGPNCASVSRSVSNNLVERLKNMDKIFCNNQGISLKNYTTQTIY----------------------------------------------------CECYLNFFGNHCENRYYMKAPVNEGLKEFITEQNSKLAVKYXXXXXXXXXXXXXXXXXXXXXXWRFYLTKQRKRIIQIKGDKRSENETKISNSDNIIMPIPPNEENSLLLTNIKPKNFQNNDNSIQDKEIRLKNPNLISGNGIYDNTY 1643
            MNIITLFLYQCCFAFYQIKAGNLCDKLNDFGDNIQTKAILAPIIIIGKGGMKIDLPNAKYKLTIDIVKTIKGSLGEWKSPILMAGEFSTFRDSNN CQFQSQANAEQVYFLEAVSIKNGEFKVLFNPEIYNDLQLDNIYTSICPGCGKTPSVTVKDISKSVDFLVAECMSDGYPAPVTKWKIQKKYAATIIETIKGGVRLIQPINNSTNEVQVCEAVNVIGSASYSIVVKPVIFKTQVVKIKESQIIPCSTNDEKFCNGKGKCYEDKSEKNSKFCRCNKGYMGPNCASVSRSVSNNLVERLKNMDKIFCNNQGISLKNYTTQTIY                                                    CECYLNFFGNHCENRYYMKAPVNEGLKEFITEQNSKLAVKYIIIGCLIVLAGCILIVIVIVCLWRFYLTKQRKRIIQIKGDKRSENETKISNSDNIIMPIPPNEENSLLLTNIKPKNFQNNDNSIQDKEIRLKNPNLISGNGIYDNTY
Sbjct:    1 MNIITLFLYQCCFAFYQIKAGNLCDKLNDFGDNIQTKAILAPIIIIGKGGMKIDLPNAKYKLTIDIVKTIKGSLGEWKSPILMAGEFSTFRDSNNSCQFQSQANAEQVYFLEAVSIKNGEFKVLFNPEIYNDLQLDNIYTSICPGCGKTPSVTVKDISKSVDFLVAECMSDGYPAPVTKWKIQKKYAATIIETIKGGVRLIQPINNSTNEVQVCEAVNVIGSASYSIVVKPVIFKTQVVKIKESQIIPCSTNDEKFCNGKGKCYEDKSEKNSKFCRCNKGYMGPNCASVSRSVSNNLVERLKNMDKIFCNNQGISLKNYTTQTIYCECYLNFFGDNCEKKFSFSVSKNLVERLKHLDKKYCNNQGISLKNYTTQTIFCECYLNFFGNHCENRYYMKAPVNEGLKEFITEQNSKLAVKYIIIGCLIVLAGCILIVIVIVCLWRFYLTKQRKRIIQIKGDKRSENETKISNSDNIIMPIPPNEENSLLLTNIKPKNFQNNDNSIQDKEIRLKNPNLISGNGIYDNTY 525          
The following BLAST results are available for this feature:
BLAST of SMED30035435 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035435 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035435 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035435 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035435 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035435 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035435 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035435 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
A0A5J4NUP06.880e-723.72Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A5K4EN026.061e-626.27Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4S2L7F99.649e-624.75Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of SMED30035435 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035435 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035435 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035435 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035435 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035435 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000040472.10.000e+099.79SMESG000040472.1[more]
SMESG000040472.10.000e+089.90SMESG000040472.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035435 ID=SMED30035435|Name=SMED30035435|organism=Schmidtea mediterranea sexual|type=transcript|length=1867bp
TTTAATCACAATGGCTATCATTCATGGTATATCAGTAATTTTGTATATTC
TATTCTATTGACACAGAACCGACTACAATTTTGTTCTTTAAATATTCTGT
GCTATGGAGCACATTGAAGTACCTATAACGCTGTCCAGTGTTCAGTGAAC
CGTATGGTGAATCACATTAATAGTTGATCATAAAAAGATTTTTTACAATT
TTTCTTTGTCAGAATTCAAAATTCATGAATATTATCACACTGTTTCTTTA
TCAATGTTGTTTTGCATTTTATCAAATCAAAGCGGGAAATTTATGTGATA
AATTAAACGATTTCGGTGACAACATTCAAACAAAAGCGATTTTGGCACCT
ATCATAATAATCGGGAAAGGAGGAATGAAAATCGATTTGCCTAATGCCAA
ATATAAGTTAACAATTGACATTGTCAAAACTATCAAAGGTTCTTTGGGCG
AATGGAAATCTCCAATTTTGATGGCAGGAGAATTCTCGACCTTTAGAGAT
TCTAACAATTTTTGCCAATTTCAAAGTCAGGCAAATGCTGAACAAGTTTA
TTTTTTAGAAGCTGTATCTATAAAGAATGGTGAATTCAAAGTATTATTCA
ATCCAGAAATATATAATGATCTGCAGTTGGATAATATTTATACATCAATT
TGTCCAGGATGTGGCAAGACGCCATCTGTAACTGTGAAAGATATAAGTAA
GTCCGTAGATTTTCTCGTTGCAGAATGCATGAGCGACGGATATCCGGCTC
CTGTAACTAAATGGAAGATTCAAAAAAAATATGCAGCCACAATTATTGAA
ACTATCAAAGGAGGAGTGAGACTTATTCAACCGATAAATAATTCAACTAA
TGAAGTTCAAGTGTGTGAAGCAGTTAATGTTATTGGTTCCGCTTCCTATT
CCATTGTTGTTAAACCGGTTATTTTCAAAACACAAGTGGTAAAAATTAAA
GAATCACAGATAATTCCGTGTTCTACAAATGATGAAAAGTTTTGCAATGG
CAAAGGAAAATGCTATGAAGACAAATCAGAAAAAAATTCTAAATTTTGCC
GGTGTAATAAAGGGTATATGGGACCGAATTGTGCGTCGGTTTCCCGGTCA
GTTTCAAATAATTTAGTTGAAAGATTGAAAAATATGGATAAAATTTTTTG
CAATAATCAAGGAATATCATTAAAAAATTACACAACTCAAACGATATATT
GCGAATGTTATTTGAACTTTTTTGGTAATCATTGTGAAAACAGATATTAC
ATGAAAGCTCCAGTCAATGAAGGCTTAAAAGAATTTATAACTGAACAGAA
CTCAAAATTAGCAGTAAAATATATAATAATTGGATGTCTAATTGTTCTGG
CAGGCTGCATTTTAATTGTAATTGTCATAGTTTGCCTGTGGAGATTTTAT
TTAACAAAACAACGCAAAAGAATCATTCAGATAAAAGGCGATAAAAGGTC
AGAGAATGAAACAAAGATTTCAAATTCTGACAATATTATAATGCCAATAC
CGCCAAATGAGGAAAATAGTCTTTTACTAACTAACATAAAACCGAAAAAT
TTCCAAAATAATGACAATTCAATACAAGATAAGGAAATTCGCCTCAAAAA
TCCTAATCTCATTTCTGGAAATGGGATTTATGATAATACTTACTAATCAT
GATTGCAGGTATCCCCATACTCCTCCCAGTGGTTATCATACTTACTTAAT
ACGTTACTGTTATTTTTGTGGCTTGATATTCTATCCAAATATCATACTTT
AATTGAATTTGTATCGTTTTCATTTATTTGAATTTAATACAATTAATATG
ATATTCCATCAGTAAACAATGGAAATTAAATTTAATTATTTTTAATACTA
TGTTTTAATGAGTAGCG
back to top

protein sequence of SMED30035435-orf-1

>SMED30035435-orf-1 ID=SMED30035435-orf-1|Name=SMED30035435-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=474bp
MNIITLFLYQCCFAFYQIKAGNLCDKLNDFGDNIQTKAILAPIIIIGKGG
MKIDLPNAKYKLTIDIVKTIKGSLGEWKSPILMAGEFSTFRDSNNFCQFQ
SQANAEQVYFLEAVSIKNGEFKVLFNPEIYNDLQLDNIYTSICPGCGKTP
SVTVKDISKSVDFLVAECMSDGYPAPVTKWKIQKKYAATIIETIKGGVRL
IQPINNSTNEVQVCEAVNVIGSASYSIVVKPVIFKTQVVKIKESQIIPCS
TNDEKFCNGKGKCYEDKSEKNSKFCRCNKGYMGPNCASVSRSVSNNLVER
LKNMDKIFCNNQGISLKNYTTQTIYCECYLNFFGNHCENRYYMKAPVNEG
LKEFITEQNSKLAVKYIIIGCLIVLAGCILIVIVIVCLWRFYLTKQRKRI
IQIKGDKRSENETKISNSDNIIMPIPPNEENSLLLTNIKPKNFQNNDNSI
QDKEIRLKNPNLISGNGIYDNTY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR013032EGF-like_CS
IPR000742EGF-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 243..292
e-value: 4.0E-6
score: 28.5
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.452
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 245..289
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 304..342
NoneNo IPR availableTMHMMTMhelixcoord: 366..388
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 275..286
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 275..286
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 245..287
score: 12.764