NLK-1

Overview
NameNLK-1 (AFD29625.1)
Smed IDSMED30035424
Length (bp)2307
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NLK-1 (SMED30035424) t-SNE clustered cells

Violin plots show distribution of expression levels for NLK-1 (SMED30035424) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NLK-1 (SMED30035424) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NLK-1 (SMED30035424) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035424

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30035424SMESG000023289.1 SMED30035424smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30035424SMESG000023289.1 SmedASXL_005509SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035424SMESG000023289.1 SmedASXL_005509SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30035424SMESG000023289.1 SMESG000023149.1 dd_Smed_v4_4172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035424SMESG000023289.1 SMESG000023149.1 dd_Smed_v4_4172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035424SMESG000023289.1 SMESG000023149.1 dd_Smed_v4_4172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035424SMESG000023289.1 SMESG000023149.1 dd_Smed_v4_4172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035424SMESG000023289.1 SMESG000023149.1 dd_Smed_v4_4172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035424SMESG000023289.1 SMESG000023149.1 dd_Smed_v4_4172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035424SMESG000023289.1 SMESG000023149.1 dd_Smed_v4_4172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035424SMESG000023289.1 Contig18138newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035424SMESG000023289.1 Contig18138uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
sigma neoblastSMED30035424SMESG000023289.1 JQ425157.1smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30035424SMESG000023289.1 JQ425157.1smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035424SMESG000023289.1 SMESG000038292.1 SMESG000024597.1 Contig49304newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30035424SMESG000023289.1 SMESG000038292.1 SMESG000024597.1 Contig49304uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30035424SMESG000023289.1 SMED_08795_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035424SMESG000023289.1 SMED_08795_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035424SMESG000023289.1 SMED_08795_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035424SMESG000023289.1 SMED_08795_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035424SMESG000023289.1 SmWIOct06_024248GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035424SMESG000023289.1 SMED30035424smed_20140614PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30035424 SMED_17787_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035424 SMED_17787_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NLK-1 vs. Ensembl Human
Match: NLK (nemo like kinase [Source:HGNC Symbol;Acc:HGNC:29858])

HSP 1 Score: 414.846 bits (1065), Expect = 3.916e-137
Identity = 201/392 (51.28%), Postives = 276/392 (70.41%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDPTN 1739
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y+ A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   A+ ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC              R +  D EP+       T + + + + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P +
Sbjct:   89 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTG--------RVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPS 470          
BLAST of NLK-1 vs. Ensembl Human
Match: NLK (nemo like kinase [Source:HGNC Symbol;Acc:HGNC:29858])

HSP 1 Score: 416.772 bits (1070), Expect = 4.875e-137
Identity = 201/390 (51.54%), Postives = 275/390 (70.51%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y+ A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   A+ ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC              R +  D EP+       T + + + + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:  141 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTG--------RVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMP 520          
BLAST of NLK-1 vs. Ensembl Human
Match: MAPK3 (mitogen-activated protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:6877])

HSP 1 Score: 236.113 bits (601), Expect = 2.536e-70
Identity = 130/288 (45.14%), Postives = 187/288 (64.93%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKR--NISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDL-CHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLD 1427
            +G GA+G+V S +D   + + A+K+I    H T   +R  RE+ IL   +HEN+I + DI+++       ++YI+ D M+TDL+K++ S Q LS DH+  FLYQILRG+KY+HSA+++HRD+KP N+L+N+ C LKICDFGLARI D    +   LT+ V T++YRAPE+++ S  Y  ++D+WS+GC  AE+L  R +F  K  L+QL+ IL I+G+P   DL C  +  AR Y+ S   K       AK       +AL LLD ML FNP+ RI+ EEAL+H YL+
Sbjct:   48 IGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTY-CQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKS-QQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKV--AWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLE 331          
BLAST of NLK-1 vs. Ensembl Human
Match: MAPK3 (mitogen-activated protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:6877])

HSP 1 Score: 236.113 bits (601), Expect = 4.986e-70
Identity = 130/288 (45.14%), Postives = 187/288 (64.93%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKR--NISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDL-CHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLD 1427
            +G GA+G+V S +D   + + A+K+I    H T   +R  RE+ IL   +HEN+I + DI+++       ++YI+ D M+TDL+K++ S Q LS DH+  FLYQILRG+KY+HSA+++HRD+KP N+L+N+ C LKICDFGLARI D    +   LT+ V T++YRAPE+++ S  Y  ++D+WS+GC  AE+L  R +F  K  L+QL+ IL I+G+P   DL C  +  AR Y+ S   K       AK       +AL LLD ML FNP+ RI+ EEAL+H YL+
Sbjct:   48 IGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTY-CQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKS-QQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKV--AWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLE 331          
BLAST of NLK-1 vs. Ensembl Human
Match: MAPK7 (mitogen-activated protein kinase 7 [Source:HGNC Symbol;Acc:HGNC:6880])

HSP 1 Score: 245.743 bits (626), Expect = 2.041e-69
Identity = 145/383 (37.86%), Postives = 202/383 (52.74%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFIN-DEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISP------LTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTP-PLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSN---NVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQ-----KDQYRLRLVLNP 1673
            +G GA+GVV S     T ++ A+K+IPN F     AKR  REL IL H KH+NII++ DI++    +     +Y++ D M++DLH+II S Q L+++HV+ FLYQ+LRG+KY+HSA +IHRD+KP N+LVN NC LKI DFG+AR       SP      +T+ V T++YRAPEL++    Y  A+D+WS+GC F E+L RR LF  K  + QL LI+ ++GTP P           R Y+ S   ++P       W         +AL LL  ML+F P  RIS+  AL H +L     +YH                          D EP C  P     D         KE I   I++++      + Q R +  L P
Sbjct:   61 IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMAR---GLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQSLPPRQP-----VPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFL----AKYHDP------------------------DDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQP 407          
BLAST of NLK-1 vs. Ensembl Celegans
Match: lit-1 (Serine/threonine kinase NLK [Source:UniProtKB/Swiss-Prot;Acc:Q9U9Y8])

HSP 1 Score: 402.519 bits (1033), Expect = 3.347e-133
Identity = 205/425 (48.24%), Postives = 291/425 (68.47%), Query Frame = 3
Query:  489 AVIDEANGCYAPILLNNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWS--NNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMS--EAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKE-DPTNHKW 1748
            A++  A   Y P + +++ +      RP+GYGAFGVVWSV DPR+ K+ ALK++PN+F N  + KR++RE+ +LS  +H+N++SL+DI++  +     E+Y+L + MQ+DLHKIIVSPQAL+ DHVK+F+YQILRG+KYLH+A+I+HRDIKPGN+LVNSNC+LKICDFGLAR  D+R+   +T EVVTQYYRAPELLM +  Y  AVD+WS+GC FAELL R+ILFQA GP+EQL +I++++GTP    + +A   A+ +VL    + P+   + K +  ++   EA+ LL  +L F+PD RIS EEAL H YL++ RLR+HSCMCSCC+     +KPN    R F  D +P    P     +   +++S  E +E + +F+ +  +   Y + L +NP S  Y+   +SSVAQA E  P+   W
Sbjct:   27 AILAAAQPFYPPPVQDSQPD------RPIGYGAFGVVWSVTDPRSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIVSPQALTPDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGLRAPDTQRLYKIASPDDKNHEAVDLLQKLLHFDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCY-----TKPNMP-SRLFAQDLDPRHESPFDPKWEKDMSRLSMFELREKMYQFVMD--RPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW 437          
BLAST of NLK-1 vs. Ensembl Celegans
Match: lit-1 (Serine/threonine kinase NLK [Source:UniProtKB/Swiss-Prot;Acc:Q9U9Y8])

HSP 1 Score: 402.519 bits (1033), Expect = 5.498e-133
Identity = 205/425 (48.24%), Postives = 291/425 (68.47%), Query Frame = 3
Query:  489 AVIDEANGCYAPILLNNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWS--NNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMS--EAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKE-DPTNHKW 1748
            A++  A   Y P + +++ +      RP+GYGAFGVVWSV DPR+ K+ ALK++PN+F N  + KR++RE+ +LS  +H+N++SL+DI++  +     E+Y+L + MQ+DLHKIIVSPQAL+ DHVK+F+YQILRG+KYLH+A+I+HRDIKPGN+LVNSNC+LKICDFGLAR  D+R+   +T EVVTQYYRAPELLM +  Y  AVD+WS+GC FAELL R+ILFQA GP+EQL +I++++GTP    + +A   A+ +VL    + P+   + K +  ++   EA+ LL  +L F+PD RIS EEAL H YL++ RLR+HSCMCSCC+     +KPN    R F  D +P    P     +   +++S  E +E + +F+ +  +   Y + L +NP S  Y+   +SSVAQA E  P+   W
Sbjct:   44 AILAAAQPFYPPPVQDSQPD------RPIGYGAFGVVWSVTDPRSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIVSPQALTPDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGLRAPDTQRLYKIASPDDKNHEAVDLLQKLLHFDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCY-----TKPNMP-SRLFAQDLDPRHESPFDPKWEKDMSRLSMFELREKMYQFVMD--RPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW 454          
BLAST of NLK-1 vs. Ensembl Celegans
Match: lit-1 (Serine/threonine kinase NLK [Source:UniProtKB/Swiss-Prot;Acc:Q9U9Y8])

HSP 1 Score: 402.519 bits (1033), Expect = 5.764e-133
Identity = 205/425 (48.24%), Postives = 291/425 (68.47%), Query Frame = 3
Query:  489 AVIDEANGCYAPILLNNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWS--NNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMS--EAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKE-DPTNHKW 1748
            A++  A   Y P + +++ +      RP+GYGAFGVVWSV DPR+ K+ ALK++PN+F N  + KR++RE+ +LS  +H+N++SL+DI++  +     E+Y+L + MQ+DLHKIIVSPQAL+ DHVK+F+YQILRG+KYLH+A+I+HRDIKPGN+LVNSNC+LKICDFGLAR  D+R+   +T EVVTQYYRAPELLM +  Y  AVD+WS+GC FAELL R+ILFQA GP+EQL +I++++GTP    + +A   A+ +VL    + P+   + K +  ++   EA+ LL  +L F+PD RIS EEAL H YL++ RLR+HSCMCSCC+     +KPN    R F  D +P    P     +   +++S  E +E + +F+ +  +   Y + L +NP S  Y+   +SSVAQA E  P+   W
Sbjct:   52 AILAAAQPFYPPPVQDSQPD------RPIGYGAFGVVWSVTDPRSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIVSPQALTPDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGLRAPDTQRLYKIASPDDKNHEAVDLLQKLLHFDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCY-----TKPNMP-SRLFAQDLDPRHESPFDPKWEKDMSRLSMFELREKMYQFVMD--RPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW 462          
BLAST of NLK-1 vs. Ensembl Celegans
Match: lit-1 (Serine/threonine kinase NLK [Source:UniProtKB/Swiss-Prot;Acc:Q9U9Y8])

HSP 1 Score: 402.519 bits (1033), Expect = 5.764e-133
Identity = 205/425 (48.24%), Postives = 291/425 (68.47%), Query Frame = 3
Query:  489 AVIDEANGCYAPILLNNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWS--NNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMS--EAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKE-DPTNHKW 1748
            A++  A   Y P + +++ +      RP+GYGAFGVVWSV DPR+ K+ ALK++PN+F N  + KR++RE+ +LS  +H+N++SL+DI++  +     E+Y+L + MQ+DLHKIIVSPQAL+ DHVK+F+YQILRG+KYLH+A+I+HRDIKPGN+LVNSNC+LKICDFGLAR  D+R+   +T EVVTQYYRAPELLM +  Y  AVD+WS+GC FAELL R+ILFQA GP+EQL +I++++GTP    + +A   A+ +VL    + P+   + K +  ++   EA+ LL  +L F+PD RIS EEAL H YL++ RLR+HSCMCSCC+     +KPN    R F  D +P    P     +   +++S  E +E + +F+ +  +   Y + L +NP S  Y+   +SSVAQA E  P+   W
Sbjct:   52 AILAAAQPFYPPPVQDSQPD------RPIGYGAFGVVWSVTDPRSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIVSPQALTPDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGLRAPDTQRLYKIASPDDKNHEAVDLLQKLLHFDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCY-----TKPNMP-SRLFAQDLDPRHESPFDPKWEKDMSRLSMFELREKMYQFVMD--RPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW 462          
BLAST of NLK-1 vs. Ensembl Celegans
Match: lit-1 (Serine/threonine kinase NLK [Source:UniProtKB/Swiss-Prot;Acc:Q9U9Y8])

HSP 1 Score: 403.675 bits (1036), Expect = 1.805e-131
Identity = 205/425 (48.24%), Postives = 291/425 (68.47%), Query Frame = 3
Query:  489 AVIDEANGCYAPILLNNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWS--NNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMS--EAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKE-DPTNHKW 1748
            A++  A   Y P + +++ +      RP+GYGAFGVVWSV DPR+ K+ ALK++PN+F N  + KR++RE+ +LS  +H+N++SL+DI++  +     E+Y+L + MQ+DLHKIIVSPQAL+ DHVK+F+YQILRG+KYLH+A+I+HRDIKPGN+LVNSNC+LKICDFGLAR  D+R+   +T EVVTQYYRAPELLM +  Y  AVD+WS+GC FAELL R+ILFQA GP+EQL +I++++GTP    + +A   A+ +VL    + P+   + K +  ++   EA+ LL  +L F+PD RIS EEAL H YL++ RLR+HSCMCSCC+     +KPN    R F  D +P    P     +   +++S  E +E + +F+ +  +   Y + L +NP S  Y+   +SSVAQA E  P+   W
Sbjct:  191 AILAAAQPFYPPPVQDSQPD------RPIGYGAFGVVWSVTDPRSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIVSPQALTPDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGLRAPDTQRLYKIASPDDKNHEAVDLLQKLLHFDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCY-----TKPNMP-SRLFAQDLDPRHESPFDPKWEKDMSRLSMFELREKMYQFVMD--RPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW 601          
BLAST of NLK-1 vs. Ensembl Fly
Match: nmo (gene:FBgn0011817 transcript:FBtr0076756)

HSP 1 Score: 424.091 bits (1089), Expect = 1.380e-141
Identity = 200/396 (50.51%), Postives = 275/396 (69.44%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKE-DPTNHKW 1748
            +RP+GYGAFGVVW+V DPR  ++ ALK++PN+F + V++KR++REL +L   KHEN++S +DI++  H     EIY++ + +Q+DLHKIIVSPQ LS DH+K+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM + +Y+ AVD+WS+GC F ELL RRILFQA+ P++QL+LI  ++GTP + D+ HA   AR ++L +  K P+  ++   S++ T EA+ LL  ML F+PD RIS  +AL+H YLD+ RLRYHSCMC CC             +R +  D EP   +P     +   T + + KE + KFI    Q    R+ L +NP S  ++   +S+VA   E  P+ H+W
Sbjct:   43 DRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFT-------TSAGMRQYTADFEPSAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTG--RVPLCINPQSAAFKSFASSTVAHPSELPPSPHQW 429          
BLAST of NLK-1 vs. Ensembl Fly
Match: nmo (gene:FBgn0011817 transcript:FBtr0333223)

HSP 1 Score: 424.091 bits (1089), Expect = 1.380e-141
Identity = 200/396 (50.51%), Postives = 275/396 (69.44%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKE-DPTNHKW 1748
            +RP+GYGAFGVVW+V DPR  ++ ALK++PN+F + V++KR++REL +L   KHEN++S +DI++  H     EIY++ + +Q+DLHKIIVSPQ LS DH+K+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM + +Y+ AVD+WS+GC F ELL RRILFQA+ P++QL+LI  ++GTP + D+ HA   AR ++L +  K P+  ++   S++ T EA+ LL  ML F+PD RIS  +AL+H YLD+ RLRYHSCMC CC             +R +  D EP   +P     +   T + + KE + KFI    Q    R+ L +NP S  ++   +S+VA   E  P+ H+W
Sbjct:   43 DRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFT-------TSAGMRQYTADFEPSAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTG--RVPLCINPQSAAFKSFASSTVAHPSELPPSPHQW 429          
BLAST of NLK-1 vs. Ensembl Fly
Match: nmo (gene:FBgn0011817 transcript:FBtr0076759)

HSP 1 Score: 424.091 bits (1089), Expect = 1.380e-141
Identity = 200/396 (50.51%), Postives = 275/396 (69.44%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKE-DPTNHKW 1748
            +RP+GYGAFGVVW+V DPR  ++ ALK++PN+F + V++KR++REL +L   KHEN++S +DI++  H     EIY++ + +Q+DLHKIIVSPQ LS DH+K+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM + +Y+ AVD+WS+GC F ELL RRILFQA+ P++QL+LI  ++GTP + D+ HA   AR ++L +  K P+  ++   S++ T EA+ LL  ML F+PD RIS  +AL+H YLD+ RLRYHSCMC CC             +R +  D EP   +P     +   T + + KE + KFI    Q    R+ L +NP S  ++   +S+VA   E  P+ H+W
Sbjct:   43 DRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFT-------TSAGMRQYTADFEPSAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTG--RVPLCINPQSAAFKSFASSTVAHPSELPPSPHQW 429          
BLAST of NLK-1 vs. Ensembl Fly
Match: nmo (gene:FBgn0011817 transcript:FBtr0076758)

HSP 1 Score: 424.091 bits (1089), Expect = 1.380e-141
Identity = 200/396 (50.51%), Postives = 275/396 (69.44%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKE-DPTNHKW 1748
            +RP+GYGAFGVVW+V DPR  ++ ALK++PN+F + V++KR++REL +L   KHEN++S +DI++  H     EIY++ + +Q+DLHKIIVSPQ LS DH+K+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM + +Y+ AVD+WS+GC F ELL RRILFQA+ P++QL+LI  ++GTP + D+ HA   AR ++L +  K P+  ++   S++ T EA+ LL  ML F+PD RIS  +AL+H YLD+ RLRYHSCMC CC             +R +  D EP   +P     +   T + + KE + KFI    Q    R+ L +NP S  ++   +S+VA   E  P+ H+W
Sbjct:   43 DRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFT-------TSAGMRQYTADFEPSAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTG--RVPLCINPQSAAFKSFASSTVAHPSELPPSPHQW 429          
BLAST of NLK-1 vs. Ensembl Fly
Match: nmo (gene:FBgn0011817 transcript:FBtr0474156)

HSP 1 Score: 424.091 bits (1089), Expect = 1.428e-141
Identity = 200/396 (50.51%), Postives = 275/396 (69.44%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKE-DPTNHKW 1748
            +RP+GYGAFGVVW+V DPR  ++ ALK++PN+F + V++KR++REL +L   KHEN++S +DI++  H     EIY++ + +Q+DLHKIIVSPQ LS DH+K+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM + +Y+ AVD+WS+GC F ELL RRILFQA+ P++QL+LI  ++GTP + D+ HA   AR ++L +  K P+  ++   S++ T EA+ LL  ML F+PD RIS  +AL+H YLD+ RLRYHSCMC CC             +R +  D EP   +P     +   T + + KE + KFI    Q    R+ L +NP S  ++   +S+VA   E  P+ H+W
Sbjct:   43 DRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFT-------TSAGMRQYTADFEPSAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTG--RVPLCINPQSAAFKSFASSTVAHPSELPPSPHQW 429          
BLAST of NLK-1 vs. Ensembl Zebrafish
Match: nlk2 (nemo-like kinase, type 2 [Source:ZFIN;Acc:ZDB-GENE-080320-1])

HSP 1 Score: 417.927 bits (1073), Expect = 1.003e-138
Identity = 202/390 (51.79%), Postives = 275/390 (70.51%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y+ A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   AR ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC+             R +  D EP+         + + T + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:   66 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGARAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCYTTSSG--------RVYTSDFEPVTNPKFDDGFEKNLTSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMP 445          
BLAST of NLK-1 vs. Ensembl Zebrafish
Match: nlk2 (nemo-like kinase, type 2 [Source:ZFIN;Acc:ZDB-GENE-080320-1])

HSP 1 Score: 417.927 bits (1073), Expect = 1.184e-138
Identity = 202/390 (51.79%), Postives = 275/390 (70.51%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y+ A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   AR ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC+             R +  D EP+         + + T + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:   71 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGARAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCYTTSSG--------RVYTSDFEPVTNPKFDDGFEKNLTSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMP 450          
BLAST of NLK-1 vs. Ensembl Zebrafish
Match: nlk2 (nemo-like kinase, type 2 [Source:ZFIN;Acc:ZDB-GENE-080320-1])

HSP 1 Score: 418.313 bits (1074), Expect = 9.700e-138
Identity = 202/390 (51.79%), Postives = 275/390 (70.51%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y+ A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   AR ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC+             R +  D EP+         + + T + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:  147 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGARAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCYTTSSG--------RVYTSDFEPVTNPKFDDGFEKNLTSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMP 526          
BLAST of NLK-1 vs. Ensembl Zebrafish
Match: nlk1 (nemo-like kinase, type 1 [Source:ZFIN;Acc:ZDB-GENE-040701-1])

HSP 1 Score: 410.223 bits (1053), Expect = 2.046e-135
Identity = 198/383 (51.70%), Postives = 269/383 (70.23%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSV 1712
            +RP+GYGAFGVVWSV DPR  +K ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++       +EIY++ + MQ+DLHK+IVSPQ L+ DH+K+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNCLLKICDFGLAR+E+      +TQEVVTQYYRAPE+LM   +Y  ++D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTPPL+ +  A   AR ++L    K P+L ++   S+  T EA+ LL  ML F+P  RIS  +ALSH YLD+ RLRYH+CMC CC+     S P+    R +  D EP   +P S   + S   + + KE I +FI  + Q    R+ L +NP S  ++  + S+ 
Sbjct:   91 DRPIGYGAFGVVWSVTDPRDGRKVALKKMPNVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHKVIVSPQPLTTDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCLLKICDFGLARVEEPDPSRHMTQEVVTQYYRAPEVLMGCQHYTSSIDVWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPPLSAMTSACEGARAHILRGPHKPPSLSVLYMLSDGATHEAVHLLCRMLVFDPAKRISGSDALSHPYLDEGRLRYHTCMCKCCY-----SVPSG---RVYTRDFEPPADRPFSHNYEQSMHSVWQGKELIHRFITEHQQGK--RVPLCINPQSAAFKTFIRSTA 463          
BLAST of NLK-1 vs. Ensembl Zebrafish
Match: nlk1 (nemo-like kinase, type 1 [Source:ZFIN;Acc:ZDB-GENE-040701-1])

HSP 1 Score: 298.13 bits (762), Expect = 2.196e-94
Identity = 139/241 (57.68%), Postives = 185/241 (76.76%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRK 1286
            +RP+GYGAFGVVWSV DPR  +K ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++       +EIY++ + MQ+DLHK+IVSPQ L+ DH+K+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNCLLKICDFGLAR+E+      +TQEVVTQYYRAPE+LM   +Y  ++D+WS+GC FAELL RRILFQA+ P++Q+ +  +  G   L  L     D +Y ++S RK
Sbjct:   91 DRPIGYGAFGVVWSVTDPRDGRKVALKKMPNVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHKVIVSPQPLTTDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCLLKICDFGLARVEEPDPSRHMTQEVVTQYYRAPEVLMGCQHYTSSIDVWSVGCIFAELLGRRILFQAQSPIQQVMMDTSFKGLKILAFL----QDVKYVLVSSRK 327          
BLAST of NLK-1 vs. Ensembl Xenopus
Match: nlk (nemo-like kinase [Source:NCBI gene;Acc:100144638])

HSP 1 Score: 416.001 bits (1068), Expect = 9.449e-138
Identity = 202/390 (51.79%), Postives = 274/390 (70.26%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y  A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   A+ ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC              R +  D EPI       T + + + + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:   72 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYTNAIDVWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSSG--------RVYTSDFEPITNPKFDDTFEKNLSSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMP 451          
BLAST of NLK-1 vs. Ensembl Xenopus
Match: nlk (nemo-like kinase [Source:NCBI gene;Acc:100144638])

HSP 1 Score: 416.772 bits (1070), Expect = 5.764e-137
Identity = 202/390 (51.79%), Postives = 274/390 (70.26%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y  A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   A+ ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC              R +  D EPI       T + + + + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:  148 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYTNAIDVWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSSG--------RVYTSDFEPITNPKFDDTFEKNLSSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMP 527          
BLAST of NLK-1 vs. Ensembl Xenopus
Match: nlk (nemo-like kinase [Source:NCBI gene;Acc:100144638])

HSP 1 Score: 404.06 bits (1037), Expect = 2.077e-133
Identity = 196/379 (51.72%), Postives = 266/379 (70.18%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLL 1700
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y  A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   A+ ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC              R +  D EPI       T + + + + + KE I +FI    Q+   R+ L +NP S  ++  +
Sbjct:   62 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYTNAIDVWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSSG--------RVYTSDFEPITNPKFDDTFEKNLSSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFI 430          
BLAST of NLK-1 vs. Ensembl Xenopus
Match: nlk (nemo-like kinase [Source:NCBI gene;Acc:100144638])

HSP 1 Score: 378.637 bits (971), Expect = 1.433e-124
Identity = 187/370 (50.54%), Postives = 257/370 (69.46%), Query Frame = 3
Query:  603 SVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSV 1712
            SV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y  A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   A+ ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC              R +  D EPI       T + + + + + KE I +FI    Q+   R+ L +NP S  ++  ++S+V
Sbjct:   10 SVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYTNAIDVWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSSG--------RVYTSDFEPITNPKFDDTFEKNLSSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTV 369          
BLAST of NLK-1 vs. Ensembl Xenopus
Match: nlk (nemo-like kinase [Source:NCBI gene;Acc:100144638])

HSP 1 Score: 374.4 bits (960), Expect = 6.951e-123
Identity = 185/366 (50.55%), Postives = 253/366 (69.13%), Query Frame = 3
Query:  603 SVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLL 1700
            SV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y  A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   A+ ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC              R +  D EPI       T + + + + + KE I +FI    Q+   R+ L +NP S  ++  +
Sbjct:    9 SVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYTNAIDVWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSSG--------RVYTSDFEPITNPKFDDTFEKNLSSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFI 364          
BLAST of NLK-1 vs. Ensembl Mouse
Match: Nlk (nemo like kinase [Source:MGI Symbol;Acc:MGI:1201387])

HSP 1 Score: 416.772 bits (1070), Expect = 3.420e-137
Identity = 201/390 (51.54%), Postives = 275/390 (70.51%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y+ A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   A+ ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC              R +  D EP+       T + + + + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:  141 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTG--------RVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMP 520          
BLAST of NLK-1 vs. Ensembl Mouse
Match: Mapk7 (mitogen-activated protein kinase 7 [Source:MGI Symbol;Acc:MGI:1346347])

HSP 1 Score: 247.284 bits (630), Expect = 3.690e-70
Identity = 149/400 (37.25%), Postives = 212/400 (53.00%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFIN-DEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISP------LTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTP-PLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSN---NVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYY-QKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDPT 1736
            +G GA+GVV S     T ++ A+K+IPN F     AKR  REL IL H KH+NII++ DI+K    +     +Y++ D M++DLH+II S Q L+++HV+ FLYQ+LRG+KY+HSA +IHRD+KP N+LVN NC LKI DFG+AR       SP      +T+ V T++YRAPEL++    Y  A+D+WS+GC F E+L RR LF  K  + QL LI+ ++GTP P           R Y+ S   ++P       W         +AL LL  ML+F P  RIS+  AL H +L     +YH                          D EP C  P     D         KE I   I++++ +++  R ++   P   + QP+ +  V    E P+
Sbjct:   61 IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILKPTVPYGEFRSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMAR---GLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQSLPPRQP-----VPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFL----AKYHDP------------------------DDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQP---SLQPVASEPVCPDVEMPS 421          
BLAST of NLK-1 vs. Ensembl Mouse
Match: Mapk3 (mitogen-activated protein kinase 3 [Source:MGI Symbol;Acc:MGI:1346859])

HSP 1 Score: 236.113 bits (601), Expect = 4.422e-70
Identity = 130/288 (45.14%), Postives = 187/288 (64.93%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKR--NISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDL-CHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLD 1427
            +G GA+G+V S +D   + + A+K+I    H T   +R  RE+ IL   +HEN+I + DI+++       ++YI+ D M+TDL+K++ S Q LS DH+  FLYQILRG+KY+HSA+++HRD+KP N+L+N+ C LKICDFGLARI D    +   LT+ V T++YRAPE+++ S  Y  ++D+WS+GC  AE+L  R +F  K  L+QL+ IL I+G+P   DL C  +  AR Y+ S   K       AK       +AL LLD ML FNP+ RI+ EEAL+H YL+
Sbjct:   49 IGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTY-CQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKS-QQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKV--AWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLE 332          
BLAST of NLK-1 vs. Ensembl Mouse
Match: Mapk3 (mitogen-activated protein kinase 3 [Source:MGI Symbol;Acc:MGI:1346859])

HSP 1 Score: 235.343 bits (599), Expect = 7.492e-70
Identity = 130/288 (45.14%), Postives = 187/288 (64.93%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKR--NISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDL-CHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLD 1427
            +G GA+G+V S +D   + + A+K+I    H T   +R  RE+ IL   +HEN+I + DI+++       ++YI+ D M+TDL+K++ S Q LS DH+  FLYQILRG+KY+HSA+++HRD+KP N+L+N+ C LKICDFGLARI D    +   LT+ V T++YRAPE+++ S  Y  ++D+WS+GC  AE+L  R +F  K  L+QL+ IL I+G+P   DL C  +  AR Y+ S   K       AK       +AL LLD ML FNP+ RI+ EEAL+H YL+
Sbjct:   49 IGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTY-CQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKS-QQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKV--AWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLE 332          
BLAST of NLK-1 vs. Ensembl Mouse
Match: Mapk1 (mitogen-activated protein kinase 1 [Source:MGI Symbol;Acc:MGI:1346858])

HSP 1 Score: 233.032 bits (593), Expect = 2.642e-69
Identity = 129/291 (44.33%), Postives = 187/291 (64.26%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDK--RNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDL-CHAHPDARYYVLSKRKKKPNLGMIAKWSN---NVTEEALRLLDSMLKFNPDHRISSEEALSHSYLD 1427
            +G GA+G+V S +D   + + A+K+I    H T   +R  RE+ IL   +HENII + DI+++       ++YI+ D M+TDL+K++ + Q LS DH+  FLYQILRG+KY+HSA+++HRD+KP N+L+N+ C LKICDFGLAR+ D    +   LT+ V T++YRAPE+++ S  Y  ++D+WS+GC  AE+L  R +F  K  L+QL+ IL I+G+P   DL C  +  AR Y+LS   K         W+    N   +AL LLD ML FNP  RI  E+AL+H YL+
Sbjct:   29 IGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTY-CQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKT-QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNK-----VPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLE 312          
BLAST of NLK-1 vs. UniProt/SwissProt
Match: sp|E2QWQ2|NLK_CANLF (Serine/threonine-protein kinase NLK OS=Canis lupus familiaris OX=9615 GN=NLK PE=3 SV=1)

HSP 1 Score: 417.157 bits (1071), Expect = 1.297e-136
Identity = 202/390 (51.79%), Postives = 275/390 (70.51%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y+ A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   A+ ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC              R +  D EPI       T + + + + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:  141 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTG--------RVYTSDFEPITNPKFDDTFEKNLSSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMP 520          
BLAST of NLK-1 vs. UniProt/SwissProt
Match: sp|Q9UBE8|NLK_HUMAN (Serine/threonine-protein kinase NLK OS=Homo sapiens OX=9606 GN=NLK PE=1 SV=2)

HSP 1 Score: 416.772 bits (1070), Expect = 2.341e-136
Identity = 201/390 (51.54%), Postives = 275/390 (70.51%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y+ A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   A+ ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC              R +  D EP+       T + + + + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:  141 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTG--------RVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMP 520          
BLAST of NLK-1 vs. UniProt/SwissProt
Match: sp|D3ZSZ3|NLK_RAT (Serine/threonine-protein kinase NLK OS=Rattus norvegicus OX=10116 GN=Nlk PE=3 SV=1)

HSP 1 Score: 416.772 bits (1070), Expect = 2.392e-136
Identity = 201/390 (51.54%), Postives = 275/390 (70.51%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y+ A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   A+ ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC              R +  D EP+       T + + + + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:  141 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTG--------RVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMP 520          
BLAST of NLK-1 vs. UniProt/SwissProt
Match: sp|O54949|NLK_MOUSE (Serine/threonine-protein kinase NLK OS=Mus musculus OX=10090 GN=Nlk PE=1 SV=2)

HSP 1 Score: 416.772 bits (1070), Expect = 2.392e-136
Identity = 201/390 (51.54%), Postives = 275/390 (70.51%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y+ A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   A+ ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC              R +  D EP+       T + + + + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:  141 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTG--------RVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMP 520          
BLAST of NLK-1 vs. UniProt/SwissProt
Match: sp|E1BMN8|NLK_BOVIN (Serine/threonine-protein kinase NLK OS=Bos taurus OX=9913 GN=NLK PE=3 SV=2)

HSP 1 Score: 416.387 bits (1069), Expect = 3.665e-136
Identity = 201/390 (51.54%), Postives = 275/390 (70.51%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y+ A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP L  +  A   A+ ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC              R +  D EP+       T + + + + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:  148 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTG--------RVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMP 527          
BLAST of NLK-1 vs. TrEMBL
Match: H9CXV4 (Mitogen-activated protein kinase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 944.495 bits (2440), Expect = 0.000e+0
Identity = 465/465 (100.00%), Postives = 465/465 (100.00%), Query Frame = 3
Query:  354 MLVGQRIHAGVTSLTXXXXXXXXXXXQTELDSKLMRDDKQEEALLAVIDEANGCYAPILLNNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDPTNHKW 1748
            MLVGQRIHAGVTSLTSSKSNNFKSKSQTELDSKLMRDDKQEEALLAVIDEANGCYAPILLNNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDPTNHKW
Sbjct:    1 MLVGQRIHAGVTSLTSSKSNNFKSKSQTELDSKLMRDDKQEEALLAVIDEANGCYAPILLNNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDPTNHKW 465          
BLAST of NLK-1 vs. TrEMBL
Match: A0A0X3PZK9 (Mitogen-activated protein kinase OS=Schistocephalus solidus OX=70667 GN=NLK PE=3 SV=1)

HSP 1 Score: 497.664 bits (1280), Expect = 2.700e-165
Identity = 253/488 (51.84%), Postives = 333/488 (68.24%), Query Frame = 3
Query:  447 SKLMRDDKQEEALLAVI---DEANGC--YAPILLNNKC---EDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHD---------------HQDS------------------------------SKPNDGIV-RNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDPTNHKW 1748
            S   +   ++EALLA+     EA G   Y P LL  +      ++  E+ LGYGAFGVVWSV DPR  +K ALKRIP +FHN +TAKR+YREL +LS ++H+N++SL+D+VK+D     DE+Y+L + MQTDLHKIIVSPQ LS DHVKIFLYQILRG++YLHSA I+HRDIKPGNMLVNSNCLLKICDFGLAR++D +N + LTQEVVTQYYR+PELLME+S Y++AVD+WS+GCTFAELL RRILF A  PLEQ++LILN+ GTP + DL H HP+A  +VLS R ++PNL  +   S ++   A+ LL SML+FNP  RI++EEALSH YL++ARLRYHSCMC+CCHD               + DS                              S  + G+  R FC + +P     +   +D+ F ++S+AK  + + ++ Y+++D    RL+LN N+ NY+ L+TS+VAQAKE P +H+W
Sbjct:   50 SSFAQTQSRDEALLAIYVHPAEAGGVGHYKPFLLPPRAPGESSHSSLEKGLGYGAFGVVWSVIDPRDGRKVALKRIPRVFHNPITAKRVYRELKMLSLLRHDNVVSLIDVVKTDSYSSFDEVYLLFELMQTDLHKIIVSPQPLSSDHVKIFLYQILRGLRYLHSAGIVHRDIKPGNMLVNSNCLLKICDFGLARMDDPKNQAQLTQEVVTQYYRSPELLMEASRYSYAVDIWSVGCTFAELLSRRILFPAHSPLEQIELILNLTGTPSMDDLQHCHPEACCFVLSFRPRRPNLATLYSLSPDMNASAVDLLSSMLRFNPKERITAEEALSHPYLEEARLRYHSCMCTCCHDVPVSTSQTSLGSPGVNGDSGSLSSAPTTPTSSISSASSGSEAHGKLSIGSNSSSGLTRRKFCQNLDPTANFLLPLDLDSHFKRLSDAKRILWETVQEYFRRDTRTARLILNKNAANYKALVTSNVAQAKEMPASHRW 537          
BLAST of NLK-1 vs. TrEMBL
Match: A0A5K3EJC8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 496.123 bits (1276), Expect = 4.005e-164
Identity = 257/484 (53.10%), Postives = 328/484 (67.77%), Query Frame = 3
Query:  468 KQEEALLAVI---DEANGC--YAPILL---NNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKP-------NDGIV------------------------------------------RNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDPTNHKW 1748
            +++EALLA+     EA G   Y P LL   N      +  E+ LGYGAFGVVWSV DPR  +K ALKRIP +FHN +TAKR+YREL +LS + H+NI++LVD+VKSD+    DE+Y+L + MQTDLHKIIVSPQ LS DHVKIFLYQILRG++YLHSA I+HRDIKPGNMLVNSNCLLKICDFGLAR++D  N + LT EVVTQYYR+PELLME+S Y++AVDMWS+GCTFAELL RRILF A+GPLEQL+LILN+ GTP + DL H HP+A  +VLS R ++PNL  +   S +++  A+ LL SML+F+P  RI++EEALSH YL++ARLRYHSCMC+CCHD   +S P       + G V                                          R FC D +P     +   +D+ F ++S+AK  + + ++ Y+ +D    RL+LN N+ NY+ L+TSSVAQAKE P   +W
Sbjct:   88 QRDEALLAIYVHPSEAGGVGHYKPFLLPPRNPGEGSQSSLEKGLGYGAFGVVWSVIDPRDGRKVALKRIPRVFHNPITAKRVYRELKMLSMLHHDNIVTLVDVVKSDNYSSFDEVYLLFELMQTDLHKIIVSPQPLSSDHVKIFLYQILRGLRYLHSAGIVHRDIKPGNMLVNSNCLLKICDFGLARMDDPGNQAQLTTEVVTQYYRSPELLMETSRYSYAVDMWSVGCTFAELLSRRILFPAQGPLEQLELILNLTGTPKMVDLEHCHPEACCFVLSFRPRRPNLASLYSLSPDLSNAAVDLLSSMLRFSPKDRITAEEALSHCYLEEARLRYHSCMCTCCHDVPVASPPATQGGLSSPGAVGDNASLSSAPTTPTSSISSSSSSISPSDTPGKQQQHPGNLTRRKFCRDLDPAANFLLPLDLDSHFKRLSDAKRILWETLQEYHHRDTRSARLILNKNAVNYRALVTSSVAQAKEMPPARRW 571          
BLAST of NLK-1 vs. TrEMBL
Match: A0A564YF87 (Mitogen-activated protein kinase OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5308 PE=3 SV=1)

HSP 1 Score: 486.878 bits (1252), Expect = 9.073e-161
Identity = 248/483 (51.35%), Postives = 323/483 (66.87%), Query Frame = 3
Query:  471 QEEALLAVIDEAN-----GCYAPILL---NNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHD-----------------------------------------------HQDSSKPNDGIV--RNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDPTNHKW 1748
            +EEALLA+  +       G Y P LL   N         E+ LGYGAFGVVWSV DPR  +K ALKRIP +FHN +TAKR+YRE+ +LS + H+NI++LVD+VKSD+    DE+Y++ + MQTDLHKIIVSPQ LS DHVKIFLYQILRG++YLHSA I+HRDIKPGNMLVNSNCLLKICDFGLAR++D +N + LT EVVTQYYR+PELLME+S Y++AVDMWS+GCTFAELL RRILF A+GPLEQL+LI+N+ GTP + DL + HP+A  +VLS R ++PNL      S +V+  A+ L+ +ML FNP  RI++EEAL+HSYL++ARLRYHSCMC+CCHD                                                    +P  G++  R FC D +P     +   +D+ F ++S+AK  +   ++ Y+ +D    +L+LN N+ NY+ L+TS+VAQAKE P   +W
Sbjct:   72 REEALLAIYVQPTEIGGVGHYKPFLLPPRNPGDSSQNALEKGLGYGAFGVVWSVIDPRDGRKVALKRIPRVFHNPITAKRVYREVKMLSMLHHDNIVTLVDVVKSDNYSNFDEVYLIFELMQTDLHKIIVSPQPLSTDHVKIFLYQILRGLRYLHSAGIVHRDIKPGNMLVNSNCLLKICDFGLARMDDPKNQAQLTTEVVTQYYRSPELLMETSRYSYAVDMWSVGCTFAELLSRRILFPAQGPLEQLELIVNLTGTPNVEDLENCHPEACCFVLSFRPRRPNLAFFYSLSPDVSSAAVDLISNMLCFNPKARITAEEALNHSYLEEARLRYHSCMCTCCHDVPVTQSGGLSSPGGVSDNGSLSSAPATPTSSISSTSTASSPADTPGKGIQQQRPGTGVLTRRKFCRDLDPAANFLLPLDLDSHFKRLSDAKRILWDTLQEYHHRDPRSAKLILNKNAANYRALVTSNVAQAKEMPAARRW 554          
BLAST of NLK-1 vs. TrEMBL
Match: A0A068YGR6 (Mitogen-activated protein kinase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001020300 PE=3 SV=1)

HSP 1 Score: 487.263 bits (1253), Expect = 2.203e-160
Identity = 248/484 (51.24%), Postives = 329/484 (67.98%), Query Frame = 3
Query:  471 QEEALLAVI---DEANGC--YAPILLNNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHD---------------------------------------------------HQDSSKPNDGIV-RNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP-TNHKW 1748
            +EEALLA+     +A G   Y P LL  +    +  E+ LGYGAFGVVWSV DPR  ++ ALKRIP +FHN +TAKR+YREL +LS + H+NI+SL+D+VKSD+    DE+Y+L + MQTDLHKIIVSPQ LS DHVKIFLYQILRG++YLHSA I+HRDIKPGNMLVNSNCLLKICDFGLAR++D +N + LT EVVTQYYR+PELLME+S Y++AVD+WS+GCTFAELL RRILF A+GPLEQL+LI+N+ GTP + DL + HP+A  +VLS R ++PNL  +   S ++T  A+ L+ SML+FNP  RI++EEAL+H YL++ARLRYHSCMC+CCHD                                                    Q   +P   +  R FC + +PI    +   +D+ F ++S+AK  +   ++ Y+ +D    +L+LN N+ NY+ L+TS+VAQAKE P ++H++
Sbjct:   62 REEALLAIYVHPTDAGGVGHYKPFLLPPRAPGESSLEKGLGYGAFGVVWSVIDPRDGRRVALKRIPRVFHNPITAKRVYRELKMLSVLHHDNIVSLIDVVKSDNYSNFDEVYLLFELMQTDLHKIIVSPQPLSSDHVKIFLYQILRGLRYLHSAGIVHRDIKPGNMLVNSNCLLKICDFGLARMDDPKNQAQLTTEVVTQYYRSPELLMETSRYSYAVDIWSVGCTFAELLSRRILFPAQGPLEQLELIVNLTGTPTIEDLENCHPEACCFVLSFRPRRPNLAFLYSLSPDITGAAVELISSMLRFNPKARITAEEALNHCYLEEARLRYHSCMCTCCHDVPVTPTSTQGTMSSPGGVSDNGSLSSAPVTPTSSISSAASSASTSPADTPGKQQQQRPAGVLTRRKFCRNLDPIANFLLPLDLDSHFKRLSDAKRILWDTLQEYHHRDTRSAKLILNKNAANYRALVTSNVAQAKEIPASSHQY 545          
BLAST of NLK-1 vs. Ensembl Cavefish
Match: nlk1 (serine/threonine-protein kinase NLK2-like [Source:NCBI gene;Acc:103027970])

HSP 1 Score: 416.387 bits (1069), Expect = 6.339e-138
Identity = 200/383 (52.22%), Postives = 271/383 (70.76%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSV 1712
            +RP+GYGAFGVVWSV DPR  +K ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++       +EIY++ + MQ+DLHK+IVSPQ L+ DH+K+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNCLLKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y  A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTPPL+ +  A   AR ++L    K P+L ++   S+  T EA+ LL  ML F+P  RIS  +ALSH YLD+ RLRYH+CMC CC+     S P+    R +  D EP   +P S + + S   + + KE I +FI  + Q    R+ L +NP S  ++  + S+ 
Sbjct:   94 DRPIGYGAFGVVWSVTDPRDGRKVALKKMPNVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHKVIVSPQPLTTDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCLLKICDFGLARVEEPDPTRHMTQEVVTQYYRAPEVLMGSRHYGPAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPPLSAMASACEGARAHILRGPHKPPSLSVLYMLSDAATHEAVHLLCRMLVFDPAKRISGSDALSHPYLDEGRLRYHTCMCQCCY-----SVPSG---RVYTRDFEPPAERPFSHSYEESMLSVWQGKELIHRFITEHQQGK--RVPLCINPQSAAFKTFIRSTA 466          
BLAST of NLK-1 vs. Ensembl Cavefish
Match: nlk2 (nemo-like kinase, type 2 [Source:ZFIN;Acc:ZDB-GENE-080320-1])

HSP 1 Score: 387.497 bits (994), Expect = 3.394e-126
Identity = 194/390 (49.74%), Postives = 262/390 (67.18%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++  H    +EIY++ + MQ+DLHKIIVSPQ LS DHVK+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y               LL RRILFQA+ P++QLDLI +++GTP L  +  A   AR ++L    K+P+L ++   SN  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC+             R +  D EP+         + + T + + KE I +FI    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:  142 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDESRHMTQEVVTQYYRAPEILMGSRHY-------------TNLLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGARAHILRGPHKQPSLPVLYTLSNQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCYTTSSG--------RVYTSDFEPVTNPKFDDGFEKNLTSVRQVKEIIHQFILE--QQKGNRVPLCINPQSAAFKSFISSTVAQPSEMP 508          
BLAST of NLK-1 vs. Ensembl Cavefish
Match: mapk3 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:103041389])

HSP 1 Score: 236.884 bits (603), Expect = 1.963e-70
Identity = 132/290 (45.52%), Postives = 190/290 (65.52%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKR--NISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDL-CHAHPDARYYV--LSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLD 1427
            +G GA+G+V S FD   + + A+K+I    H T   +R  RE+ IL   +HENII + DI+++       ++YI+ D M+TDL+K++ + Q LS DH+  FLYQILRG+KY+HSA+++HRD+KP N+L+N+ C LKICDFGLARI D    +   LT+ V T++YRAPE+++ S  Y  ++D+WS+GC  AE+L  R +F  K  L+QL+ IL I+G+P   DL C  +  AR Y+  L ++ K P   +  K  N    +AL LLD ML FNP  RI+ EEAL+H YL+
Sbjct:   62 IGEGAYGMVCSAFDNVNKIRVAIKKISPFEHQTY-CQRTLREIKILLRFRHENIIGINDILRARRIDYMRDVYIVQDLMETDLYKLLKT-QQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPQKPKIPWNKLFPKADN----KALDLLDRMLTFNPIKRITVEEALAHPYLE 345          
BLAST of NLK-1 vs. Ensembl Cavefish
Match: mapk1 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:103047585])

HSP 1 Score: 235.728 bits (600), Expect = 2.769e-70
Identity = 134/293 (45.73%), Postives = 190/293 (64.85%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDK--RNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDL-CHAHPDARYYVLS--KRKKKPNLGMIAKWSN---NVTEEALRLLDSMLKFNPDHRISSEEALSHSYLD 1427
            +G GA+G+V S +D   + + A+K+I    H T   +R  RE+ IL   KHENIIS+ DI+++       ++YI+ D M+TDL+K++ + Q LS DH+  FLYQILRG+KY+HSA+++HRD+KP N+L+N+ C LKICDFGLAR+ D    +   LT+ V T++YRAPE+++ S  Y  ++D+WS+GC  AE+L  R +F  K  L+QL+ IL I+G+P   DL C  +  AR Y+LS   R K P       W+    N   +AL LLD ML FNP  RI  EEAL+H YL+
Sbjct:   42 IGEGAYGMVCSAYDRDNKVRVAIKKISPFEHQTY-CQRTLREIKILLRFKHENIISINDIIRAPSIDQMKDVYIVQDLMETDLYKLLKT-QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVP-------WNRLFPNADPKALDLLDKMLTFNPHKRIEVEEALAHPYLE 325          
BLAST of NLK-1 vs. Ensembl Cavefish
Match: mapk1 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:103047585])

HSP 1 Score: 235.343 bits (599), Expect = 1.165e-69
Identity = 134/293 (45.73%), Postives = 190/293 (64.85%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDK--RNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDL-CHAHPDARYYVLS--KRKKKPNLGMIAKWSN---NVTEEALRLLDSMLKFNPDHRISSEEALSHSYLD 1427
            +G GA+G+V S +D   + + A+K+I    H T   +R  RE+ IL   KHENIIS+ DI+++       ++YI+ D M+TDL+K++ + Q LS DH+  FLYQILRG+KY+HSA+++HRD+KP N+L+N+ C LKICDFGLAR+ D    +   LT+ V T++YRAPE+++ S  Y  ++D+WS+GC  AE+L  R +F  K  L+QL+ IL I+G+P   DL C  +  AR Y+LS   R K P       W+    N   +AL LLD ML FNP  RI  EEAL+H YL+
Sbjct:   42 IGEGAYGMVCSAYDRDNKVRVAIKKISPFEHQTY-CQRTLREIKILLRFKHENIISINDIIRAPSIDQMKDVYIVQDLMETDLYKLLKT-QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVP-------WNRLFPNADPKALDLLDKMLTFNPHKRIEVEEALAHPYLE 325          
BLAST of NLK-1 vs. Ensembl Sea Lamprey
Match: mapk1 (mitogen-activated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030722-2])

HSP 1 Score: 231.876 bits (590), Expect = 1.562e-69
Identity = 131/290 (45.17%), Postives = 186/290 (64.14%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDK--RNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDL-CHAHPDARYYV--LSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLD 1427
            +G GA+G+V + FD     + A+K+I    H T   +R  RE+ IL   KHENII + DI+++       ++YI+ D M+TDL+K++   Q LS DH+  FLYQILRG+KY+HSA+++HRD+KP N+L+N+ C LKICDFGLAR+ D    +   LT+ V T++YRAPE+++ S  Y  ++D+WS+GC  AE+L  R LF  K  L+QL+ IL I+G+P   DL C  +  AR Y+  L  + K P   +  K       +AL LLD ML FNP  RI+ EEAL+H YL+
Sbjct:   42 IGEGAYGMVCAAFDNVKLVRVAIKKISPFEHQTY-CQRTLREIKILLRFKHENIIGINDILRASTIDQMKDVYIVQDLMETDLYKLLKG-QQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPLFPGKHYLDQLNHILGILGSPSQEDLDCIINMKARNYLQSLPPKAKVPWNRLFPK----ADSKALDLLDKMLTFNPHRRITVEEALAHPYLE 325          
BLAST of NLK-1 vs. Ensembl Sea Lamprey
Match: mapk12a (mitogen-activated protein kinase 12a [Source:NCBI gene;Acc:30681])

HSP 1 Score: 219.935 bits (559), Expect = 4.526e-65
Identity = 122/307 (39.74%), Postives = 182/307 (59.28%), Query Frame = 3
Query:  549 DNTLWERP--------LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFIN-DEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPP--LTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDAR 1436
            +  +WE P        +G GA+G V S  D  T  K A+K++   F + V AKR YREL +L H+KHEN+I LVD+   + +     + Y++  FM TDL KI+   +  S D V+  +YQIL+G+KY+HS+ IIHRD+KPGN+ VN +C LKI DFGLAR  D+     +T  VVT++YRAPE+++   +Y   VD+WS+GC  AE++  + LF     ++QL LIL + GTPP  L D    +  A+Y     + +K  +  +   +N +   A+ LL+ ML  +P+ R ++ EAL H +  + R
Sbjct:   17 NKMVWEVPKRYSQLFAVGSGAYGTVCSSMDLVTGSKVAVKKLYRPFQSRVFAKRAYRELRLLKHMKHENVIGLVDVFTPNDTLDQFQDFYLVMPFMGTDLSKIMKHGKQ-SDDKVQYLIYQILKGLKYIHSSGIIHRDLKPGNLAVNEDCELKILDFGLARHADQE----MTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGKPLFPGNDHMDQLMLILKLTGTPPQYLVDRMDENEAAKYIKTLPKMEKRRISTVFPNANPI---AIDLLEKMLALDPEQRPTASEALQHPFFSETR 315          
BLAST of NLK-1 vs. Ensembl Sea Lamprey
Match: mapk14a (mitogen-activated protein kinase 14a [Source:NCBI gene;Acc:65237])

HSP 1 Score: 216.468 bits (550), Expect = 6.791e-64
Identity = 128/308 (41.56%), Postives = 181/308 (58.77%), Query Frame = 3
Query:  549 DNTLWERP--------LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFIN-DEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAK----GPLEQLDLILNIVGTPP--LTDLCHAHPDARYYVLS-KRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYL 1424
            + T+WE P        +G GA+G V S  D +T  K A+K++   F + + AKR YREL +L H+KHEN+I L+D+   + S    D++Y++ D M  DL+ I V  Q L+ DHV+  +YQILRG+KY+HSA IIHRD+KP N+ VN +C LKI DFGLAR  D      +T  V T++YRAPE+++   +Y   VD+WS+GC  AELL  R LF         + QL  IL + GTPP  L D   +  +AR Y+ S    +K +   +   +N +    + LL+ ML  + D RI++ EAL H Y 
Sbjct:   15 NKTVWEVPRRYVNLTSVGSGAYGSVCSSLDTKTGMKVAVKKLSRPFQSVIHAKRTYRELRLLKHMKHENVIGLMDVFTPNSSLEEFDDLYLVTDLMGADLNNI-VKCQKLTDDHVQFLVYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLARHADDE----MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDRILSDINQLVKILQLTGTPPQYLIDRMQSK-EARNYIQSLPYTQKRDFKDVFLGANPL---VVDLLERMLVLDTDQRITAAEALVHQYF 313          
BLAST of NLK-1 vs. Ensembl Sea Lamprey
Match: mapk15 (mitogen-activated protein kinase 15 [Source:ZFIN;Acc:ZDB-GENE-050522-307])

HSP 1 Score: 202.216 bits (513), Expect = 4.814e-57
Identity = 107/290 (36.90%), Postives = 164/290 (56.55%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAK-RLYRELFILSHIK-HENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLAR----IEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYL 1424
            LG G  G+VW   D +     A+K+I + F N   A+ R +RE+  L     H NII+L +++++D+   + +IY++ DFM TDLH +I     L   H     YQ+L+  KY+HS ++IHRD KP N+L++  C +K+CDFGLAR    I D+     LT+ V T++YRAPE+L+ S  Y   VDMWS+GC   E+L  + +F     L Q++ I++++  P   D+     +    VL K  ++     +     N    AL LL  +L FNP+ R+++EEAL H Y+
Sbjct:   19 LGKGELGIVWKGVDRKNGDVVAIKKIFDAFRNQTDAQQRTFREIIFLQEFGDHPNIINLRNVLRADN---DKDIYLVFDFMDTDLHAVIRKGNILKDVHKAYITYQLLKATKYIHSGNVIHRDQKPSNVLLDGECFVKLCDFGLARSLKQIRDEPGDPALTEYVATRWYRAPEILLASPRYTKGVDMWSVGCIVGEMLLGKAIFPGTSTLNQIERIMSVIPQPSKEDVLAIKSEYGGSVLEKMGRQRQ--SLESLLPNAPPNALDLLKRLLVFNPEKRLTAEEALGHPYV 303          
BLAST of NLK-1 vs. Ensembl Sea Lamprey
Match: mapk15 (mitogen-activated protein kinase 15 [Source:ZFIN;Acc:ZDB-GENE-050522-307])

HSP 1 Score: 201.445 bits (511), Expect = 2.294e-56
Identity = 107/290 (36.90%), Postives = 164/290 (56.55%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAK-RLYRELFILSHIK-HENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLAR----IEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYL 1424
            LG G  G+VW   D +     A+K+I + F N   A+ R +RE+  L     H NII+L +++++D+   + +IY++ DFM TDLH +I     L   H     YQ+L+  KY+HS ++IHRD KP N+L++  C +K+CDFGLAR    I D+     LT+ V T++YRAPE+L+ S  Y   VDMWS+GC   E+L  + +F     L Q++ I++++  P   D+     +    VL K  ++     +     N    AL LL  +L FNP+ R+++EEAL H Y+
Sbjct:   20 LGKGELGIVWKGVDRKNGDVVAIKKIFDAFRNQTDAQQRTFREIIFLQEFGDHPNIINLRNVLRADN---DKDIYLVFDFMDTDLHAVIRKGNILKDVHKAYITYQLLKATKYIHSGNVIHRDQKPSNVLLDGECFVKLCDFGLARSLKQIRDEPGDPALTEYVATRWYRAPEILLASPRYTKGVDMWSVGCIVGEMLLGKAIFPGTSTLNQIERIMSVIPQPSKEDVLAIKSEYGGSVLEKMGRQRQ--SLESLLPNAPPNALDLLKRLLVFNPEKRLTAEEALGHPYV 304          
BLAST of NLK-1 vs. Ensembl Yeast
Match: FUS3 (Mitogen-activated serine/threonine protein kinase involved in mating; phosphoactivated by Ste7p; substrates include Ste12p, Far1p, Bni1p, Sst2p; inhibits invasive growth during mating by phosphorylating Tec1p, promoting its; inhibits recruitment of Ste5p, Cdc42p-mediated asymmetry and mating morphogenesis [Source:SGD;Acc:S000000112])

HSP 1 Score: 225.328 bits (573), Expect = 1.887e-67
Identity = 134/296 (45.27%), Postives = 183/296 (61.82%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFIN-DEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNI---------SPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTP-PLTDL-CHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYL 1424
            LG GA+GVV S     T +  A+K+I   F   + A R  RE+ IL H KHENII++ +I + D SF N +E+YI+ + MQTDLH++I S Q LS DH++ F+YQ LR VK LH +++IHRD+KP N+L+NSNC LK+CDFGLARI D+            S +T+ V T++YRAPE+++ S+ Y+ A+D+WS GC  AEL  RR +F  +    QL LI  I+GTP    DL C   P AR Y+  K         + K    V  + + LL  ML F+P  RI+++EAL H YL
Sbjct:   19 LGEGAYGVVCSATHKPTGEIVAIKKI-EPFDKPLFALRTLREIKILKHFKHENIITIFNIQRPD-SFENFNEVYIIQELMQTDLHRVI-STQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYI--KSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYL 309          
BLAST of NLK-1 vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 222.246 bits (565), Expect = 2.130e-65
Identity = 121/287 (42.16%), Postives = 176/287 (61.32%), Query Frame = 3
Query:  570 PLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPP---LTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSY 1421
            P+G GAFG+V S  D  T +  A+K+I   F   V AKR YREL +L H++HEN+I L DI  S      ++IY + +   TDLH+++ + + L    V+ FLYQILRG+KY+HSA +IHRD+KP N+L+N NC LKICDFGLARI+D +    +T  V T+YYRAPE+++    Y   VD+WS GC FAE++  + LF  K  + Q  +I +++G+PP   +  +C  +       L  R   P     ++    V  +A+ LL+ ML F+P  RI++ +AL+H Y
Sbjct:   28 PVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIFLSPL----EDIYFVTELQGTDLHRLLQT-RPLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQ----MTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSLPHRDPIP----FSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHPY 301          
BLAST of NLK-1 vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 204.527 bits (519), Expect = 1.318e-59
Identity = 119/296 (40.20%), Postives = 173/296 (58.45%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHI-KHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQA----LSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARI----EDKRN--ISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWS-NNVTEEALRLLDSMLKFNPDHRISSEEALSHSYL 1424
            +G GA+G V S     +  K A+K+I   F   +   R  RE+ +L +  +HENIIS++D V+       + +Y++ + M+TDL K+I +  +    LS DHV+ F YQILR +K +HSA +IHRDIKP N+L+NSNC LK+CDFGLAR      D R   +  +T+ V T++YRAPE+++    Y  A+D+WS GC  AE++  + LF  +    QL LIL ++GTP   D            ++    +P L     WS  ++  + + LLD ML+FNPD RIS+ EAL H YL
Sbjct:   19 IGEGAYGTVCSAIHKPSGIKVAIKKI-QPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYL 313          
BLAST of NLK-1 vs. Ensembl Yeast
Match: SLT2 (Serine/threonine MAP kinase; coordinates expression of all 19S regulatory particle assembly-chaperones (RACs) to control proteasome abundance; involved in regulating maintenance of cell wall integrity, cell cycle progression, nuclear mRNA retention in heat shock, septum assembly; required for mitophagy, pexophagy; affects recruitment of mitochondria to phagophore assembly site; plays role in adaptive response of cells to cold; regulated by the PKC1-mediated signaling pathway [Source:SGD;Acc:S000001072])

HSP 1 Score: 206.838 bits (525), Expect = 2.864e-59
Identity = 122/300 (40.67%), Postives = 177/300 (59.00%), Query Frame = 3
Query:  567 RPLGYGAFGVVWSV--FDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIK-HENIISL--VDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDK---RNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCH-AHPDARYYVLSKRKKKPNLGMIAKWS-----NNVTEEALRLLDSMLKFNPDHRISSEEALSHSYL 1424
            + +G+GA+G+V S    +       A+K++ N+F  T+  KR  REL +L H + H+NI  L  +DIV      IN  +Y+  + M+ D+H+II S Q L+  H + F YQIL G+KY+HSA ++HRD+KPGN+LVN++C LKICDFGLAR   +    N   LT+ V T++YRAPE+++    Y  A+D+WS GC  AE L  + +F+ K  + QL+ IL ++GTPP   L      + + Y+         LG I K        N   +AL LL+ ML F+P  RI+ +EAL H YL
Sbjct:   27 KEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSING-LYLYEELMECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIH-------QLGFIPKVPFVNLYPNANSQALDLLEQMLAFDPQKRITVDEALEHPYL 318          
BLAST of NLK-1 vs. Ensembl Yeast
Match: SMK1 (Middle sporulation-specific mitogen-activated protein kinase (MAPK); required for production of the outer spore wall layers; negatively regulates activity of the glucan synthase subunit Gsc2p [Source:SGD;Acc:S000006258])

HSP 1 Score: 200.29 bits (508), Expect = 8.717e-58
Identity = 132/369 (35.77%), Postives = 204/369 (55.28%), Query Frame = 3
Query:  573 LGYGAFGVVWSV-FDPRT-RKKAALKRIPNIFHNTVTAKRLYRELFILSHIK-HENIISLVD--IVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLAR------IEDKRNISP-LTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSN---NVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPK-PISSTIDNSFTKMSEAKETIKKFIKNY 1631
            LG GA+G V SV F  R+   + A+K+I NIF+  +  KR  REL  ++  K H+NI++L+D  IV S      D +Y   + +  DL K+I S   LS  H+K FLYQIL G+KY+HSA +IHRD+KPGN+L   N  LKICDFGLAR       +    + P +T  V T++YRAPELL+ +  Y+ +VD+W++GC  AE   R+ +F  +  + Q+  I+ ++GTP   D+       + + L K    P    I  WSN     + EA+ L++S+L ++  HR++ E+A+SH +L++ R                  KP+D          EP+C + P   T ++    MS+ ++ + + +KN+
Sbjct:   44 LGKGAYGTVCSVKFKGRSPAARIAVKKISNIFNKEILLKRAIRELKFMNFFKGHKNIVNLIDLEIVTSSPY---DGLYCYQELIDYDLAKVIHSSVQLSEFHIKYFLYQILCGLKYIHSADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAGFFKCHSTVQPHITNYVATRWYRAPELLLSNQPYSKSVDIWAVGCILAEFYARKPVFMGRDSMHQIFEIIKVLGTPD-KDILIKFGTIKAWNLGKNSNNPVYKKIP-WSNIFPFASHEAINLIESLLHWDSTHRLNVEQAISHPFLNEVR------------------KPDD----------EPVCLQGPFDFTYESELNSMSKLRDYLVEEVKNF 379          
BLAST of NLK-1 vs. Ensembl Nematostella
Match: EDO30527 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0K0])

HSP 1 Score: 391.349 bits (1004), Expect = 2.464e-129
Identity = 196/386 (50.78%), Postives = 263/386 (68.13%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPD--ARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVA 1715
            +RP+GYGAFGVVWSV DPR  K+ ALK++P +F N  +++R YREL +L  +KH+N+IS +DIV   H  +  EIY++ + MQ+DLHKIIVSPQ L+ DHVK+FLYQILRG+KYL SA I+HRDIKPGN+LVNSNCLLKICDFGLAR+E+      +TQEVVTQYYR+PELL  S++Y  AVD+WS+GC FAELL R+ILFQA+ P++QL+ I++++GTP L DL  A     A  Y+L +  K P L  +   SN  T EA+ LL  ML FNP+ RIS  +ALSH YLD+ RLR+H+CMC CC      + P     R +  D EP+ P     + + +   +S  KE++ K++  +       + L +N  S +++    S VA
Sbjct:   42 DRPIGYGAFGVVWSVTDPRNGKRVALKKMPKVFQNITSSRRAYRELRMLCTLKHDNVISAIDIVHPGHIDLFHEIYVVSELMQSDLHKIIVSPQPLTADHVKVFLYQILRGLKYLDSAKILHRDIKPGNLLVNSNCLLKICDFGLARLEEPDESVIMTQEVVTQYYRSPELLTGSTHYTQAVDIWSVGCIFAELLSRKILFQAQSPVQQLNQIIDLLGTPCLEDLSKAGSSEGATKYILQRPHKPPALASLYNLSNQATHEAVHLLCRMLVFNPNKRISCIDALSHPYLDEGRLRFHTCMCKCCQ-----TTPAG---RQYVSDFEPVNPARFDDSYEYNLNDISSIKESLYKYVLEHQGNS---VPLCINMASPSFKSFQRSGVA 416          
BLAST of NLK-1 vs. Ensembl Nematostella
Match: EDO37435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFQ0])

HSP 1 Score: 245.358 bits (625), Expect = 1.558e-74
Identity = 133/288 (46.18%), Postives = 195/288 (67.71%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDK--RNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTD-LCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLD 1427
            +G GA+G+V +  D  T ++ A+K+I    H T   +R  RE+ ILS  KHENII ++DI+++  +    +IYI+   M+TD++K++ + Q LS DH+  FLYQILRG+KY+HSA+++HRD+KP N+L+N+ C LKICDFGLARI D    +   LT+ V T++YRAPE+++ S  Y+ A+D+WS+GC  AE+L  R LF  K  L+QL+LILN++G+P   D LC  +  AR Y L     KP    I  +S N   +AL L++++L FNP+ RI+ EEAL+H YL+
Sbjct:   27 IGEGAYGMVVAGVDNTTGERIAIKKISPFEHQTY-CQRTLREIKILSRFKHENIIGILDIIRAPRAEDMKDIYIVQPLMETDMYKLLKT-QRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARIADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYSKAIDIWSVGCILAEMLANRPLFPGKHYLDQLNLILNVLGSPIADDLLCIKNEKARSY-LQSLPYKPKTPFIKLFS-NADAKALDLIENLLAFNPNKRITVEEALAHPYLE 310          
BLAST of NLK-1 vs. Ensembl Nematostella
Match: EDO40573 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6R5])

HSP 1 Score: 244.202 bits (622), Expect = 1.630e-73
Identity = 146/374 (39.04%), Postives = 210/374 (56.15%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFIN-DEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLAR------IEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNP 1673
            +G GA+GVV S  D RT  K A+K+I   F    TA+R +REL IL H KH+NII + DI+K   +    D++Y++ D M++DLH+II + Q L+ +HV+ FLYQILRG+KY+HSA ++HRD+KP N+LVN N  LKI DFG+AR      +E KR    +T+ V T++YRAPEL++  + Y+ A+DMWS+GC  AE++ RR LF     L QL +IL++ GTP    +     +     L++   K  +    K+      EA+ LL  ML+ +P  RI+ E AL H +L +    YHS                         + EP C  P    +D  F  +   KE +K+ I N  +  Q +  LVL+P
Sbjct:   29 IGNGAYGVVCSAMDTRTGAKVAVKKISRAFDVLTTARRTHRELKILRHFKHDNIICIRDILKPPVNLDEFDDVYVVLDLMESDLHRIIHTDQPLTTEHVRYFLYQILRGLKYIHSAKVLHRDLKPSNLLVNENAELKIGDFGMARGLCSSPLEQKRF---MTEYVATRWYRAPELMLSLNEYSEAIDMWSVGCILAEMIGRRPLFPGANYLNQLQMILSVTGTPSQNFIERMGAERVKTYLNQLPHKDPVPF-EKFFPKAHPEAINLLSQMLQLDPKERITVENALQHPFLKE----YHSE------------------------EDEPTCYSP----LDFKFDTVLMTKEALKEAIVNEIKDFQKKQALVLSP 366          
BLAST of NLK-1 vs. Ensembl Nematostella
Match: EDO39421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA30])

HSP 1 Score: 215.312 bits (547), Expect = 8.791e-64
Identity = 116/307 (37.79%), Postives = 180/307 (58.63%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYREL-FILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEV----VTQYY------RAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHS 1451
            ++ LG GA+G+VW   D RT +  A+K+I + F N   A+R +RE+ F+     HEN++ L++++K+D+   + +IY++ ++M TDLH +I     L   H +  +YQ+L+  K++HS ++IHRD+KP N+L++S C  KICDFGLA     R++S +TQE     +T Y       RAPE+L+ S  Y   VDMWSIGC   ELL  + LF     L Q++ I+  +  P   D+          VL +   KP   + A   N    +A+ LL+ +L+FNPD R+++EEALSH Y+     R+H+
Sbjct:   16 KKRLGKGAYGIVWKAIDRRTGEVVAVKKIFDAFRNQTDAQRTFREICFLQEFGDHENVVKLMNVIKADN---DKDIYLVFEYMDTDLHNVIKRGNILKDIHKRYIMYQLLKATKFIHSGNVIHRDLKPSNLLLDSECFAKICDFGLA-----RSVSNITQEAGDPSLTDYVATRGILRAPEILLASPRYTKGVDMWSIGCILGELLLGKPLFPGSSTLNQIEKIMTSIAPPSRQDVDSIKSHYSTSVLDRMACKPKRSL-ADVLNTAPSDAIDLLNKLLQFNPDKRLTAEEALSHPYV----ARFHN 309          
BLAST of NLK-1 vs. Ensembl Nematostella
Match: EDO46881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNM4])

HSP 1 Score: 210.305 bits (534), Expect = 3.167e-61
Identity = 128/341 (37.54%), Postives = 193/341 (56.60%), Query Frame = 3
Query:  510 GCYAPILLNNKCEDNTLWER--PLGYGAFGVVWSVF-------DPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFIN-DEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPD-ARYYV--LSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSK 1493
            G Y   L+N   E    ++   P+G GA+G V S         +P      A+K++   F +T+ AKR YREL +L H++HEN+ISL+D+  +  +F +  ++Y++ + M +DL+ I+   Q LS +HV+  +YQILRG+KY+HSA +IHRD+KP N+ VN +C LKI DFGLAR+ D    + +T  V T++YRAPE+++   +Y   VD+WS+GC  AELL  + LF     ++QL  I+ +VG P    L     + AR Y+  +   +K P      ++       A+ LL+ ML  + DHRI++ EALSH YL           CS   D  D  +
Sbjct:    7 GFYRTELVNTVYEVPRKYQELSPIGTGAYGQVCSSTITEPDPTNPDGPNTVAIKKLSRPFQSTMHAKRTYRELKLLRHMRHENVISLLDVFTTASAFEHFQDVYMVTELMGSDLNGILRF-QKLSDEHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELKILDFGLARMTD----AEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTSKTLFPGNDHIDQLTKIMQLVGKPSDDFLQKIDSESARNYIAQMPDYRKTP----FDEYFVGANPLAVDLLEKMLNLDTDHRITAVEALSHPYLASYADPNDEPTCSTFDDSFDEKE 338          
BLAST of NLK-1 vs. Ensembl Medaka
Match: nlk1 (serine/threonine-protein kinase NLK2 [Source:NCBI gene;Acc:101168711])

HSP 1 Score: 418.698 bits (1075), Expect = 1.185e-139
Identity = 201/383 (52.48%), Postives = 272/383 (71.02%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSV 1712
            +RP+GYGAFGVVWSV DPR  +K ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++       +EIY++ + MQ+DLHK+IVSPQ L+ DH+K+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNCLLKICDFGLAR+E+      +TQEVVTQYYRAPE+LM   +Y  A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTPPL+ L  A   AR ++L    K P+L ++   S+  T EA+ LL  ML F+P  RIS  +ALSH YLD+ RLRYH+CMC CC+     S P+    R +  D EP+  +P S + +NS   + + KE I +FI  + Q    R+ L +NP S  ++  + S+ 
Sbjct:   30 DRPIGYGAFGVVWSVTDPRDGRKVALKKMPNVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHKVIVSPQPLTTDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCLLKICDFGLARVEEPDQSRHMTQEVVTQYYRAPEVLMGCRHYGSAIDVWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPPLSALASACEGARAHILRGPHKPPSLSVLYMLSDGATHEAVHLLCRMLVFDPAKRISGSDALSHPYLDEGRLRYHTCMCQCCY-----SVPSG---RVYTRDFEPVAERPFSHSYENSLLSVWQGKELIHRFITEHQQGK--RVPLCINPQSAAFKTFIRSTA 402          
BLAST of NLK-1 vs. Ensembl Medaka
Match: nlk1 (serine/threonine-protein kinase NLK2 [Source:NCBI gene;Acc:101168711])

HSP 1 Score: 419.853 bits (1078), Expect = 3.195e-139
Identity = 201/383 (52.48%), Postives = 272/383 (71.02%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSV 1712
            +RP+GYGAFGVVWSV DPR  +K ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++       +EIY++ + MQ+DLHK+IVSPQ L+ DH+K+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNCLLKICDFGLAR+E+      +TQEVVTQYYRAPE+LM   +Y  A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTPPL+ L  A   AR ++L    K P+L ++   S+  T EA+ LL  ML F+P  RIS  +ALSH YLD+ RLRYH+CMC CC+     S P+    R +  D EP+  +P S + +NS   + + KE I +FI  + Q    R+ L +NP S  ++  + S+ 
Sbjct:   91 DRPIGYGAFGVVWSVTDPRDGRKVALKKMPNVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHKVIVSPQPLTTDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCLLKICDFGLARVEEPDQSRHMTQEVVTQYYRAPEVLMGCRHYGSAIDVWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPPLSALASACEGARAHILRGPHKPPSLSVLYMLSDGATHEAVHLLCRMLVFDPAKRISGSDALSHPYLDEGRLRYHTCMCQCCY-----SVPSG---RVYTRDFEPVAERPFSHSYENSLLSVWQGKELIHRFITEHQQGK--RVPLCINPQSAAFKTFIRSTA 463          
BLAST of NLK-1 vs. Ensembl Medaka
Match: nlk1 (serine/threonine-protein kinase NLK2 [Source:NCBI gene;Acc:101168711])

HSP 1 Score: 419.853 bits (1078), Expect = 3.195e-139
Identity = 201/383 (52.48%), Postives = 272/383 (71.02%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSV 1712
            +RP+GYGAFGVVWSV DPR  +K ALK++PN+F N V+ KR++REL +L   KH+N++S +DI++       +EIY++ + MQ+DLHK+IVSPQ L+ DH+K+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNCLLKICDFGLAR+E+      +TQEVVTQYYRAPE+LM   +Y  A+D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTPPL+ L  A   AR ++L    K P+L ++   S+  T EA+ LL  ML F+P  RIS  +ALSH YLD+ RLRYH+CMC CC+     S P+    R +  D EP+  +P S + +NS   + + KE I +FI  + Q    R+ L +NP S  ++  + S+ 
Sbjct:   91 DRPIGYGAFGVVWSVTDPRDGRKVALKKMPNVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHKVIVSPQPLTTDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCLLKICDFGLARVEEPDQSRHMTQEVVTQYYRAPEVLMGCRHYGSAIDVWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPPLSALASACEGARAHILRGPHKPPSLSVLYMLSDGATHEAVHLLCRMLVFDPAKRISGSDALSHPYLDEGRLRYHTCMCQCCY-----SVPSG---RVYTRDFEPVAERPFSHSYENSLLSVWQGKELIHRFITEHQQGK--RVPLCINPQSAAFKTFIRSTA 463          
BLAST of NLK-1 vs. Ensembl Medaka
Match: nlk2 (nemo like kinase [Source:NCBI gene;Acc:101162387])

HSP 1 Score: 419.083 bits (1076), Expect = 2.766e-138
Identity = 199/390 (51.03%), Postives = 275/390 (70.51%), Query Frame = 3
Query:  564 ERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDP 1733
            +RP+GYGAFGVVWSV DPR  K+ ALK++PN+F N V+ KR++REL +LS  KHEN++S +D+++  H    +EIY++ + MQ+DLHKIIVSPQ LS DH K+FLYQILRG+KYLHSA I+HRDIKPGN+LVNSNC+LKICDFGLAR+E+      +TQEVVTQYYRAPE+LM S +Y+ ++D+WS+GC FAELL RRILFQA+ P++QLDLI +++GTP +  +  A   AR ++L    K+P+L ++   S+  T EA+ LL  ML F+P  RIS+++AL+H YLD+ RLRYH+CMC CC+             R +  D EP+         + + T + + KE I +F+    Q+   R+ L +NP S  ++  ++S+VAQ  E P
Sbjct:  141 DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLSFFKHENVLSALDVLQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHAKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEESDESRHMTQEVVTQYYRAPEILMGSRHYSNSIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSMEAMRTACEGARAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCYTTSSG--------RVYTSDFEPVTNAKFDDGFEKNLTSVRQVKEIIHQFVLE--QQKGSRVPLCINPQSAAFKSFISSTVAQPSEMP 520          
BLAST of NLK-1 vs. Ensembl Medaka
Match: mapk7 (mitogen-activated protein kinase 7 [Source:NCBI gene;Acc:101157651])

HSP 1 Score: 254.603 bits (649), Expect = 1.481e-71
Identity = 154/381 (40.42%), Postives = 218/381 (57.22%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSD--HSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLAR---IEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPP--LTDLCHAHPDARYYV--LSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKF----IKNYYQKDQY-RLRLVLNP 1673
            +G GA+GVV S       ++ A+K+I N F     AKR  REL IL H KH+NII++ DI++ +  HS     +Y++ D M++DLH+II S Q L+ +H + FLYQ+LRG+KY+HSA++IHRD+KP N+LVN NC LKI DFG+AR      + + S +T+ V T++YRAPELL+  ++Y+ A+D+WS+GC FAE+L R+ LF  K  + QL LIL+++GTPP  L     A    R YV  L  R   P    ++K       +AL LL +ML+F+P  RI   EAL H YL     +YH                          D EPIC        D  F K++ +KE IK      I+++++K Q  R +L   P
Sbjct:   71 IGTGAYGVVSSARRRDNGQQVAIKKISNAFEVVTNAKRTLRELKILKHFKHDNIIAIKDILQPNLPHSAFK-SVYVVLDLMESDLHQIIHSTQTLTPEHTRYFLYQLLRGLKYVHSANVIHRDLKPSNLLVNENCELKIGDFGMARGLSSHPEESYSFMTEYVATRWYRAPELLLSLNHYSLAIDLWSVGCIFAEMLGRKQLFPGKHYVHQLQLILSVLGTPPEGLISAIRAE-RVRSYVQSLPSRTAVP----LSKLYPQAEPDALDLLGAMLRFDPRQRIGVTEALEHPYL----AKYHDP------------------------DDEPIC----VPAFDFEFDKIAMSKEQIKDAILMEIQDFHKKKQSCRQKLQFKP 413          
BLAST of NLK-1 vs. Planmine SMEST
Match: SMESG000023289.1 (SMESG000023289.1)

HSP 1 Score: 944.495 bits (2440), Expect = 0.000e+0
Identity = 465/465 (100.00%), Postives = 465/465 (100.00%), Query Frame = 3
Query:  354 MLVGQRIHAGVTSLTXXXXXXXXXXXQTELDSKLMRDDKQEEALLAVIDEANGCYAPILLNNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDPTNHKW 1748
            MLVGQRIHAGVTSLTSSKSNNFKSKSQTELDSKLMRDDKQEEALLAVIDEANGCYAPILLNNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDPTNHKW
Sbjct:    1 MLVGQRIHAGVTSLTSSKSNNFKSKSQTELDSKLMRDDKQEEALLAVIDEANGCYAPILLNNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVAQAKEDPTNHKW 465          
BLAST of NLK-1 vs. Planmine SMEST
Match: SMESG000014256.1 (SMESG000014256.1)

HSP 1 Score: 308.531 bits (789), Expect = 1.721e-95
Identity = 175/448 (39.06%), Postives = 261/448 (58.26%), Query Frame = 3
Query:  483 LLAVIDEANGCYAPILLN----NKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDH-SFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDL-------CHAH---PDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVR-NFCID---------------SEPICPKPI------SSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLTSSVA 1715
            LLAV D++N  Y     N    NK   +   ++PLG GAFGVVW V DPRT +K A+K+I N+F N ++A+R +REL +L  +KH N+I L D++  DH + + ++IYILC FM  DLH II S + ++  HVK+  YQILRG+KYLHSA+IIHRD+KPGN+LVNS C LKICDFGLAR   +++   +T  VVTQYYRAPEL++  S Y  ++D+WS GC   EL    ILFQ+    EQL+LIL+IVG P +            AH     +R ++ ++  ++ N+      ++ +  +AL LL ++LKFNP+ R+S+E AL   ++   R  +H  +C+CC    +++   D +   +F  D               + P   +PI       + I +    + EA+  I   +++YY  +  + RL+++    N+   + SSVA
Sbjct:  100 LLAVPDQSNN-YMRNAFNFGNYNKIFVSFDGKKPLGNGAFGVVWQVNDPRTNEKMAMKQITNVFSNVMSAQRTFRELTMLMSLKHSNVILLTDVILEDHMNSVANDIYILCQFMDFDLHTIISSKKPIAKFHVKLLFYQILRGLKYLHSANIIHRDLKPGNLLVNSKCQLKICDFGLAR---EKSFESMTPHVVTQYYRAPELILGVSEYTSSIDLWSAGCILVELFTNGILFQSNNTFEQLNLILDIVGCPKIVSQNDDEMKKIGAHLWSKQSRQFMCTQLPRRQNVKFFESLTSEIDMDALYLLINLLKFNPNERLSAETALQSPFVSQGRQLFHGFLCTCCPHSINNTNNGDNLYNMSFTTDKTMINCQNLINQKFLNNPTFFEPIFNGRLFCADISDKMATLEEARMKIHALVQSYYNIEPGKPRLIMS-QFNNHNSFIRSSVA 542          
BLAST of NLK-1 vs. Planmine SMEST
Match: SMESG000001435.1 (SMESG000001435.1)

HSP 1 Score: 224.557 bits (571), Expect = 1.040e-66
Identity = 123/287 (42.86%), Postives = 188/287 (65.51%), Query Frame = 3
Query:  573 LGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKR--NISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDL-CHAHPDARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYL 1424
            +G GA+G+V S +D   ++K A+K+I + F      +R  RE+ IL+  KHENII + DI+ ++      ++YI+   M+TDL K++ + Q LS DH   FLYQILRG+KY+HSA+++HRD+KP N+L+N+ C LKICDFGLAR+ D    +   LT+ V T++YRAPE+++ S  Y  ++D+WS+GC  AE+L  + LF  K  ++QL+LIL ++G+P   DL    +  AR Y L +   KP +   + +  N  ++AL L++ +L FNP +RI  E+AL+H YL
Sbjct:   25 IGEGAYGMVASAYDNIKKEKVAIKKI-SPFEYQTYCQRTLREIKILTRFKHENIIDIRDIITANSINEMKDVYIVQCLMETDLFKLLKT-QQLSNDHTCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEHDHTGLLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLNNKPLFPGKHYIDQLNLILGVLGSPNQEDLDSIVNLKARGY-LQQLPYKPKVSWKSLYP-NADDQALDLIEKLLTFNPVNRIGVEDALAHPYL 307          
BLAST of NLK-1 vs. Planmine SMEST
Match: SMESG000075533.1 (SMESG000075533.1)

HSP 1 Score: 225.328 bits (573), Expect = 1.228e-66
Identity = 131/359 (36.49%), Postives = 198/359 (55.15%), Query Frame = 3
Query:  570 PLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIV---KSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCH-AHPDARYYVLSKRKKKPNLGMIA-KWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNY 1631
            P+G+GA+G V + FD + +++ A+K++   FH+   AKR YREL I+ H+ HENI+ L+D      +  SF   ++Y++   M  DL+ II + + L+ +HV+  +YQILRG+KY+HS+ IIHRD+KP N+ VN +C LKI DFGLAR  D+     +T  V T++YRAPE+++   +Y   VD+WS+GC  AEL  R+ LF     ++QL  I+ + GTP    +      DAR ++  K +  P     +  W     E A+ LLD ML  +PD RIS+++AL+H YL D             HD  D                EP  P  +      +   +   K+T+  FI+N+
Sbjct:   26 PIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESF--SDVYLITPLMGADLNAIIRTQELLN-EHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE----MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLAD------------YHDEHD----------------EPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 349          
BLAST of NLK-1 vs. Planmine SMEST
Match: SMESG000075533.1 (SMESG000075533.1)

HSP 1 Score: 224.942 bits (572), Expect = 3.051e-66
Identity = 131/359 (36.49%), Postives = 198/359 (55.15%), Query Frame = 3
Query:  570 PLGYGAFGVVWSVFDPRTRKKAALKRIPNIFHNTVTAKRLYRELFILSHIKHENIISLVDIV---KSDHSFINDEIYILCDFMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNMLVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAFAVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCH-AHPDARYYVLSKRKKKPNLGMIA-KWSNNVTEEALRLLDSMLKFNPDHRISSEEALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKPISSTIDNSFTKMSEAKETIKKFIKNY 1631
            P+G+GA+G V + FD + +++ A+K++   FH+   AKR YREL I+ H+ HENI+ L+D      +  SF   ++Y++   M  DL+ II + + L+ +HV+  +YQILRG+KY+HS+ IIHRD+KP N+ VN +C LKI DFGLAR  D+     +T  V T++YRAPE+++   +Y   VD+WS+GC  AEL  R+ LF     ++QL  I+ + GTP    +      DAR ++  K +  P     +  W     E A+ LLD ML  +PD RIS+++AL+H YL D             HD  D                EP  P  +      +   +   K+T+  FI+N+
Sbjct:   50 PIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESF--SDVYLITPLMGADLNAIIRTQELLN-EHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE----MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLAD------------YHDEHD----------------EPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 373          
The following BLAST results are available for this feature:
BLAST of NLK-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NLK3.916e-13751.28nemo like kinase [Source:HGNC Symbol;Acc:HGNC:2985... [more]
NLK4.875e-13751.54nemo like kinase [Source:HGNC Symbol;Acc:HGNC:2985... [more]
MAPK32.536e-7045.14mitogen-activated protein kinase 3 [Source:HGNC Sy... [more]
MAPK34.986e-7045.14mitogen-activated protein kinase 3 [Source:HGNC Sy... [more]
MAPK72.041e-6937.86mitogen-activated protein kinase 7 [Source:HGNC Sy... [more]
back to top
BLAST of NLK-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lit-13.347e-13348.24Serine/threonine kinase NLK [Source:UniProtKB/Swi... [more]
lit-15.498e-13348.24Serine/threonine kinase NLK [Source:UniProtKB/Swi... [more]
lit-15.764e-13348.24Serine/threonine kinase NLK [Source:UniProtKB/Swi... [more]
lit-15.764e-13348.24Serine/threonine kinase NLK [Source:UniProtKB/Swi... [more]
lit-11.805e-13148.24Serine/threonine kinase NLK [Source:UniProtKB/Swi... [more]
back to top
BLAST of NLK-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmo1.380e-14150.51gene:FBgn0011817 transcript:FBtr0076756[more]
nmo1.380e-14150.51gene:FBgn0011817 transcript:FBtr0333223[more]
nmo1.380e-14150.51gene:FBgn0011817 transcript:FBtr0076759[more]
nmo1.380e-14150.51gene:FBgn0011817 transcript:FBtr0076758[more]
nmo1.428e-14150.51gene:FBgn0011817 transcript:FBtr0474156[more]
back to top
BLAST of NLK-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nlk21.003e-13851.79nemo-like kinase, type 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
nlk21.184e-13851.79nemo-like kinase, type 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
nlk29.700e-13851.79nemo-like kinase, type 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
nlk12.046e-13551.70nemo-like kinase, type 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
nlk12.196e-9457.68nemo-like kinase, type 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of NLK-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nlk9.449e-13851.79nemo-like kinase [Source:NCBI gene;Acc:100144638][more]
nlk5.764e-13751.79nemo-like kinase [Source:NCBI gene;Acc:100144638][more]
nlk2.077e-13351.72nemo-like kinase [Source:NCBI gene;Acc:100144638][more]
nlk1.433e-12450.54nemo-like kinase [Source:NCBI gene;Acc:100144638][more]
nlk6.951e-12350.55nemo-like kinase [Source:NCBI gene;Acc:100144638][more]
back to top
BLAST of NLK-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nlk3.420e-13751.54nemo like kinase [Source:MGI Symbol;Acc:MGI:120138... [more]
Mapk73.690e-7037.25mitogen-activated protein kinase 7 [Source:MGI Sym... [more]
Mapk34.422e-7045.14mitogen-activated protein kinase 3 [Source:MGI Sym... [more]
Mapk37.492e-7045.14mitogen-activated protein kinase 3 [Source:MGI Sym... [more]
Mapk12.642e-6944.33mitogen-activated protein kinase 1 [Source:MGI Sym... [more]
back to top
BLAST of NLK-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E2QWQ2|NLK_CANLF1.297e-13651.79Serine/threonine-protein kinase NLK OS=Canis lupus... [more]
sp|Q9UBE8|NLK_HUMAN2.341e-13651.54Serine/threonine-protein kinase NLK OS=Homo sapien... [more]
sp|D3ZSZ3|NLK_RAT2.392e-13651.54Serine/threonine-protein kinase NLK OS=Rattus norv... [more]
sp|O54949|NLK_MOUSE2.392e-13651.54Serine/threonine-protein kinase NLK OS=Mus musculu... [more]
sp|E1BMN8|NLK_BOVIN3.665e-13651.54Serine/threonine-protein kinase NLK OS=Bos taurus ... [more]
back to top
BLAST of NLK-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXV40.000e+0100.00Mitogen-activated protein kinase OS=Schmidtea medi... [more]
A0A0X3PZK92.700e-16551.84Mitogen-activated protein kinase OS=Schistocephalu... [more]
A0A5K3EJC84.005e-16453.10Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A564YF879.073e-16151.35Mitogen-activated protein kinase OS=Hymenolepis di... [more]
A0A068YGR62.203e-16051.24Mitogen-activated protein kinase OS=Echinococcus m... [more]
back to top
BLAST of NLK-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nlk16.339e-13852.22serine/threonine-protein kinase NLK2-like [Source:... [more]
nlk23.394e-12649.74nemo-like kinase, type 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
mapk31.963e-7045.52mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
mapk12.769e-7045.73mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
mapk11.165e-6945.73mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
back to top
BLAST of NLK-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk11.562e-6945.17mitogen-activated protein kinase 1 [Source:ZFIN;Ac... [more]
mapk12a4.526e-6539.74mitogen-activated protein kinase 12a [Source:NCBI ... [more]
mapk14a6.791e-6441.56mitogen-activated protein kinase 14a [Source:NCBI ... [more]
mapk154.814e-5736.90mitogen-activated protein kinase 15 [Source:ZFIN;A... [more]
mapk152.294e-5636.90mitogen-activated protein kinase 15 [Source:ZFIN;A... [more]
back to top
BLAST of NLK-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
FUS31.887e-6745.27Mitogen-activated serine/threonine protein kinase ... [more]
HOG12.130e-6542.16Mitogen-activated protein kinase involved in osmor... [more]
KSS11.318e-5940.20Mitogen-activated protein kinase (MAPK); involved ... [more]
SLT22.864e-5940.67Serine/threonine MAP kinase; coordinates expressio... [more]
SMK18.717e-5835.77Middle sporulation-specific mitogen-activated prot... [more]
back to top
BLAST of NLK-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO305272.464e-12950.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374351.558e-7446.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405731.630e-7339.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394218.791e-6437.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468813.167e-6137.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NLK-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nlk11.185e-13952.48serine/threonine-protein kinase NLK2 [Source:NCBI ... [more]
nlk13.195e-13952.48serine/threonine-protein kinase NLK2 [Source:NCBI ... [more]
nlk13.195e-13952.48serine/threonine-protein kinase NLK2 [Source:NCBI ... [more]
nlk22.766e-13851.03nemo like kinase [Source:NCBI gene;Acc:101162387][more]
mapk71.481e-7140.42mitogen-activated protein kinase 7 [Source:NCBI ge... [more]
back to top
BLAST of NLK-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023289.10.000e+0100.00SMESG000023289.1[more]
SMESG000014256.11.721e-9539.06SMESG000014256.1[more]
SMESG000001435.11.040e-6642.86SMESG000001435.1[more]
SMESG000075533.11.228e-6636.49SMESG000075533.1[more]
SMESG000075533.13.051e-6636.49SMESG000075533.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035424
GenBankAFD29625.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035424 ID=SMED30035424|Name=NLK-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2307bp
GATCTTTTTCAAATCAGCTGATTAATATTTTATTACACACAAAATATCTG
CGAATGCCTACACACAAACAAAGCTAGTGATACAATTTGCTAGAAATCTT
ACAAATACAAAGTAATGACTCATGAAGGAAACAAAGTCACCTTGTATGCC
TTTTCTAACTGGTAGAAAAATTTTCATGTGTATCTGTCAGTGATTGCATC
TAATAAACTGTCGGGTCGAATACAGCACTCTATCATTTTCTAATACTGCC
TGCTCCAATTAGAAAAGCGAATGGTTCTTTGTGTCTTTGTTTTTGATATT
ATCTATATTACTGAGCAAAATTGGATGTTATTGTTAAATTTTTTATTTAA
ATCATGTTAGTGGGGCAACGTATTCATGCAGGAGTAACAAGTTTGACCTC
ATCCAAATCCAACAATTTTAAAAGTAAATCACAAACTGAACTTGATTCCA
AATTGATGCGAGACGATAAACAAGAAGAAGCTTTATTGGCAGTGATAGAC
GAAGCAAATGGTTGTTACGCTCCAATTCTTTTGAACAATAAATGCGAAGA
TAATACTTTATGGGAGAGACCTTTGGGATATGGAGCTTTCGGAGTAGTTT
GGTCAGTTTTTGATCCTAGAACTCGTAAAAAAGCAGCACTGAAACGAATA
CCGAATATATTTCACAATACAGTTACCGCCAAACGATTATACCGTGAACT
TTTCATTCTTTCGCACATCAAACATGAGAATATAATTTCTCTTGTGGATA
TTGTCAAATCGGATCACAGCTTTATTAATGACGAAATATACATATTATGT
GATTTTATGCAAACTGATCTCCATAAAATTATTGTTTCTCCTCAAGCGTT
GTCAGTCGACCATGTCAAAATATTTCTTTATCAAATTCTTCGAGGTGTTA
AATATTTGCACTCTGCACACATCATTCACCGAGATATCAAACCGGGTAAT
ATGCTGGTCAATTCCAACTGTTTACTTAAGATTTGTGATTTCGGTTTGGC
AAGGATCGAAGATAAAAGAAACATTTCTCCTTTGACCCAAGAGGTTGTGA
CCCAATACTATCGAGCTCCAGAGTTGTTAATGGAATCGAGTTACTATGCA
TTCGCTGTCGACATGTGGAGCATCGGCTGCACATTTGCCGAATTGCTATG
TCGTAGAATTCTATTTCAGGCCAAAGGACCATTGGAGCAACTAGATCTTA
TTTTGAACATAGTCGGTACGCCTCCATTAACTGATTTATGTCATGCACAT
CCAGATGCTCGGTATTATGTTTTATCAAAAAGGAAAAAGAAACCAAATCT
TGGCATGATTGCTAAATGGAGTAATAATGTCACCGAGGAAGCTTTGCGGC
TACTCGATTCAATGTTGAAGTTTAATCCGGACCATCGGATAAGCTCAGAA
GAAGCACTATCTCACTCATATCTCGACGATGCTCGGTTACGGTATCATTC
TTGTATGTGTTCTTGTTGTCACGATCACCAGGATAGCAGCAAACCAAATG
ACGGAATCGTCAGAAATTTCTGTATAGATTCAGAGCCAATTTGCCCAAAA
CCCATATCGTCAACTATCGATAATTCTTTCACAAAAATGTCAGAAGCTAA
AGAAACTATAAAAAAGTTTATCAAAAACTACTATCAGAAAGACCAATATC
GGCTTCGTTTAGTATTAAATCCCAACTCCAAAAATTATCAGCCTTTATTG
ACGTCATCAGTTGCTCAAGCAAAAGAAGATCCAACCAATCACAAGTGGTA
GTCTGTACCGATTCCCTTGTAAATGCCTCTGTACCCCAGCTGTCTTCTTC
TTTCTCTCCCTCACCCCGCTTCCTTCTCCCAGTTTCCTTTCTCTGTACAA
ATTATTTGAACTTTGATTTACTTTGTACATTCAATACTTTTTATTGCCAC
AATCTTTTGTCTGAGAAAACTCAATTCTTTCGAATTCTACCTTCGAACCT
AGTTCTCTTCAATTATCTACTTGACTCGGTCGTTATTTTGTATATCTCTA
TAATATACTATGTATTATGATTTTGTTGACCTATGCATTTATTATTTATT
ATCCGACATGGTGTAACGTATATATATATACTGACAGCTCTTGATGATTC
GCTATTGCAATCAACCAATCAACATCAACTGCGAAAAATTACCAGAATAG
CTTTTTTCAATTTTTTTTATATCAACGTTGTGTTTAGAAAGACCGGCACT
TGTGTTGATGTGTGCTCGGGGAATCGAATAGTTTTATTGAATTTATAAAT
GTTTTTAAATCACAATTTTCTGTTTTTAATTGAAATAAATTTTTTTTAAT
TAAAAAG
back to top

protein sequence of SMED30035424-orf-1

>SMED30035424-orf-1 ID=SMED30035424-orf-1|Name=SMED30035424-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=466bp
MLVGQRIHAGVTSLTSSKSNNFKSKSQTELDSKLMRDDKQEEALLAVIDE
ANGCYAPILLNNKCEDNTLWERPLGYGAFGVVWSVFDPRTRKKAALKRIP
NIFHNTVTAKRLYRELFILSHIKHENIISLVDIVKSDHSFINDEIYILCD
FMQTDLHKIIVSPQALSVDHVKIFLYQILRGVKYLHSAHIIHRDIKPGNM
LVNSNCLLKICDFGLARIEDKRNISPLTQEVVTQYYRAPELLMESSYYAF
AVDMWSIGCTFAELLCRRILFQAKGPLEQLDLILNIVGTPPLTDLCHAHP
DARYYVLSKRKKKPNLGMIAKWSNNVTEEALRLLDSMLKFNPDHRISSEE
ALSHSYLDDARLRYHSCMCSCCHDHQDSSKPNDGIVRNFCIDSEPICPKP
ISSTIDNSFTKMSEAKETIKKFIKNYYQKDQYRLRLVLNPNSKNYQPLLT
SSVAQAKEDPTNHKW*
back to top
Aliases
The feature 'NLK-1' has the following synonyms
Synonym
NLK-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000009sigma neoblast
PLANA:0000039gamma neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR003527MAP_kinase_CS
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004707MAP kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0000165MAPK cascade
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 68..357
e-value: 2.3E-82
score: 289.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 72..357
e-value: 2.1E-62
score: 210.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 68..357
score: 43.015
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 72..153
e-value: 2.9E-102
score: 344.1
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 154..366
e-value: 2.9E-102
score: 344.1
NoneNo IPR availablePANTHERPTHR24055MITOGEN-ACTIVATED PROTEIN KINASEcoord: 68..461
NoneNo IPR availablePANTHERPTHR24055:SF380SERINE/THREONINE-PROTEIN KINASE NLKcoord: 68..461
IPR003527Mitogen-activated protein (MAP) kinase, conserved sitePROSITEPS01351MAPKcoord: 103..206
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 190..202
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 74..97
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 71..361