Helicase ATP-binding domain-containing protein

Overview
NameHelicase ATP-binding domain-containing protein
Smed IDSMED30035415
Length (bp)2646
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Helicase ATP-binding domain-containing protein (SMED30035415) t-SNE clustered cells

Violin plots show distribution of expression levels for Helicase ATP-binding domain-containing protein (SMED30035415) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Helicase ATP-binding domain-containing protein (SMED30035415) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Helicase ATP-binding domain-containing protein (SMED30035415) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035415

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30035415SMESG000025070.1 SmedASXL_014594SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30035415SMESG000025070.1 SmedASXL_014594SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035415SMESG000025070.1 SmedASXL_014594SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30035415SMESG000025070.1 dd_Smed_v4_19858_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30035415SMESG000025070.1 Contig28636newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035415SMESG000025070.1 Contig28636uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
zeta neoblastSMED30035415SMESG000025070.1 dd_Smed_v4_19858_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035415SMESG000025070.1 SMED_10972_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035415SMESG000025070.1 SMED_10972_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Human
Match: DDX11 (DEAD/H-box helicase 11 [Source:HGNC Symbol;Acc:HGNC:2736])

HSP 1 Score: 153.295 bits (386), Expect = 1.702e-37
Identity = 78/219 (35.62%), Postives = 123/219 (56.16%), Query Frame = 2
Query: 1520 CQNLKSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIM----RNFTASAKSN---KGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYG-----SESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            C     +  GVV FF SY  + ++   W+  G+L  +   K ++ E K + Q E ++    R   A  +      GA+L +V+G KMSEGINFSD L R V++VG+P+P  RS  LQEKM+Y+++        +   + +  NL MK VNQ+IGRAIRH+ DFA+++LLD+RYA    +++         LP+W++  V ++      I+ ++ F  +K
Sbjct:  667 CNLCGVVPGGVVCFFPSYEYLRQVHAHWEKGGLLGRLAARKKIFQEPKSAHQVEQVLLAYSRCIQACGQERGQVTGALLLSVVGGKMSEGINFSDNLGRCVVMVGMPFPNIRSAELQEKMAYLDQTLPRAPGQAPPGKALVENLCMKAVNQSIGRAIRHQKDFASVVLLDQRYARPPVLAK---------LPAWIRARVEVKATFGPAIAAVQKFHREK 876          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Human
Match: DDX11 (DEAD/H-box helicase 11 [Source:HGNC Symbol;Acc:HGNC:2736])

HSP 1 Score: 152.91 bits (385), Expect = 2.215e-37
Identity = 76/219 (34.70%), Postives = 124/219 (56.62%), Query Frame = 2
Query: 1520 CQNLKSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSN-------KGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYG-----SESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            C     +  GVV FF SY  + ++   W+  G+L  +   K ++ E K + Q E ++  ++   ++         GA+L +V+G KMSEGINFSD L R V++VG+P+P  RS  LQEKM+Y+++        +   + +  NL MK VNQ+IGRAIRH+ DFA+++LLD+RYA    +++         LP+W++  V ++      I+ ++ F  +K
Sbjct:  693 CNLCGVVPGGVVCFFPSYEYLRQVHAHWEKGGLLGRLAARKKIFQEPKSAHQVEQVLLAYSRCIQACGQERGQVTGALLLSVVGGKMSEGINFSDNLGRCVVMVGMPFPNIRSAELQEKMAYLDQTLPRAPGQAPPGKALVENLCMKAVNQSIGRAIRHQKDFASVVLLDQRYARPPVLAK---------LPAWIRARVEVKATFGPAIAAVQKFHREK 902          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Human
Match: DDX11 (DEAD/H-box helicase 11 [Source:HGNC Symbol;Acc:HGNC:2736])

HSP 1 Score: 126.716 bits (317), Expect = 6.442e-33
Identity = 60/144 (41.67%), Postives = 92/144 (63.89%), Query Frame = 2
Query: 1724 GAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYG-----SESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            GA+L +V+G KMSEGINFSD L R V++VG+P+P  RS  LQEKM+Y+++        +   + +  NL MK VNQ+IGRAIRH+ DFA+++LLD+RYA    +++         LP+W++  V ++      I+ ++ F  +K
Sbjct:   34 GALLLSVVGGKMSEGINFSDNLGRCVVMVGMPFPNIRSAELQEKMAYLDQTLPRAPGQAPPGKALVENLCMKAVNQSIGRAIRHQKDFASVVLLDQRYARPPVLAK---------LPAWIRARVEVKATFGPAIAAVQKFHREK 168          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Human
Match: DDX11 (DEAD/H-box helicase 11 [Source:HGNC Symbol;Acc:HGNC:2736])

HSP 1 Score: 127.102 bits (318), Expect = 2.746e-29
Identity = 64/177 (36.16%), Postives = 105/177 (59.32%), Query Frame = 2
Query: 1646 VYIEQKQSLQNENIMRNFTASAKSN-------KGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYG-----SESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            ++ E K + Q E ++  ++   ++         GA+L +V+G KMSEGINFSD L R V++VG+P+P  RS  LQEKM+Y+++        +   + +  NL MK VNQ+IGRAIRH+ DFA+++LLD+RYA    +++         LP+W++  V ++      I+ ++ F  +K
Sbjct:  685 IFQEPKSAHQVEQVLLAYSRCIQACGQERGQVTGALLLSVVGGKMSEGINFSDNLGRCVVMVGMPFPNIRSAELQEKMAYLDQTLPRAPGQAPPGKALVENLCMKAVNQSIGRAIRHQKDFASVVLLDQRYARPPVLAK---------LPAWIRARVEVKATFGPAIAAVQKFHREK 852          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Human
Match: RTEL1 (regulator of telomere elongation helicase 1 [Source:HGNC Symbol;Acc:HGNC:15888])

HSP 1 Score: 125.946 bits (315), Expect = 8.184e-29
Identity = 66/204 (32.35%), Postives = 108/204 (52.94%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTA--SAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSE-------SSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            G++IFF SY VM+K +E W+++ +  +++ LK +++E +        +  + A  +A  + GA   AV   K SEG++FSD   R VI+ G+PYP    P +  KM ++++  G         S +  Y   A + VNQAIGR IRH+ D+ A+ L D R+A             +  LPSW++  V + +N   +I ++  FF
Sbjct:  332 GLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGSTGATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRFA---------FADARAQLPSWVRPHVRVYDNFGHVIRDVAQFF 526          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Celegans
Match: chl-1 (ATP-dependent DNA helicase chl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21489])

HSP 1 Score: 158.303 bits (399), Expect = 1.324e-39
Identity = 81/198 (40.91%), Postives = 125/198 (63.13%), Query Frame = 2
Query: 1538 ILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            I +GVVIF  SY+ +    ++ +  G+L  I++ K+V+ E +Q     ++   F+ +AK++KGA+LFAV+G KMSEGINF DEL R VI++G+PYP   S  L+E+M +++ Q  +    ++Y +L M  VNQAIGRAIRH+ D+AA+ L D+RYA      E+  RK    L +W+ D   ++     +I + +SFF
Sbjct:  639 IPNGVVIFVPSYDFLFNFQKKMKEFGILKRIEEKKAVFTESRQP--TSDVWDRFSRAAKTSKGAILFAVVGGKMSEGINFCDELGRAVIVIGLPYPNKTSVELRERMKFLDTQMPN-GGNLLYESLCMHAVNQAIGRAIRHRRDYAAVYLFDDRYA-----KESTRRK----LSTWIGDRTQVKLGFGEIIRKTRSFF 824          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Celegans
Match: chl-1 (ATP-dependent DNA helicase chl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21489])

HSP 1 Score: 158.303 bits (399), Expect = 1.324e-39
Identity = 81/198 (40.91%), Postives = 125/198 (63.13%), Query Frame = 2
Query: 1538 ILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            I +GVVIF  SY+ +    ++ +  G+L  I++ K+V+ E +Q     ++   F+ +AK++KGA+LFAV+G KMSEGINF DEL R VI++G+PYP   S  L+E+M +++ Q  +    ++Y +L M  VNQAIGRAIRH+ D+AA+ L D+RYA      E+  RK    L +W+ D   ++     +I + +SFF
Sbjct:  639 IPNGVVIFVPSYDFLFNFQKKMKEFGILKRIEEKKAVFTESRQP--TSDVWDRFSRAAKTSKGAILFAVVGGKMSEGINFCDELGRAVIVIGLPYPNKTSVELRERMKFLDTQMPN-GGNLLYESLCMHAVNQAIGRAIRHRRDYAAVYLFDDRYA-----KESTRRK----LSTWIGDRTQVKLGFGEIIRKTRSFF 824          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Celegans
Match: xpd-1 (XPD (Xeroderma Pigmentosum complementation group D) related [Source:UniProtKB/TrEMBL;Acc:Q9N3L2])

HSP 1 Score: 127.102 bits (318), Expect = 7.922e-30
Identity = 62/177 (35.03%), Postives = 108/177 (61.02%), Query Frame = 2
Query: 1544 DGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKD 2074
            DG+V+FF+SY  M+ +I  W  + ++ E+ K K ++IE   +L+    +  +  +  S +GAVLF+V   K+SEGI+FS  L R VI++GIPY  T S +L+ ++ Y+  Q+G + +  +  + AM+   Q +GRA+R K D+  ++  D+R+      S N+ ++GK  LP W+++
Sbjct:  527 DGMVVFFTSYLYMENVIGVWYEQHIIDELMKYKLLFIETNDALETSAALEKYVEACDSGRGAVLFSVARGKVSEGIDFSHHLGRCVIMLGIPYMYTESRVLRARLEYLRDQFGIKENDFLTFD-AMRHTAQCMGRALRSKTDYGLMVFADKRF------SRND-KRGK--LPRWMQE 693          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Celegans
Match: dog-1 (Deletions Of G-rich DNA [Source:UniProtKB/TrEMBL;Acc:O62217])

HSP 1 Score: 99.7525 bits (247), Expect = 3.684e-21
Identity = 57/170 (33.53%), Postives = 96/170 (56.47%), Query Frame = 2
Query: 1520 CQNLKSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTAS-------AKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVE---KQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDER 1999
            C N+ +   G++ F  SY V+D++ +       + +I+  K V  E ++S +  ++M  F A+         +  G+++FAV   K+SEGI+F+D+ AR+VI VGIPYP      +  K  Y +   K+ G  +    Y   A + +NQA+GR +RHKND+ A++++DER
Sbjct:  759 CSNVPA---GILCFLPSYRVLDQLKQCMIRNSTMRQIEMKKVVLYEPRRSSELTSVMDQFDAAIFDPSRFGANINGSLMFAVFRGKVSEGIDFADDRARVVISVGIPYPNAMDDQVNAKKLYNDQNSKEKGILTGDEWYTTQAYRALNQALGRCLRHKNDWGAMLMIDER 925          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Celegans
Match: rtel-1 (Regulator of telomere elongation helicase 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93575])

HSP 1 Score: 98.9821 bits (245), Expect = 7.630e-21
Identity = 70/219 (31.96%), Postives = 117/219 (53.42%), Query Frame = 2
Query: 1529 LKSILDGVVIFFSSYNVMDKIIEEWQS--------KGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYG-------SESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            ++ I  G++IFFSSY+ MD+++  W++        +    +++K K V +E +   +   I   +T       GA L AV   K+SEGI+F D  +R VII+GIPYP      +  K  Y++   G        +SS+  Y   A + VNQAIGR +RHK+DF  ++L+D RYA     ++ E+       P WL++++S +++T+    +   FF ++
Sbjct:  560 MEVIPQGILIFFSSYSQMDELVATWKTTKWSSNSNESFWEKMEKTKRVVVEPRAKEELAAIRLRYTQGVSEQHGAALLAVCRGKVSEGIDFCDAESRAVIIIGIPYPPIHDERVVLKKMYLDDLMGRKDTKSERQSSQDWYQMEAFRAVNQAIGRVLRHKDDFGTVVLMDTRYAS----AKPEM------FPKWLRNTIS-RSDTDGCALKTSRFFKER 767          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Fly
Match: CG11403 (gene:FBgn0026876 transcript:FBtr0070245)

HSP 1 Score: 137.117 bits (344), Expect = 8.956e-33
Identity = 73/187 (39.04%), Postives = 113/187 (60.43%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAK--SNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTN 2101
            GVV F  SY  +DK+ +  +  G L  I   KSV+ E   S   E ++ N+  + K  ++ GA+L +V+G K+SEG+NF+D+L R V++VG+PY  + SP L+++M +++++ G  +    Y NL +K VNQ IGRA+RH  D+A + LLD+R+AD  KI      +GK  LP W+   +   N  N
Sbjct:  669 GVVCFLPSYEYLDKVYKYLEQSGTLETISGRKSVFREVSGS--AEQLLDNYALAIKRPASYGALLLSVVGGKLSEGLNFADDLGRAVLVVGLPYSNSLSPELRQRMQHLDEKLGPGAGNEYYENLCVKAVNQCIGRAVRHIKDYACVYLLDKRFAD-PKI------RGK--LPKWISRHIVEANAAN 844          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Fly
Match: CG4078 (gene:FBgn0029798 transcript:FBtr0070807)

HSP 1 Score: 135.191 bits (339), Expect = 5.825e-32
Identity = 67/205 (32.68%), Postives = 118/205 (57.56%), Query Frame = 2
Query: 1538 ILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIM---YHNL-AMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTN---SLISELKSFF 2131
            + DG+++FF SY +++K ++ WQ+ G+ ++I   K +++E +   Q  + M  F  + + +KGAV  AV   K+SEG++F+D   R VII G+P+P  + P +  K  Y+E     E+  +    ++NL A + VNQAIGR IRH+ND+ AI+L D R+ D +++ +         L  W++  +  +   +    ++ EL+ FF
Sbjct:  553 VPDGLLVFFPSYPMLNKCVDAWQASGLWADISCKKPIFLEPRSKDQFTSTMEEFYQAIRDSKGAVFMAVCRGKVSEGLDFADRNGRAVIITGLPFPPLKDPKVILKRRYLEANRTRENQLLSGQEWYNLDATRAVNQAIGRVIRHRNDYGAILLCDSRFKDASQVQQ---------LSKWIRGHLGDRPQCSPFGPIVRELRQFF 748          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Fly
Match: CG4078 (gene:FBgn0029798 transcript:FBtr0332398)

HSP 1 Score: 135.191 bits (339), Expect = 5.825e-32
Identity = 67/205 (32.68%), Postives = 118/205 (57.56%), Query Frame = 2
Query: 1538 ILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIM---YHNL-AMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTN---SLISELKSFF 2131
            + DG+++FF SY +++K ++ WQ+ G+ ++I   K +++E +   Q  + M  F  + + +KGAV  AV   K+SEG++F+D   R VII G+P+P  + P +  K  Y+E     E+  +    ++NL A + VNQAIGR IRH+ND+ AI+L D R+ D +++ +         L  W++  +  +   +    ++ EL+ FF
Sbjct:  553 VPDGLLVFFPSYPMLNKCVDAWQASGLWADISCKKPIFLEPRSKDQFTSTMEEFYQAIRDSKGAVFMAVCRGKVSEGLDFADRNGRAVIITGLPFPPLKDPKVILKRRYLEANRTRENQLLSGQEWYNLDATRAVNQAIGRVIRHRNDYGAILLCDSRFKDASQVQQ---------LSKWIRGHLGDRPQCSPFGPIVRELRQFF 748          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Fly
Match: Xpd (gene:FBgn0261850 transcript:FBtr0071576)

HSP 1 Score: 115.931 bits (289), Expect = 4.199e-26
Identity = 54/183 (29.51%), Postives = 102/183 (55.74%), Query Frame = 2
Query: 1532 KSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSV 2080
            K++ DG+V FF+SY  ++ ++  W  +G++  + + K ++IE + + +    + N+  +    +GAVL AV   K+SEG++F     R V++ GIPY  T+S IL+ ++ Y+  Q+    +  +  + AM+   Q +GRA+R K D+  +I  D+R++   K S          LP W+++ +
Sbjct:  529 KTVPDGIVCFFTSYLYLESVVASWYDQGIVDTLLRYKLLFIETQDNAETSYALMNYVKACDCGRGAVLLAVARGKVSEGVDFDHHYGRAVLMFGIPYVYTQSRILKARLDYLRDQFQIRENDFLTFD-AMRHAAQCVGRALRGKTDYGIMIFADKRFSRHDKRSR---------LPKWIQEHL 701          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Zebrafish
Match: ddx11 (DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 [Source:NCBI gene;Acc:492353])

HSP 1 Score: 168.318 bits (425), Expect = 1.653e-42
Identity = 85/218 (38.99%), Postives = 125/218 (57.34%), Query Frame = 2
Query: 1526 NLKSILDG-VVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTAS-------AKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY----GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKL-GLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            NL +I+ G VV FF SY    +I+  W+S G+L  ++  K ++ E K++ Q E ++  ++              GA+LF+V+G KMSEGINFSD+L R +++VG+PYP  +SP LQEKM+Y++K      G    + +  +L MK VNQ+IGRAIRH+ D+A I+L D RYA          R G L  LP W++ S           +  + FFL+K
Sbjct:  648 NLCNIVPGGVVCFFPSYEYEKRILGHWESTGILQRLQSKKKIFQEPKKASQVEQVLSEYSKCIQRCSNIGGGQTGALLFSVVGGKMSEGINFSDDLGRCIVMVGMPYPNIKSPELQEKMAYLDKHMPHVAGKSPGKALVESLCMKAVNQSIGRAIRHRGDYACIVLCDHRYA----------RTGTLQKLPEWIRSSTHTHATFGPAFASARRFFLEK 855          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Zebrafish
Match: ddx11 (DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 [Source:NCBI gene;Acc:492353])

HSP 1 Score: 168.318 bits (425), Expect = 1.791e-42
Identity = 85/218 (38.99%), Postives = 125/218 (57.34%), Query Frame = 2
Query: 1526 NLKSILDG-VVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTAS-------AKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY----GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKL-GLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            NL +I+ G VV FF SY    +I+  W+S G+L  ++  K ++ E K++ Q E ++  ++              GA+LF+V+G KMSEGINFSD+L R +++VG+PYP  +SP LQEKM+Y++K      G    + +  +L MK VNQ+IGRAIRH+ D+A I+L D RYA          R G L  LP W++ S           +  + FFL+K
Sbjct:  677 NLCNIVPGGVVCFFPSYEYEKRILGHWESTGILQRLQSKKKIFQEPKKASQVEQVLSEYSKCIQRCSNIGGGQTGALLFSVVGGKMSEGINFSDDLGRCIVMVGMPYPNIKSPELQEKMAYLDKHMPHVAGKSPGKALVESLCMKAVNQSIGRAIRHRGDYACIVLCDHRYA----------RTGTLQKLPEWIRSSTHTHATFGPAFASARRFFLEK 884          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Zebrafish
Match: ercc2 (excision repair cross-complementation group 2 [Source:ZFIN;Acc:ZDB-GENE-040426-997])

HSP 1 Score: 121.324 bits (303), Expect = 9.529e-28
Identity = 65/203 (32.02%), Postives = 114/203 (56.16%), Query Frame = 2
Query: 1544 DGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISE---LKSFFLQKI 2143
            DG+V FF+SY  M+ I+  W  +G+L  I++ K ++IE + + +    +  +  + ++ +GA+L +V   K+SEGI+F     R VI+ G+PY  T+S IL+ ++ Y+  Q+    +  +  + AM+   Q +GRAIR K D+  +I  D+RYA   K       +GK  LP W+++ ++   + N  I E   L   FL+++
Sbjct:  533 DGIVAFFTSYMYMENIVASWYEQGILENIQRNKLIFIETQDAAETSMALEKYQEACENGRGAILLSVARGKVSEGIDFVHHFGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFD-AMRHAAQCVGRAIRGKTDYGLMIFADKRYARADK-------RGK--LPRWIQEHLT-DGSLNLTIDETVQLSKHFLRQM 724          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Zebrafish
Match: rtel1 (regulator of telomere elongation helicase 1 [Source:NCBI gene;Acc:503732])

HSP 1 Score: 120.553 bits (301), Expect = 2.558e-27
Identity = 63/204 (30.88%), Postives = 107/204 (52.45%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAK--SNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIM-------YHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            G+++FF SY VMDK +E W++KG    I+ +K +++E +       ++  +       ++ G   FAV   K SEG++F+D   R V+I G+P+P    P +  KM Y+++   ++ S +        Y   A + VNQAIGR IRH+ D+ AI L D R+      ++         LPSW++  V I +   +++ ++  FF
Sbjct:  554 GLLVFFPSYPVMDKTLEFWRAKGHADRIENVKPMFVEPRGKGTFTEVIDGYYGKVDDPNSSGGSFFAVCRGKASEGLDFADTYGRGVVITGLPFPPRMDPRVVLKMQYLDEMCRNKISGVKYLTGQEWYRQQASRAVNQAIGRVIRHREDYGAIFLCDHRFKSADARNQ---------LPSWVRPYVKIYDGFGTMVRDVAQFF 748          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Zebrafish
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:ZFIN;Acc:ZDB-GENE-081107-11])

HSP 1 Score: 113.62 bits (283), Expect = 3.862e-25
Identity = 64/212 (30.19%), Postives = 111/212 (52.36%), Query Frame = 2
Query: 1529 LKSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNE---------NIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSES---SRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSF 2128
              ++  GV+ F  SY ++DK+ + W + G+  ++++ K+V  E +   + +           +R   A  +   GA+L AV   K+SEG++F+D+ AR V+ +GIP+P  +   ++ KM Y +K   S         Y   A + +NQA+GR IRH+ND+ A+IL+D+R+    + + N   K   GL  W++  V   +     +  LKSF
Sbjct:  712 CHTVSRGVLCFLPSYKMLDKLRDRWTNTGLWDKLEECKTVITEPRGGGKGDFDELLQTYYEAIRGTAAKGEKRDGALLVAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDKHAKSRGLLPGGRWYEIQAYRALNQALGRCIRHRNDWGALILVDDRF----RTNPN---KYITGLSKWVRQLVRHHDTFTGAMQSLKSF 916          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Xenopus
Match: crat (carnitine O-acetyltransferase b [Source:Xenbase;Acc:XB-GENE-487012])

HSP 1 Score: 171.4 bits (433), Expect = 1.482e-43
Identity = 87/210 (41.43%), Postives = 129/210 (61.43%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIM-------RNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY----GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLG-LPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            G+V FF SY    +I E W+  G+L  +   K ++ E K++ Q + ++       +N + S  +  GA+LF+V+G KMSEGINFSD+L R +++VG+PYP  RSP LQEKMSY++K      G  + R++  NL MK VNQ+IGRAIRH+ D+A+I+LLD RY+          R   LG LP W++ S  ++ N  +  + ++ FF QK
Sbjct:  592 GLVCFFPSYEYQKRIQEHWEKSGLLKRLALKKKIFQEPKRANQVDQVLVEYSKCIKNCSQSGGAQNGALLFSVVGGKMSEGINFSDDLGRCIVMVGMPYPNIRSPELQEKMSYLDKTLPKTEGVSAGRVLIENLCMKAVNQSIGRAIRHRGDYASIVLLDHRYS----------RPAILGKLPQWIRSSTQVKPNFGAAFATIRKFFQQK 791          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Xenopus
Match: crat (carnitine O-acetyltransferase b [Source:Xenbase;Acc:XB-GENE-487012])

HSP 1 Score: 171.785 bits (434), Expect = 1.605e-43
Identity = 87/206 (42.23%), Postives = 128/206 (62.14%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSN---KGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY----GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLG-LPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            G+V FF SY    +I E W+  G+L  +   K ++ E K++ Q + ++  ++   KS     GA+LF+V+G KMSEGINFSD+L R +++VG+PYP  RSP LQEKMSY++K      G  + R++  NL MK VNQ+IGRAIRH+ D+A+I+LLD RY+          R   LG LP W++ S  ++ N  +  + ++ FF QK
Sbjct:  630 GLVCFFPSYEYQKRIQEHWEKSGLLKRLALKKKIFQEPKRANQVDQVLVEYSKCIKSGGAQNGALLFSVVGGKMSEGINFSDDLGRCIVMVGMPYPNIRSPELQEKMSYLDKTLPKTEGVSAGRVLIENLCMKAVNQSIGRAIRHRGDYASIVLLDHRYS----------RPAILGKLPQWIRSSTQVKPNFGAAFATIRKFFQQK 825          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Xenopus
Match: crat (carnitine O-acetyltransferase b [Source:Xenbase;Acc:XB-GENE-487012])

HSP 1 Score: 171.785 bits (434), Expect = 1.826e-43
Identity = 87/210 (41.43%), Postives = 129/210 (61.43%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIM-------RNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY----GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLG-LPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            G+V FF SY    +I E W+  G+L  +   K ++ E K++ Q + ++       +N + S  +  GA+LF+V+G KMSEGINFSD+L R +++VG+PYP  RSP LQEKMSY++K      G  + R++  NL MK VNQ+IGRAIRH+ D+A+I+LLD RY+          R   LG LP W++ S  ++ N  +  + ++ FF QK
Sbjct:  692 GLVCFFPSYEYQKRIQEHWEKSGLLKRLALKKKIFQEPKRANQVDQVLVEYSKCIKNCSQSGGAQNGALLFSVVGGKMSEGINFSDDLGRCIVMVGMPYPNIRSPELQEKMSYLDKTLPKTEGVSAGRVLIENLCMKAVNQSIGRAIRHRGDYASIVLLDHRYS----------RPAILGKLPQWIRSSTQVKPNFGAAFATIRKFFQQK 891          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Xenopus
Match: crat (carnitine O-acetyltransferase b [Source:Xenbase;Acc:XB-GENE-487012])

HSP 1 Score: 164.081 bits (414), Expect = 7.364e-42
Identity = 83/204 (40.69%), Postives = 125/204 (61.27%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIM-------RNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY----GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLG-LPSWLKDSVSIQNNTNSLISELK 2122
            G+V FF SY    +I E W+  G+L  +   K ++ E K++ Q + ++       +N + S  +  GA+LF+V+G KMSEGINFSD+L R +++VG+PYP  RSP LQEKMSY++K      G  + R++  NL MK VNQ+IGRAIRH+ D+A+I+LLD RY+          R   LG LP W++ S  ++ N  +  + ++
Sbjct:  373 GLVCFFPSYEYQKRIQEHWEKSGLLKRLALKKKIFQEPKRANQVDQVLVEYSKCIKNCSQSGGAQNGALLFSVVGGKMSEGINFSDDLGRCIVMVGMPYPNIRSPELQEKMSYLDKTLPKTEGVSAGRVLIENLCMKAVNQSIGRAIRHRGDYASIVLLDHRYS----------RPAILGKLPQWIRSSTQVKPNFGAAFATIR 566          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Xenopus
Match: crat (carnitine O-acetyltransferase b [Source:Xenbase;Acc:XB-GENE-487012])

HSP 1 Score: 164.081 bits (414), Expect = 5.596e-41
Identity = 83/204 (40.69%), Postives = 125/204 (61.27%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIM-------RNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY----GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLG-LPSWLKDSVSIQNNTNSLISELK 2122
            G+V FF SY    +I E W+  G+L  +   K ++ E K++ Q + ++       +N + S  +  GA+LF+V+G KMSEGINFSD+L R +++VG+PYP  RSP LQEKMSY++K      G  + R++  NL MK VNQ+IGRAIRH+ D+A+I+LLD RY+          R   LG LP W++ S  ++ N  +  + ++
Sbjct:  654 GLVCFFPSYEYQKRIQEHWEKSGLLKRLALKKKIFQEPKRANQVDQVLVEYSKCIKNCSQSGGAQNGALLFSVVGGKMSEGINFSDDLGRCIVMVGMPYPNIRSPELQEKMSYLDKTLPKTEGVSAGRVLIENLCMKAVNQSIGRAIRHRGDYASIVLLDHRYS----------RPAILGKLPQWIRSSTQVKPNFGAAFATIR 847          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Mouse
Match: Ddx11 (DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 [Source:MGI Symbol;Acc:MGI:2443590])

HSP 1 Score: 155.992 bits (393), Expect = 1.691e-38
Identity = 78/219 (35.62%), Postives = 124/219 (56.62%), Query Frame = 2
Query: 1520 CQNLKSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSN-------KGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEK-----QYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            C     +  GVV F  SY  + ++   W   G+L+ +   K ++ E K++ Q E ++  ++    S         GA+L +V+G KMSEGINFSD+L R V++VG+PYP  +SP LQEKM+Y+ +     Q       ++  NL MK +NQ+IGRAIRH+ DFA+I+LLD RYA  + +++         LP+W++D V ++       + ++ F  +K
Sbjct:  691 CNLCNVVPGGVVCFLPSYEYLRQVHAHWDKTGLLTRLSVRKKIFQEPKRASQVEQVLMAYSKCIMSCSHSEGHLTGALLLSVVGGKMSEGINFSDDLGRCVVMVGMPYPNIKSPELQEKMAYLNQTLPRTQGQPLPGTVLIENLCMKAINQSIGRAIRHQRDFASIVLLDHRYARPSILAK---------LPAWIRDRVEVKATFGPAFAAVRKFHREK 900          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Mouse
Match: Ddx11 (DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 [Source:MGI Symbol;Acc:MGI:2443590])

HSP 1 Score: 155.992 bits (393), Expect = 1.792e-38
Identity = 78/219 (35.62%), Postives = 124/219 (56.62%), Query Frame = 2
Query: 1520 CQNLKSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSN-------KGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEK-----QYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            C     +  GVV F  SY  + ++   W   G+L+ +   K ++ E K++ Q E ++  ++    S         GA+L +V+G KMSEGINFSD+L R V++VG+PYP  +SP LQEKM+Y+ +     Q       ++  NL MK +NQ+IGRAIRH+ DFA+I+LLD RYA  + +++         LP+W++D V ++       + ++ F  +K
Sbjct:  665 CNLCNVVPGGVVCFLPSYEYLRQVHAHWDKTGLLTRLSVRKKIFQEPKRASQVEQVLMAYSKCIMSCSHSEGHLTGALLLSVVGGKMSEGINFSDDLGRCVVMVGMPYPNIKSPELQEKMAYLNQTLPRTQGQPLPGTVLIENLCMKAINQSIGRAIRHQRDFASIVLLDHRYARPSILAK---------LPAWIRDRVEVKATFGPAFAAVRKFHREK 874          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Mouse
Match: Rtel1 (regulator of telomere elongation helicase 1 [Source:MGI Symbol;Acc:MGI:2139369])

HSP 1 Score: 127.102 bits (318), Expect = 2.504e-29
Identity = 69/208 (33.17%), Postives = 111/208 (53.37%), Query Frame = 2
Query: 1538 ILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNF---TASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSE-------SSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            +  G+++FF SY VM+K +E WQ +G+  +++ LK +++E +       ++  +    AS  SN GA   AV   K SEG++FSD   R VI+ G+PYP    P +  KM ++++  G         S +  Y   A + VNQAIGR IRH++D+ AI L D R+A             +  LPSW++  + + +N   +I ++  FF
Sbjct:  368 VPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLFVEPRNKGSFSEVIDAYYQQVASPASN-GATFLAVCRGKASEGLDFSDMNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMRGRSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGAIFLCDHRFA---------YADARAQLPSWVRPYLKVYDNFGHVIRDVAQFF 565          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Mouse
Match: Rtel1 (regulator of telomere elongation helicase 1 [Source:MGI Symbol;Acc:MGI:2139369])

HSP 1 Score: 127.102 bits (318), Expect = 2.537e-29
Identity = 69/208 (33.17%), Postives = 111/208 (53.37%), Query Frame = 2
Query: 1538 ILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNF---TASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSE-------SSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            +  G+++FF SY VM+K +E WQ +G+  +++ LK +++E +       ++  +    AS  SN GA   AV   K SEG++FSD   R VI+ G+PYP    P +  KM ++++  G         S +  Y   A + VNQAIGR IRH++D+ AI L D R+A             +  LPSW++  + + +N   +I ++  FF
Sbjct:  552 VPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLFVEPRNKGSFSEVIDAYYQQVASPASN-GATFLAVCRGKASEGLDFSDMNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMRGRSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGAIFLCDHRFA---------YADARAQLPSWVRPYLKVYDNFGHVIRDVAQFF 749          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Mouse
Match: Rtel1 (regulator of telomere elongation helicase 1 [Source:MGI Symbol;Acc:MGI:2139369])

HSP 1 Score: 127.102 bits (318), Expect = 2.548e-29
Identity = 69/208 (33.17%), Postives = 111/208 (53.37%), Query Frame = 2
Query: 1538 ILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNF---TASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSE-------SSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            +  G+++FF SY VM+K +E WQ +G+  +++ LK +++E +       ++  +    AS  SN GA   AV   K SEG++FSD   R VI+ G+PYP    P +  KM ++++  G         S +  Y   A + VNQAIGR IRH++D+ AI L D R+A             +  LPSW++  + + +N   +I ++  FF
Sbjct:  552 VPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLFVEPRNKGSFSEVIDAYYQQVASPASN-GATFLAVCRGKASEGLDFSDMNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMRGRSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGAIFLCDHRFA---------YADARAQLPSWVRPYLKVYDNFGHVIRDVAQFF 749          
BLAST of Helicase ATP-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|F1R345|DDX11_DANRE (ATP-dependent DNA helicase DDX11 OS=Danio rerio OX=7955 GN=ddx11 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.352e-41
Identity = 85/218 (38.99%), Postives = 125/218 (57.34%), Query Frame = 2
Query: 1526 NLKSILDG-VVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTAS-------AKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY----GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKL-GLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            NL +I+ G VV FF SY    +I+  W+S G+L  ++  K ++ E K++ Q E ++  ++              GA+LF+V+G KMSEGINFSD+L R +++VG+PYP  +SP LQEKM+Y++K      G    + +  +L MK VNQ+IGRAIRH+ D+A I+L D RYA          R G L  LP W++ S           +  + FFL+K
Sbjct:  677 NLCNIVPGGVVCFFPSYEYEKRILGHWESTGILQRLQSKKKIFQEPKKASQVEQVLSEYSKCIQRCSNIGGGQTGALLFSVVGGKMSEGINFSDDLGRCIVMVGMPYPNIKSPELQEKMAYLDKHMPHVAGKSPGKALVESLCMKAVNQSIGRAIRHRGDYACIVLCDHRYA----------RTGTLQKLPEWIRSSTHTHATFGPAFASARRFFLEK 884          
BLAST of Helicase ATP-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q21489|CHL1_CAEEL (ATP-dependent DNA helicase chl-1 OS=Caenorhabditis elegans OX=6239 GN=chl-1 PE=3 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 1.684e-38
Identity = 81/198 (40.91%), Postives = 125/198 (63.13%), Query Frame = 2
Query: 1538 ILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            I +GVVIF  SY+ +    ++ +  G+L  I++ K+V+ E +Q     ++   F+ +AK++KGA+LFAV+G KMSEGINF DEL R VI++G+PYP   S  L+E+M +++ Q  +    ++Y +L M  VNQAIGRAIRH+ D+AA+ L D+RYA      E+  RK    L +W+ D   ++     +I + +SFF
Sbjct:  639 IPNGVVIFVPSYDFLFNFQKKMKEFGILKRIEEKKAVFTESRQP--TSDVWDRFSRAAKTSKGAILFAVVGGKMSEGINFCDELGRAVIVIGLPYPNKTSVELRERMKFLDTQMPN-GGNLLYESLCMHAVNQAIGRAIRHRRDYAAVYLFDDRYA-----KESTRRK----LSTWIGDRTQVKLGFGEIIRKTRSFF 824          
BLAST of Helicase ATP-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|A1D8E4|CHL1_NEOFI (ATP-dependent DNA helicase chl1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=chl1 PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 2.386e-38
Identity = 90/229 (39.30%), Postives = 140/229 (61.14%), Query Frame = 2
Query: 1520 CQNLKSILDGVVIFFSSYNVMDKIIEEWQ-----SKG--VLSEIKKLKSVYIEQKQ-SLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY-----GSESSRI---------MYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSV---SIQNNTNSLISELKSFF 2131
            CQ   +I DGVV FF SY+ + +I+  W+      KG  +LS I++ KS+  E +    + E++++ +T +  S +GA+L +V+G K+SEGINFSD+L R V+I+G+P+P  RS + Q K+ YVE++      GSE  R+          Y N  M+ VNQ IGRAIRH+ND+AAI+++D RY       E    +GK  LP+W+K S+   S++   ++L ++L +FF
Sbjct:  639 CQ---AIPDGVVAFFPSYDYLSRILAIWRKPLVGEKGQTILSLIERKKSILYEGRDMGAKTEDLLQEYTRTIDSGQGALLLSVVGGKLSEGINFSDKLGRGVLIIGLPFPNIRSAVWQAKIQYVEQKTYNSSSGSEKDRLSIAKAAGKDFYENACMRAVNQCIGRAIRHRNDYAAIVMIDRRY-------EKANIQGK--LPAWIKQSMLRRSVRRPASALAADLSNFF 855          
BLAST of Helicase ATP-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4WWE9|CHL1_ASPFU (ATP-dependent DNA helicase chl1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chl1 PE=3 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.131e-37
Identity = 89/229 (38.86%), Postives = 140/229 (61.14%), Query Frame = 2
Query: 1520 CQNLKSILDGVVIFFSSYNVMDKIIEEWQ-----SKG--VLSEIKKLKSVYIEQKQ-SLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY-----GSESSR---------IMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSV---SIQNNTNSLISELKSFF 2131
            CQ   +I DGVV FF SY+ + +I+  W+      KG  +LS I++ KS+  E +    + +++++ +T +  S +GA+L +V+G K+SEGINFSD+L R V+I+G+P+P  RS + Q K+ YVE++      GSE  R           Y N  M+ VNQ IGRAIRH+ND+AAI+++D RY       E    +GK  LP+W+K+S+   S++   ++L ++L +FF
Sbjct:  560 CQ---AIPDGVVAFFPSYDYLSRIVAIWRKPLEGEKGETILSLIEREKSILYEGRDMGPKTDDLLQEYTRTIDSGQGALLLSVVGGKLSEGINFSDKLGRGVLIIGLPFPNIRSAVWQAKIQYVEQKTYNSSSGSEKDRQSIAKAAGKDFYENACMRAVNQCIGRAIRHRNDYAAIVMIDRRY-------EKANIQGK--LPAWIKESMLRRSVRRPASALAADLSNFF 776          
BLAST of Helicase ATP-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6AXC6|DDX11_MOUSE (ATP-dependent DNA helicase DDX11 OS=Mus musculus OX=10090 GN=Ddx11 PE=1 SV=2)

HSP 1 Score: 155.992 bits (393), Expect = 1.183e-37
Identity = 78/219 (35.62%), Postives = 124/219 (56.62%), Query Frame = 2
Query: 1520 CQNLKSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSN-------KGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEK-----QYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            C     +  GVV F  SY  + ++   W   G+L+ +   K ++ E K++ Q E ++  ++    S         GA+L +V+G KMSEGINFSD+L R V++VG+PYP  +SP LQEKM+Y+ +     Q       ++  NL MK +NQ+IGRAIRH+ DFA+I+LLD RYA  + +++         LP+W++D V ++       + ++ F  +K
Sbjct:  691 CNLCNVVPGGVVCFLPSYEYLRQVHAHWDKTGLLTRLSVRKKIFQEPKRASQVEQVLMAYSKCIMSCSHSEGHLTGALLLSVVGGKMSEGINFSDDLGRCVVMVGMPYPNIKSPELQEKMAYLNQTLPRTQGQPLPGTVLIENLCMKAINQSIGRAIRHQRDFASIVLLDHRYARPSILAK---------LPAWIRDRVEVKATFGPAFAAVRKFHREK 900          
BLAST of Helicase ATP-binding domain-containing protein vs. TrEMBL
Match: A0A1B6I3H7 (HELICc2 domain-containing protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.9281 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 9.677e-43
Identity = 83/206 (40.29%), Postives = 126/206 (61.17%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTAS---AKSNK-----GAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            G++ FFSSY+    + + +   G + ++   K V+ E +++ Q + ++ +F AS   AK N      GA+LF+V+G K+SEG+NFSD+L R VI+VG+PYP  +SP LQEKMSY++K  G  + +  Y NL MK VNQ IGRA+RH  D+A ++LLD+RY    + S  +L      LP+W++ S+ +   T   I  +  FF  K
Sbjct:  116 GIICFFSSYDYEQTVYQHFVKSGTVDKLSTKKKVFREPRKANQVDQVLSDFAASINNAKKNPQIKPNGALLFSVVGGKLSEGLNFSDDLGRCVIVVGMPYPNVKSPELQEKMSYLDKTLGGNAGQQHYENLCMKAVNQCIGRAVRHSADYATVLLLDQRYE---RPSTQKL------LPAWIQTSLQLHQKTGPAIGTIARFFSSK 312          
BLAST of Helicase ATP-binding domain-containing protein vs. TrEMBL
Match: F2TY31 (Helicase ATP-binding domain-containing protein OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) OX=946362 GN=PTSG_00993 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 3.448e-42
Identity = 82/206 (39.81%), Postives = 128/206 (62.14%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSES--------SRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            GVV+FF SY+  D I + W++ GVL  +++LK V  E + + + +  +  ++ + +  +G +LFAV+G K+SEGINF D+L R V++VG+PYP   SP LQEKM+Y++K+ GS +            Y NL MK VNQ+IGRAIRH+ND+AAI+L+D+RYA     S+         LP W++   +  +    ++  L +FF ++
Sbjct:  674 GVVVFFPSYDTEDFIYQHWKACGVLDSLQRLKQVVREPRAAGKTDECLTEYSNAVQQGRGGLLFAVVGGKLSEGINFKDDLGRCVVMVGLPYPNRHSPALQEKMAYLDKRAGSGARNANGQSPGEAYYENLCMKAVNQSIGRAIRHRNDYAAILLVDDRYARPRIASQ---------LPEWMQPYHTTVDKMGGVVRHLSTFFRKR 870          
BLAST of Helicase ATP-binding domain-containing protein vs. TrEMBL
Match: A0A3Q3LZI6 (DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 3.790e-42
Identity = 88/209 (42.11%), Postives = 125/209 (59.81%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSN-------KGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY----GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            GVV FF SY    +II  W++ GVL+ +   K V+ E K++ Q E ++  F+   +          GA+LF+V+G KMSEGINFSDEL R V++VG+PYP  +SP LQEKMSY++K      G    + +  NL MK VNQ+IGRAIRH+ D+++I+L D RY+    +S+         LP+W++D  S         S L+ FFL+K
Sbjct:  659 GVVCFFPSYEYSRRIISHWEASGVLARLANKKKVFQEPKKANQLEQVLSEFSRCIQRCALDSSGLNGALLFSVVGGKMSEGINFSDELGRCVVMVGMPYPNIKSPELQEKMSYLDKHLPHSGGRSPGQALIENLCMKAVNQSIGRAIRHRGDYSSIVLCDRRYSRPATLSK---------LPTWIRDRTSTCTTFGPAFSALRKFFLEK 858          
BLAST of Helicase ATP-binding domain-containing protein vs. TrEMBL
Match: A0A3Q3LNF1 (DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 4.163e-42
Identity = 88/209 (42.11%), Postives = 125/209 (59.81%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSN-------KGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY----GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            GVV FF SY    +II  W++ GVL+ +   K V+ E K++ Q E ++  F+   +          GA+LF+V+G KMSEGINFSDEL R V++VG+PYP  +SP LQEKMSY++K      G    + +  NL MK VNQ+IGRAIRH+ D+++I+L D RY+    +S+         LP+W++D  S         S L+ FFL+K
Sbjct:  684 GVVCFFPSYEYSRRIISHWEASGVLARLANKKKVFQEPKKANQLEQVLSEFSRCIQRCALDSSGLNGALLFSVVGGKMSEGINFSDELGRCVVMVGMPYPNIKSPELQEKMSYLDKHLPHSGGRSPGQALIENLCMKAVNQSIGRAIRHRGDYSSIVLCDRRYSRPATLSK---------LPTWIRDRTSTCTTFGPAFSALRKFFLEK 883          
BLAST of Helicase ATP-binding domain-containing protein vs. TrEMBL
Match: A0A310T934 (HELICc2 domain-containing protein (Fragment) OS=Xenopus tropicalis OX=8364 GN=XENTR_v900262452mg PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 4.644e-42
Identity = 87/210 (41.43%), Postives = 129/210 (61.43%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIM-------RNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY----GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLG-LPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            G+V FF SY    +I E W+  G+L  +   K ++ E K++ Q + ++       +N + S  +  GA+LF+V+G KMSEGINFSD+L R +++VG+PYP  RSP LQEKMSY++K      G  + R++  NL MK VNQ+IGRAIRH+ D+A+I+LLD RY+          R   LG LP W++ S  ++ N  +  + ++ FF QK
Sbjct:  281 GLVCFFPSYEYQKRIQEHWEKSGLLKRLALKKKIFQEPKRANQVDQVLVEYSKCIKNCSQSGGAQNGALLFSVVGGKMSEGINFSDDLGRCIVMVGMPYPNIRSPELQEKMSYLDKTLPKTEGVSAGRVLIENLCMKAVNQSIGRAIRHRGDYASIVLLDHRYS----------RPAILGKLPQWIRSSTQVKPNFGAAFATIRKFFQQK 480          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Cavefish
Match: ddx11 (DEAD/H-box helicase 11 [Source:NCBI gene;Acc:103040310])

HSP 1 Score: 167.933 bits (424), Expect = 2.221e-42
Identity = 82/210 (39.05%), Postives = 122/210 (58.10%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTA-------SAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY----GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKL-GLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            GVV FF SY    +I+  W+  G+L  +   K V+ E K++ Q E ++  ++        +     GA+LF+V+G KMSEGINFSD+L R +++VG+PYP  +SP LQEKM+Y++K      G    + +  NL MK VNQ+IGRAIRH+ D+A I+L D RY+          R G L  LP W++ S    ++     + ++ FFL+K
Sbjct:  697 GVVCFFPSYEYEKRILGHWEKTGILQRLAAKKKVFQEPKKASQVEQVLSEYSKCIQRCSNTGGGQTGALLFSVVGGKMSEGINFSDDLGRCIVMVGMPYPNIKSPELQEKMAYLDKNMPHIDGRSPGKALIENLCMKAVNQSIGRAIRHRGDYACIVLCDRRYS----------RSGTLQKLPQWIRSSTHTHSSFGPAFASIRKFFLEK 896          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Cavefish
Match: ercc2 (ERCC excision repair 2, TFIIH core complex helicase subunit [Source:NCBI gene;Acc:103044920])

HSP 1 Score: 121.709 bits (304), Expect = 4.255e-28
Identity = 60/180 (33.33%), Postives = 103/180 (57.22%), Query Frame = 2
Query: 1544 DGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVS 2083
            DG+V FF+SY  M+ I+  W  +G+L  I++ K ++IE   + +    +  +  + ++ +GA+L +V   K+SEGI+F     R VI+ G+PY  T+S IL+ ++ Y+  Q+    +  +  + AM+   Q +GRAIR K D+  +I  D+RYA   K       +GK  LP W+++ +S
Sbjct:  438 DGIVAFFTSYVYMENIVASWYEQGILENIQRNKLIFIETPDAAETSMALEKYQEACENGRGAILLSVARGKVSEGIDFVHHFGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFD-AMRHAAQCVGRAIRGKTDYGLMIFADKRYARADK-------RGK--LPRWIQEHIS 607          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Cavefish
Match: ercc2 (ERCC excision repair 2, TFIIH core complex helicase subunit [Source:NCBI gene;Acc:103044920])

HSP 1 Score: 121.709 bits (304), Expect = 5.267e-28
Identity = 66/205 (32.20%), Postives = 114/205 (55.61%), Query Frame = 2
Query: 1538 ILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISE---LKSFFLQKI 2143
            + DG+V FF+SY  M+ I+  W  +G+L  I++ K ++IE   + +    +  +  + ++ +GA+L +V   K+SEGI+F     R VI+ G+PY  T+S IL+ ++ Y+  Q+    +  +  + AM+   Q +GRAIR K D+  +I  D+RYA   K       +GK  LP W+++ +S   + N  I E   L   FL+++
Sbjct:  507 VPDGIVAFFTSYVYMENIVASWYEQGILENIQRNKLIFIETPDAAETSMALEKYQEACENGRGAILLSVARGKVSEGIDFVHHFGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFD-AMRHAAQCVGRAIRGKTDYGLMIFADKRYARADK-------RGK--LPRWIQEHIS-DGSLNLTIDETVQLSKHFLRQM 700          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Cavefish
Match: ercc2 (ERCC excision repair 2, TFIIH core complex helicase subunit [Source:NCBI gene;Acc:103044920])

HSP 1 Score: 121.709 bits (304), Expect = 5.698e-28
Identity = 66/205 (32.20%), Postives = 114/205 (55.61%), Query Frame = 2
Query: 1538 ILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISE---LKSFFLQKI 2143
            + DG+V FF+SY  M+ I+  W  +G+L  I++ K ++IE   + +    +  +  + ++ +GA+L +V   K+SEGI+F     R VI+ G+PY  T+S IL+ ++ Y+  Q+    +  +  + AM+   Q +GRAIR K D+  +I  D+RYA   K       +GK  LP W+++ +S   + N  I E   L   FL+++
Sbjct:  531 VPDGIVAFFTSYVYMENIVASWYEQGILENIQRNKLIFIETPDAAETSMALEKYQEACENGRGAILLSVARGKVSEGIDFVHHFGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFD-AMRHAAQCVGRAIRGKTDYGLMIFADKRYARADK-------RGK--LPRWIQEHIS-DGSLNLTIDETVQLSKHFLRQM 724          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Cavefish
Match: rtel1 (regulator of telomere elongation helicase 1 [Source:NCBI gene;Acc:103025871])

HSP 1 Score: 119.783 bits (299), Expect = 4.231e-27
Identity = 67/205 (32.68%), Postives = 110/205 (53.66%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNF---TASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIM-------YHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            G+++FF SY V+DK +E W++ G    I+ +K +++E +       ++  F       KSN G+  FAV   K SEG++F+D   R VII G+P+P    P +  KM Y+++   ++SS +        Y   A + VNQAIGR IRH+ D+ AI L D R+ +    ++         LPSW++  V + +N  +++ +   FF
Sbjct:  554 GLLVFFPSYPVLDKTLEFWRANGHADRIENMKPMFVEPRGKGTFTEVIDGFYDKVNDPKSNGGS-FFAVCRGKASEGLDFADTYGRGVIITGLPFPPRMDPRVVLKMQYLDEMCRNKSSGMKYLSGQEWYRQQASRAVNQAIGRVIRHREDYGAIFLCDHRFKNTDVRAQ---------LPSWVRPYVRM-DNFGTVVRDAAQFF 747          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009331.1 (pep scaffold:Pmarinus_7.0:GL478127:7852:42501:1 gene:ENSPMAG00000008437.1 transcript:ENSPMAT00000009331.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.806 bits (338), Expect = 4.493e-33
Identity = 70/216 (32.41%), Postives = 119/216 (55.09%), Query Frame = 2
Query: 1526 NLKSIL-DGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNK--GAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIM-----------YHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            NL  I+ +G+++FF SY VMD  ++ W+++G+ S+I+++K +++E KQ       +  F       +   A  FAV   K+SEG++F+D   R VII G+P+P    P ++ KM ++++     S+ +            Y   A + VNQAIGR IRH++D+ AIIL D R++  + +++         LPSW++ SV       +++ EL  FF
Sbjct:   52 NLARIIPNGLLVFFPSYTVMDMCLQHWKNEGLSSKIEEIKPMFVEPKQKGLFTEAINGFYDKINDPRCSAAAFFAVCRGKVSEGLDFADANGRAVIITGLPFPPQMDPWIKLKMQFLDEMKAKRSTEMQCEFVGLSGQEWYTQQASRAVNQAIGRVIRHRHDYGAIILCDHRFSSASAVAQ---------LPSWMRPSVKAYPEFGAVVRELSQFF 258          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Sea Lamprey
Match: ercc2 (excision repair cross-complementation group 2 [Source:ZFIN;Acc:ZDB-GENE-040426-997])

HSP 1 Score: 121.709 bits (304), Expect = 1.082e-28
Identity = 60/183 (32.79%), Postives = 104/183 (56.83%), Query Frame = 2
Query: 1544 DGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQN 2092
            DGVV FF+SY+ M+ I+  W  +G+L  I++ K ++IE +   +    +  +  + ++ +GAVL +V   K+SEGI+F     R VI+ GIPY  T+S IL+ ++ ++   Y    +  +  + AM+   Q +GRAIR K D+  ++  D+RY+   K       +GK  LP W+++ ++  N
Sbjct:  510 DGVVCFFTSYHYMESIVAAWYEQGILENIQRNKLIFIETQDGAETSVALEKYHEACENGRGAVLLSVARGKVSEGIDFVHHYGRAVIMFGIPYVYTQSRILKARLEFLRDHYQIRENDFLTFD-AMRHAAQCVGRAIRGKTDYGVMVFADKRYSRADK-------RGK--LPRWIQEHITDAN 682          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Yeast
Match: CHL1 (Probable DNA helicase; involved in sister-chromatid cohesion and genome integrity and interstrand cross-link repair; interacts with ECO1 and CTF18; mutants are defective in silencing, rDNA recombination, aging and the heat shock response; FANCJ-like helicase family member; mutations in the human homolog, DDX11/ChLR1, cause Warsaw breakage syndrome [Source:SGD;Acc:S000005929])

HSP 1 Score: 129.028 bits (323), Expect = 4.455e-31
Identity = 67/204 (32.84%), Postives = 115/204 (56.37%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYV---------EKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            G+V FF SY  +  +I+ W+     + +  ++ ++ E K     ++I+  ++ S    +G++L A++G K+SEGINF D+L R V++VG+P+P   S  L  K  ++          ++  S +++    N+ MK VNQ++GRAIRH ND+A I LLD RY      +    RK    L  W++DS++ ++ T+ +IS  + FF
Sbjct:  662 GIVAFFPSYQYLAHVIQCWKQNDRFATLNNVRKIFYEAKDG---DDILSGYSDSVAEGRGSLLLAIVGGKLSEGINFQDDLCRAVVMVGLPFPNIFSGELIVKRKHLAAKIMKSGGTEEEASRATKEFMENICMKAVNQSVGRAIRHANDYANIYLLDVRY------NRPNFRK---KLSRWVQDSINSEHTTHQVISSTRKFF 853          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Yeast
Match: RAD3 (5' to 3' DNA helicase; involved in nucleotide excision repair and transcription; subunit of RNA polII initiation factor TFIIH and of Nucleotide Excision Repair Factor 3 (NEF3); homolog of human XPD protein; mutant has aneuploidy tolerance; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000973])

HSP 1 Score: 112.464 bits (280), Expect = 6.605e-26
Identity = 57/199 (28.64%), Postives = 107/199 (53.77%), Query Frame = 2
Query: 1544 DGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVS---IQNNTNSLISELKSFF 2131
            DG+V+FF SY  M+ I+  WQ+ G+L E+ K K + +E   + +    +  +  +  + +GA+L +V   K+SEGI+F  +  R V+++GIP+  T S IL+ ++ ++ + Y    +  +  + AM+   Q +GR +R K+D+  ++L D R++           + +  LP W+   +S   +  +T+  IS  K F 
Sbjct:  535 DGMVVFFPSYLYMESIVSMWQTMGILDEVWKHKLILVETPDAQETSLALETYRKACSNGRGAILLSVARGKVSEGIDFDHQYGRTVLMIGIPFQYTESRILKARLEFMRENYRIRENDFLSFD-AMRHAAQCLGRVLRGKDDYGVMVLADRRFS-----------RKRSQLPKWIAQGLSDADLNLSTDMAISNTKQFL 721          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO39388 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA32])

HSP 1 Score: 127.872 bits (320), Expect = 4.308e-30
Identity = 72/209 (34.45%), Postives = 111/209 (53.11%), Query Frame = 2
Query: 1532 KSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTA--SAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESS-------RIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            ++I +G+++FF SY VM+K +E WQ+ G+ + + + K ++ E +        M +F A  +  S  GA  FAV   K+SEG++FSD   R V+I G+P+P      ++ KMS++++    + S       R  Y   A + VNQA+GR IRH+ DF AI+L D R+     + E         LPSW+K  V I      +  EL  FF
Sbjct:  551 RTIPNGLLVFFPSYPVMNKCLEHWQNTGIWARLSQYKPMFAEPRGKGDFVQTMEDFYAKINDPSLNGATFFAVCRGKVSEGLDFSDINGRAVVITGLPFPPMMDAKVKLKMSFLDEMSRKDKSAIKGLTGREWYRQQASRAVNQAVGRVIRHRQDFGAILLCDVRFTYPDALRE---------LPSWVKPQVKIFKEFGHVQRELIQFF 750          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO46754 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNX6])

HSP 1 Score: 122.479 bits (306), Expect = 1.376e-28
Identity = 58/177 (32.77%), Postives = 105/177 (59.32%), Query Frame = 2
Query: 1544 DGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKD 2074
            DG+V FF+SY  M+ ++  W  +G++S I+K K ++IE   + +    + N+  + ++ +GA+L +V   K+SEGI+F     R VI+ GIPY  T+S IL+ ++ Y+ +Q+    +  +  + AM+   Q +GRAIR K D+  ++  D+R++ + K       +GK  LP W+++
Sbjct:  509 DGIVCFFTSYLYMESVVSLWHDQGIISNIQKNKLLFIETTDAAETSLALHNYQKACENGRGAILLSVARGKVSEGIDFDHHYGRAVIMFGIPYVYTQSRILKARLEYLREQFNIRENDFLTFD-AMRHAAQCVGRAIRGKTDYGIMVFADKRFSKVDK-------RGK--LPKWIQE 675          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Medaka
Match: ddx11 (DEAD/H-box helicase 11 [Source:NCBI gene;Acc:101163814])

HSP 1 Score: 167.548 bits (423), Expect = 3.045e-42
Identity = 80/209 (38.28%), Postives = 124/209 (59.33%), Query Frame = 2
Query: 1547 GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSN-------KGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY----GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQK 2140
            GVV FF SY  + +I+  W++ G L+ +   K ++ E K+  Q E+++  F+   +          GA+LF+V+G KMSEGINFSD+L R V++VG+PYP  +SP LQEKMSY++K      G    + +  NL MK VNQ+IGRAIRH+ D+++++L D RY+    +S+         LP+W++   S         + L+ FF++K
Sbjct:  691 GVVCFFPSYEYLRRIMCHWEASGALTRLSNKKKIFQEPKKPNQVEHVLSEFSRCIQRCAQESSGLTGALLFSVVGGKMSEGINFSDDLGRCVVMVGMPYPNIKSPELQEKMSYLDKHLPHSQGKSPGQALVENLCMKAVNQSIGRAIRHRGDYSSVVLCDRRYSRPATLSK---------LPAWIRSRTSTYATFGPAFAALRKFFMEK 890          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Medaka
Match: ercc2 (ERCC excision repair 2, TFIIH core complex helicase subunit [Source:NCBI gene;Acc:101163020])

HSP 1 Score: 122.479 bits (306), Expect = 3.355e-28
Identity = 60/180 (33.33%), Postives = 104/180 (57.78%), Query Frame = 2
Query: 1544 DGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVS 2083
            DG+V FF+SY  M+ I+  W  +G+L  I++ K ++IE + + +    +  +  + ++ +GA+L +V   K+SEGI+F     R VI+ G+PY  T+S IL+ ++ Y+  Q+    +  +  + AM+   Q +GRAIR K D+  +I  D+RYA   K       +GK  LP W+++ +S
Sbjct:  533 DGIVAFFTSYVYMENIVASWYEQGILENIQRNKLIFIETQDAAETSMALEKYQEACENGRGAILLSVARGKVSEGIDFVHHFGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFD-AMRHAAQCVGRAIRGKTDYGLMIFADKRYARADK-------RGK--LPRWIQEHIS 702          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Medaka
Match: ercc2 (ERCC excision repair 2, TFIIH core complex helicase subunit [Source:NCBI gene;Acc:101163020])

HSP 1 Score: 122.479 bits (306), Expect = 3.671e-28
Identity = 60/182 (32.97%), Postives = 105/182 (57.69%), Query Frame = 2
Query: 1538 ILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVS 2083
            + DG+V FF+SY  M+ I+  W  +G+L  I++ K ++IE + + +    +  +  + ++ +GA+L +V   K+SEGI+F     R VI+ G+PY  T+S IL+ ++ Y+  Q+    +  +  + AM+   Q +GRAIR K D+  +I  D+RYA   K       +GK  LP W+++ +S
Sbjct:  531 VPDGIVAFFTSYVYMENIVASWYEQGILENIQRNKLIFIETQDAAETSMALEKYQEACENGRGAILLSVARGKVSEGIDFVHHFGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFD-AMRHAAQCVGRAIRGKTDYGLMIFADKRYARADK-------RGK--LPRWIQEHIS 702          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Medaka
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:NCBI gene;Acc:101173242])

HSP 1 Score: 114.775 bits (286), Expect = 1.604e-25
Identity = 65/208 (31.25%), Postives = 112/208 (53.85%), Query Frame = 2
Query: 1529 LKSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNE--NIMRNFTASAKS---NKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSES---SRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSF 2128
             K I  GV+ F  SY ++DK+ + W + G+  ++++ K+V  E +   + +   +++ +  + K      GA+L AV   K+SEG++F+D+ AR V+ +GIP+P  +   ++ KM Y ++   S         Y   A + +NQA+GR IRHKND+ A+IL+D+RY        N   K   GL  W++  V      ++ +  LK+F
Sbjct:  704 CKVIAKGVLCFLPSYKLLDKLRDRWSNTGLWEKLEQQKTVITEPRGGAKGDFDELLQTYYDAIKCCDERDGALLIAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDQHCKSRGLLPGHRWYEIQAYRALNQALGRCIRHKNDWGALILVDDRYG-------NNPNKYITGLSKWVRQLVQHHYTFSNAMQSLKAF 904          
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Medaka
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:NCBI gene;Acc:101173242])

HSP 1 Score: 114.39 bits (285), Expect = 2.022e-25
Identity = 65/208 (31.25%), Postives = 112/208 (53.85%), Query Frame = 2
Query: 1529 LKSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNE--NIMRNFTASAKS---NKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSES---SRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSF 2128
             K I  GV+ F  SY ++DK+ + W + G+  ++++ K+V  E +   + +   +++ +  + K      GA+L AV   K+SEG++F+D+ AR V+ +GIP+P  +   ++ KM Y ++   S         Y   A + +NQA+GR IRHKND+ A+IL+D+RY        N   K   GL  W++  V      ++ +  LK+F
Sbjct:  704 CKVIAKGVLCFLPSYKLLDKLRDRWSNTGLWEKLEQQKTVITEPRGGAKGDFDELLQTYYDAIKCCDERDGALLIAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDQHCKSRGLLPGHRWYEIQAYRALNQALGRCIRHKNDWGALILVDDRYG-------NNPNKYITGLSKWVRQLVQHHYTFSNAMQSLKAF 904          
BLAST of Helicase ATP-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000025070.1 (SMESG000025070.1)

HSP 1 Score: 406.757 bits (1044), Expect = 6.840e-129
Identity = 199/200 (99.50%), Postives = 200/200 (100.00%), Query Frame = 2
Query: 1544 DGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQKI 2143
            +GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQKI
Sbjct:  605 NGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQKI 804          
BLAST of Helicase ATP-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000025070.1 (SMESG000025070.1)

HSP 1 Score: 406.371 bits (1043), Expect = 1.846e-128
Identity = 199/200 (99.50%), Postives = 200/200 (100.00%), Query Frame = 2
Query: 1544 DGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQKI 2143
            +GVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQKI
Sbjct:  623 NGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQYGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQKI 822          
BLAST of Helicase ATP-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000064419.1 (SMESG000064419.1)

HSP 1 Score: 125.176 bits (313), Expect = 6.384e-29
Identity = 71/208 (34.13%), Postives = 110/208 (52.88%), Query Frame = 2
Query: 1532 KSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNF---TASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQ-----YGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            K I  G+++ F SY +M K IE W+S  + + + + K + +E +   +    M  F    +   SNKG++L +V   K+SEG++ SD   R VI+VG+PYP    P ++ KMS+++ +     +G +  R  Y   A + VNQ+IGR IRH  DF AI L DER+A             +  LP WL+ ++ I N+    I    +FF
Sbjct:  531 KIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGID-GRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATA---------DSRFQLPLWLQSNIVISNHFGDAIRNTCNFF 728          
BLAST of Helicase ATP-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000064419.1 (SMESG000064419.1)

HSP 1 Score: 125.176 bits (313), Expect = 6.535e-29
Identity = 71/208 (34.13%), Postives = 110/208 (52.88%), Query Frame = 2
Query: 1532 KSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNF---TASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQ-----YGSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFF 2131
            K I  G+++ F SY +M K IE W+S  + + + + K + +E +   +    M  F    +   SNKG++L +V   K+SEG++ SD   R VI+VG+PYP    P ++ KMS+++ +     +G +  R  Y   A + VNQ+IGR IRH  DF AI L DER+A             +  LP WL+ ++ I N+    I    +FF
Sbjct:  555 KIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGID-GRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFA---------TADSRFQLPLWLQSNIVISNHFGDAIRNTCNFF 752          
BLAST of Helicase ATP-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000032754.1 (SMESG000032754.1)

HSP 1 Score: 123.25 bits (308), Expect = 1.548e-28
Identity = 75/213 (35.21%), Postives = 114/213 (53.52%), Query Frame = 2
Query: 1532 KSILDGVVIFFSSYNVMDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGAVLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVE---KQYGSE-----------SSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISENELRKGKLGLPSWLKDSVSIQNNTNSLISELKSF 2128
            K + +GV+ F SS+ +MD +++  +  G++++I++ K V  E K S++ EN M  F +  K+  GA+LFAV   K SEGI+F+DE ARLVI VGIPYP    P +  K  Y +   K  G+            S    Y   A + +NQAIGR IRH++D+ A++++D R+      + N       GL  W+K   +   + N L   L  F
Sbjct:  555 KVVPNGVLCFLSSFALMDGLLQRLEDTGLMNQIRQHKFVTKEPKSSMEMENCMAKFYSKIKT--GALLFAVYRGKASEGIDFADEAARLVITVGIPYPSAADPKVVLKRHYNDNKRKNLGTNEAAAGENQQGLSGHQWYKIQAFRALNQAIGRCIRHRSDWGAMLMVDSRFDGFDPSNTN-------GLCKWIKRRKNHYEDFNDLFYYLVRF 758          
The following BLAST results are available for this feature:
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX111.702e-3735.62DEAD/H-box helicase 11 [Source:HGNC Symbol;Acc:HGN... [more]
DDX112.215e-3734.70DEAD/H-box helicase 11 [Source:HGNC Symbol;Acc:HGN... [more]
DDX116.442e-3341.67DEAD/H-box helicase 11 [Source:HGNC Symbol;Acc:HGN... [more]
DDX112.746e-2936.16DEAD/H-box helicase 11 [Source:HGNC Symbol;Acc:HGN... [more]
RTEL18.184e-2932.35regulator of telomere elongation helicase 1 [Sourc... [more]
back to top
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chl-11.324e-3940.91ATP-dependent DNA helicase chl-1 [Source:UniProtK... [more]
chl-11.324e-3940.91ATP-dependent DNA helicase chl-1 [Source:UniProtK... [more]
xpd-17.922e-3035.03XPD (Xeroderma Pigmentosum complementation group D... [more]
dog-13.684e-2133.53Deletions Of G-rich DNA [Source:UniProtKB/TrEMBL;... [more]
rtel-17.630e-2131.96Regulator of telomere elongation helicase 1 homolo... [more]
back to top
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG114038.956e-3339.04gene:FBgn0026876 transcript:FBtr0070245[more]
CG40785.825e-3232.68gene:FBgn0029798 transcript:FBtr0070807[more]
CG40785.825e-3232.68gene:FBgn0029798 transcript:FBtr0332398[more]
Xpd4.199e-2629.51gene:FBgn0261850 transcript:FBtr0071576[more]
back to top
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx111.653e-4238.99DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 [Sour... [more]
ddx111.791e-4238.99DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 [Sour... [more]
ercc29.529e-2832.02excision repair cross-complementation group 2 [Sou... [more]
rtel12.558e-2730.88regulator of telomere elongation helicase 1 [Sourc... [more]
brip13.862e-2530.19BRCA1 interacting protein C-terminal helicase 1 [S... [more]
back to top
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crat1.482e-4341.43carnitine O-acetyltransferase b [Source:Xenbase;Ac... [more]
crat1.605e-4342.23carnitine O-acetyltransferase b [Source:Xenbase;Ac... [more]
crat1.826e-4341.43carnitine O-acetyltransferase b [Source:Xenbase;Ac... [more]
crat7.364e-4240.69carnitine O-acetyltransferase b [Source:Xenbase;Ac... [more]
crat5.596e-4140.69carnitine O-acetyltransferase b [Source:Xenbase;Ac... [more]
back to top
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx111.691e-3835.62DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 [Sour... [more]
Ddx111.792e-3835.62DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 [Sour... [more]
Rtel12.504e-2933.17regulator of telomere elongation helicase 1 [Sourc... [more]
Rtel12.537e-2933.17regulator of telomere elongation helicase 1 [Sourc... [more]
Rtel12.548e-2933.17regulator of telomere elongation helicase 1 [Sourc... [more]
back to top
BLAST of Helicase ATP-binding domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1R345|DDX11_DANRE1.352e-4138.99ATP-dependent DNA helicase DDX11 OS=Danio rerio OX... [more]
sp|Q21489|CHL1_CAEEL1.684e-3840.91ATP-dependent DNA helicase chl-1 OS=Caenorhabditis... [more]
sp|A1D8E4|CHL1_NEOFI2.386e-3839.30ATP-dependent DNA helicase chl1 OS=Neosartorya fis... [more]
sp|Q4WWE9|CHL1_ASPFU1.131e-3738.86ATP-dependent DNA helicase chl1 OS=Neosartorya fum... [more]
sp|Q6AXC6|DDX11_MOUSE1.183e-3735.62ATP-dependent DNA helicase DDX11 OS=Mus musculus O... [more]
back to top
BLAST of Helicase ATP-binding domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6I3H79.677e-4340.29HELICc2 domain-containing protein (Fragment) OS=Ho... [more]
F2TY313.448e-4239.81Helicase ATP-binding domain-containing protein OS=... [more]
A0A3Q3LZI63.790e-4242.11DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 OS=Ma... [more]
A0A3Q3LNF14.163e-4242.11DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 OS=Ma... [more]
A0A310T9344.644e-4241.43HELICc2 domain-containing protein (Fragment) OS=Xe... [more]
back to top
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx112.221e-4239.05DEAD/H-box helicase 11 [Source:NCBI gene;Acc:10304... [more]
ercc24.255e-2833.33ERCC excision repair 2, TFIIH core complex helicas... [more]
ercc25.267e-2832.20ERCC excision repair 2, TFIIH core complex helicas... [more]
ercc25.698e-2832.20ERCC excision repair 2, TFIIH core complex helicas... [more]
rtel14.231e-2732.68regulator of telomere elongation helicase 1 [Sourc... [more]
back to top
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009331.14.493e-3332.41pep scaffold:Pmarinus_7.0:GL478127:7852:42501:1 ge... [more]
ercc21.082e-2832.79excision repair cross-complementation group 2 [Sou... [more]
back to top
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CHL14.455e-3132.84Probable DNA helicase; involved in sister-chromati... [more]
RAD36.605e-2628.645' to 3' DNA helicase; involved in nucleotide exci... [more]
back to top
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO393884.308e-3034.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467541.376e-2832.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Helicase ATP-binding domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx113.045e-4238.28DEAD/H-box helicase 11 [Source:NCBI gene;Acc:10116... [more]
ercc23.355e-2833.33ERCC excision repair 2, TFIIH core complex helicas... [more]
ercc23.671e-2832.97ERCC excision repair 2, TFIIH core complex helicas... [more]
brip11.604e-2531.25BRCA1 interacting protein C-terminal helicase 1 [S... [more]
brip12.022e-2531.25BRCA1 interacting protein C-terminal helicase 1 [S... [more]
back to top
BLAST of Helicase ATP-binding domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025070.16.840e-12999.50SMESG000025070.1[more]
SMESG000025070.11.846e-12899.50SMESG000025070.1[more]
SMESG000064419.16.384e-2934.13SMESG000064419.1[more]
SMESG000064419.16.535e-2934.13SMESG000064419.1[more]
SMESG000032754.11.548e-2835.21SMESG000032754.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035415 ID=SMED30035415|Name=Helicase ATP-binding domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2646bp
ACAAATGGTAATAAAATTTCTAGAGCATTGTTTGTTAAAGAAGGAAAATA
TATTTTTACTCGTACCCAAAACGTAATAATATTATGTTCTTGTTGAAACA
TCTGTTTTAATGTGCTGTCATAAGATAAGTCAATTATGATTTCTTGCTCT
CCTTCGAATGATCAAAGTCATCAAATTTTTCAATCAAAAACGCGTTCGCT
ATTCGCTTGTCTTATTTCCTCTCGTCTGCGACAGTGATTGTGATTTTCTG
AGAGAATAATGTTGTGCGCACAACATTATGAGACAAAAATAGTTTCTGAC
GTGCCCCACAGTTTGGAAACCGCAGGTTTAAATGATTTCTTTCATGGCTT
AATTAATAACACAAAACACAGGCACATACATAAAATTTACTTTATTCAAC
TCCAGGATCGTATGAAAAACAAAAAATTAAGGTAGAGTATTTAAAATTGC
TCAAATATGTCAACTTTTTACAAAGATTTCTTTTTCCAAAACTTACATCT
CTCATAGCATAACAACTTATTTCGAAATTATCATCTAATAAAGTTTCTGA
TGTTGCTGATGTGGAAGTCTCAAATATTTACTTGTGATCCCAGCGTGCAC
TGGTCTATCTAAATAACAGCAACTGTATATTATAAATTTTATTAACAAAA
ATTACCAATTATAATTAATTATTCGATTCCAAAATGTTTTTCAACACATC
GATAATTTGATTAAAGTATTAAAAATTTATGCATGCAAATTATGTACTTG
TTATGTTGCATACGCATGTTATGTTTCTAGTGCAAAAATAGTGTTGAACT
CAGTTCTTTTTATAAATTCTCCTTTGAGATTAACGCTAGAAGAATAGAAC
GCTTGCTAATTTTTGGGCGAGTATTCTGAAATTTTTGTGGGTATTTATAT
TGTTTTAAACTAATAAAAAATTAATATACTTTAGTCATGCGATTTAGATA
TTGAAAAATTGAATAAATTAATATATTTTATAAATAAACGATTCACATAA
AATCAATACATTTTATAGCTATTGAATAAACTATCAGAAATATACTGCGA
GATTTAATTTCCTGGATTAATAATTAATAATAATAATTATTCTAATGATA
ATATTTTATCCTTGTGTAAAATATAATATATCCAAACTAAAGACAAAATT
AAAATATTATGTACAAAAAATATCATTTAAAAAGTATAATATTATATAAA
GAAAATAATAATAAAAGGATTAATGTTTCATGTGTGATAAATTGGGATTT
GGTTCGAATTTTGAGATTGAATTGTTGATTGAAAGAGTTTGGGATTAACA
TTTTCTCTCTGTTGTGTATATATGTTGACACAGTATCTACTCGGCCTGGA
TTTATACTATTTTCAGAGGTAAAAAGTATTTATTAGTTGTCCATCGTCAT
CCAAAACTGAAATGAAGCCCAAAACTTGGAAATATCTCAGTACTTTAATA
TTTTAACTTGTGTAGTACGCAGCAAAGTTAATAAAAACTTGTAATAATAA
TCTCACGAATCACTAAAAATGTCAAAATTTAAAATCAATTTTAGATGGCG
TTGTGATATTTTTCTCGAGTTATAATGTCATGGATAAAATCATTGAAGAA
TGGCAATCCAAAGGTGTTTTGAGTGAAATAAAAAAATTGAAATCAGTCTA
CATTGAACAAAAGCAATCATTACAAAATGAAAATATAATGCGAAATTTTA
CCGCATCTGCTAAATCAAATAAGGGAGCTGTTTTGTTTGCCGTGATCGGA
GCGAAAATGAGCGAAGGGATTAATTTTAGTGACGAACTAGCGAGATTGGT
TATTATAGTAGGTATACCTTATCCTCAGACTAGAAGTCCAATTTTGCAAG
AAAAAATGAGCTATGTTGAAAAGCAATACGGATCGGAATCGAGTAGAATA
ATGTATCATAATCTTGCCATGAAACCGGTCAATCAAGCTATTGGACGAGC
AATAAGACACAAAAATGACTTCGCAGCCATTATATTGCTAGATGAAAGAT
ATGCAGATATTACCAAGATTTCAGAAAATGAATTGAGAAAAGGAAAACTT
GGTCTTCCTAGCTGGCTTAAAGATTCGGTTTCAATTCAAAATAATACCAA
CTCATTGATATCTGAATTAAAATCATTCTTTCTACAAAAAATATAAAATT
TTTATAAATGTTTTGTTATTCACATTTTTCGATATTATTTTTTCTTAAGA
ATTATTTTCTCCCATTTCGATTATTGTGTATTCATAACAGGTATGTTTAA
TCGTCATAATAATGATTTTAAGGTTCACTAGAACTATCCTAAAAAATTTG
CTGCCTCGTTTTGGGGAAACTTTACATTTAGAAAGGTTTTAAGGCTCTTT
CCTTCAGTATACAATCCTAATAATCTGATAACACCATAAATTTCCTCTCA
TAATAAATAAAATATTGGAAAATTGTTACGGAATGAAAATTTAAAAAGTT
TTATAAAATTTTCAAGAATCTTAAATTCTAAAATCGCGATTTAAAACCTA
AACCTCCTTAAACGCGCATGTAAATTATAAATTTATTTGAAATAAAGGAG
CATCTATTTTGGATTTCCCCACCTTAAAAAGCAATTTTTGATCCCCTCCC
CCTGTTAGGGTTGTTAGTGGTGTAACGTCTAACACAATCGAATATC
back to top

protein sequence of SMED30035415-orf-1

>SMED30035415-orf-1 ID=SMED30035415-orf-1|Name=SMED30035415-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=189bp
MDKIIEEWQSKGVLSEIKKLKSVYIEQKQSLQNENIMRNFTASAKSNKGA
VLFAVIGAKMSEGINFSDELARLVIIVGIPYPQTRSPILQEKMSYVEKQY
GSESSRIMYHNLAMKPVNQAIGRAIRHKNDFAAIILLDERYADITKISEN
ELRKGKLGLPSWLKDSVSIQNNTNSLISELKSFFLQKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003678DNA helicase activity
GO:0003676nucleic acid binding
GO:0016818hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0008026ATP-dependent helicase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0004003ATP-dependent DNA helicase activity
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000419prepharyngeal region
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR006555ATP-dep_Helicase_C
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0006139nucleobase-containing compound metabolic process
GO:0007049cell cycle
GO:0032508DNA duplex unwinding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 14..34
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..156
e-value: 5.2E-47
score: 161.8
NoneNo IPR availablePANTHERPTHR11472DNA REPAIR DEAD HELICASE RAD3/XP-D SUBFAMILY MEMBERcoord: 1..186
NoneNo IPR availableCDDcd18788SF2_C_XPDcoord: 46..141
e-value: 6.05771E-45
score: 144.284
IPR006555ATP-dependent helicase, C-terminalSMARTSM00491Cxpdneu3coord: 1..143
e-value: 2.3E-55
score: 199.9
IPR006555ATP-dependent helicase, C-terminalPFAMPF13307Helicase_C_2coord: 1..143
e-value: 3.8E-45
score: 154.1