Zeb-1

Overview
NameZeb-1
Smed IDSMED30035408
Length (bp)1940
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zeb-1 (SMED30035408) t-SNE clustered cells

Violin plots show distribution of expression levels for Zeb-1 (SMED30035408) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zeb-1 (SMED30035408) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zeb-1 (SMED30035408) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035408

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035408h1SMcG0006102 dd_Smed_v4_10038_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035408h1SMcG0006102 dd_Smed_v4_10038_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035408h1SMcG0006102 dd_Smed_v4_10038_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
whole organismSMED30035408h1SMcG0006102 KY992929smed_ncbi_20240424PMID:28893948
Abnave et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zeb-1 vs. Ensembl Human
Match: ZEB1 (zinc finger E-box binding homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11642])

HSP 1 Score: 154.836 bits (390), Expect = 1.522e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  888 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 971          

HSP 2 Score: 92.0485 bits (227), Expect = 1.650e-18
Identity = 52/92 (56.52%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + ++ R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  185 SCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 276          

HSP 3 Score: 76.6406 bits (187), Expect = 8.897e-14
Identity = 36/73 (49.32%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  399 QNGQ-TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +NG   C++C K+F     L RH   H      R  +C  C KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  884 ENGMYACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 953          

HSP 4 Score: 75.0998 bits (183), Expect = 3.014e-13
Identity = 37/78 (47.44%), Postives = 44/78 (56.41%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEH-----------TGV-RPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   F+  + L RH   H           +G  R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  184 FSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 261          
BLAST of Zeb-1 vs. Ensembl Human
Match: ZEB1 (zinc finger E-box binding homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11642])

HSP 1 Score: 154.836 bits (390), Expect = 1.599e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  905 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 988          

HSP 2 Score: 91.6633 bits (226), Expect = 1.926e-18
Identity = 52/92 (56.52%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + ++ R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  202 SCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 293          

HSP 3 Score: 76.2554 bits (186), Expect = 1.063e-13
Identity = 36/73 (49.32%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  399 QNGQ-TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +NG   C++C K+F     L RH   H      R  +C  C KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  901 ENGMYACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 970          

HSP 4 Score: 75.0998 bits (183), Expect = 3.164e-13
Identity = 37/78 (47.44%), Postives = 44/78 (56.41%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEH-----------TGV-RPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   F+  + L RH   H           +G  R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  201 FSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 278          
BLAST of Zeb-1 vs. Ensembl Human
Match: ZEB1 (zinc finger E-box binding homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11642])

HSP 1 Score: 154.836 bits (390), Expect = 1.617e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  884 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 967          

HSP 2 Score: 91.6633 bits (226), Expect = 1.827e-18
Identity = 52/92 (56.52%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + ++ R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  181 SCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 272          

HSP 3 Score: 76.6406 bits (187), Expect = 9.935e-14
Identity = 36/73 (49.32%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  399 QNGQ-TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +NG   C++C K+F     L RH   H      R  +C  C KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  880 ENGMYACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 949          

HSP 4 Score: 75.0998 bits (183), Expect = 2.984e-13
Identity = 37/78 (47.44%), Postives = 44/78 (56.41%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEH-----------TGV-RPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   F+  + L RH   H           +G  R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  180 FSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 257          
BLAST of Zeb-1 vs. Ensembl Human
Match: ZEB1 (zinc finger E-box binding homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11642])

HSP 1 Score: 154.836 bits (390), Expect = 1.627e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  904 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 987          

HSP 2 Score: 91.6633 bits (226), Expect = 2.028e-18
Identity = 52/92 (56.52%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + ++ R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  201 SCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 292          

HSP 3 Score: 76.2554 bits (186), Expect = 1.109e-13
Identity = 36/73 (49.32%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  399 QNGQ-TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +NG   C++C K+F     L RH   H      R  +C  C KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  900 ENGMYACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 969          

HSP 4 Score: 74.7146 bits (182), Expect = 3.301e-13
Identity = 37/78 (47.44%), Postives = 44/78 (56.41%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEH-----------TGV-RPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   F+  + L RH   H           +G  R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  200 FSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 277          
BLAST of Zeb-1 vs. Ensembl Human
Match: ZEB1 (zinc finger E-box binding homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11642])

HSP 1 Score: 154.451 bits (389), Expect = 1.829e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  837 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 920          

HSP 2 Score: 91.6633 bits (226), Expect = 2.070e-18
Identity = 52/92 (56.52%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + ++ R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  134 SCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 225          

HSP 3 Score: 76.2554 bits (186), Expect = 1.190e-13
Identity = 36/73 (49.32%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  399 QNGQ-TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +NG   C++C K+F     L RH   H      R  +C  C KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  833 ENGMYACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 902          

HSP 4 Score: 74.7146 bits (182), Expect = 3.254e-13
Identity = 37/78 (47.44%), Postives = 44/78 (56.41%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEH-----------TGV-RPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   F+  + L RH   H           +G  R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  133 FSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 210          
BLAST of Zeb-1 vs. Ensembl Celegans
Match: zag-1 (Zinc finger E-box-binding homeobox protein zag-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBU4])

HSP 1 Score: 164.851 bits (416), Expect = 2.331e-43
Identity = 72/94 (76.60%), Postives = 78/94 (82.98%), Query Frame = 3
Query: 1572 TSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP 1853
            T  K+    FSCDQC KVF K SSL RHKYEH+G RP+ C IC+KAFKHKHHLTEHKRLHSGEKPFQC +C KRFSHSGS+SQHMNHRY YCKP
Sbjct:  472 TPLKEEEGLFSCDQCDKVFGKQSSLARHKYEHSGQRPYKCDICEKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMNHRYSYCKP 565          

HSP 2 Score: 80.1073 bits (196), Expect = 1.917e-15
Identity = 46/56 (82.14%), Postives = 51/56 (91.07%), Query Frame = 3
Query:  492 LRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            LRKF+C +C+KAFKFKHHLKEH RIHSGEKPF C+ C KRFSHSGSYSSHM+SKKC
Sbjct:   21 LRKFKCPECTKAFKFKHHLKEHIRIHSGEKPFECQQCHKRFSHSGSYSSHMSSKKC 76          

HSP 3 Score: 75.8702 bits (185), Expect = 4.491e-14
Identity = 34/68 (50.00%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +C+ C K+F     L RH   H      R ++C+ C KAFK KHHL EH R+HSGEKPF C  C KRF
Sbjct:  482 SCDQCDKVFGKQSSLARHKYEHSGQ---RPYKCDICEKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRF 546          

HSP 4 Score: 67.3958 bits (163), Expect = 1.910e-11
Identity = 28/42 (66.67%), Postives = 32/42 (76.19%), Query Frame = 3
Query: 1671 GVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
             +R F C  C KAFK KHHL EH R+HSGEKPF+CQ+C KRF
Sbjct:   20 ALRKFKCPECTKAFKFKHHLKEHIRIHSGEKPFECQQCHKRF 61          
BLAST of Zeb-1 vs. Ensembl Celegans
Match: egrh-1 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:Q18250])

HSP 1 Score: 81.2629 bits (199), Expect = 4.937e-16
Identity = 35/72 (48.61%), Postives = 44/72 (61.11%), Query Frame = 3
Query: 1608 DQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQH 1823
            D C + FS+   LTRH   HTG +PF C IC +AF    HLT H R H+GEKPF C  CG++F+ S    +H
Sbjct:  379 DGCDRRFSRSDELTRHIRIHTGQKPFQCRICMRAFSRSDHLTTHVRTHTGEKPFSCDICGRKFARSDERKRH 450          

HSP 2 Score: 60.8474 bits (146), Expect = 1.594e-9
Identity = 27/64 (42.19%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  423 CGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C + F+    L RH++ H   K    FQC  C +AF    HL  H R H+GEKPF+C  CG++F
Sbjct:  381 CDRRFSRSDELTRHIRIHTGQK---PFQCRICMRAFSRSDHLTTHVRTHTGEKPFSCDICGRKF 441          
BLAST of Zeb-1 vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 77.411 bits (189), Expect = 6.590e-16
Identity = 31/76 (40.79%), Postives = 49/76 (64.47%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            F C  C K FS+ ++LT HK  HTG +PF+C +C++ F     L  H+R H+GE+P+ C +C K F+ S + ++H+
Sbjct:  107 FRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHL 182          

HSP 2 Score: 74.3294 bits (181), Expect = 6.521e-15
Identity = 34/76 (44.74%), Postives = 46/76 (60.53%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            F C  C + FS+ SSL  H+  HTG RP+ C  C+KAF     LT+H R H+G KP+ C  C  +F+ SG+  +HM
Sbjct:  135 FMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHM 210          

HSP 3 Score: 56.6102 bits (135), Expect = 8.328e-9
Identity = 25/49 (51.02%), Postives = 30/49 (61.22%), Query Frame = 3
Query: 1677 RPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQH 1823
            +PF C  C KAF    +LT HKR+H+GEKPF C  C + FS S S   H
Sbjct:  105 KPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTH 153          

HSP 4 Score: 50.0618 bits (118), Expect = 1.460e-6
Identity = 21/51 (41.18%), Postives = 31/51 (60.78%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLH 1751
            + C QC+K F+  S+LT+H   HTG +P+VC+IC   F    +L  H + H
Sbjct:  163 YPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 213          

HSP 5 Score: 48.9062 bits (115), Expect = 3.153e-6
Identity = 24/67 (35.82%), Postives = 31/67 (46.27%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C  CGK F+    L  H + H   K    F C  C++ F     L  H R H+GE+P+ C  C K F
Sbjct:  109 CQTCGKAFSQAANLTAHKRIHTGEKP---FMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAF 172          
BLAST of Zeb-1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 78.9518 bits (193), Expect = 6.660e-16
Identity = 34/72 (47.22%), Postives = 44/72 (61.11%), Query Frame = 3
Query: 1608 DQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQH 1823
            D+C K FS+   LTRH   HTG +PF C IC + F    HLT H R H+GEKP+ C  CGK+F+     ++H
Sbjct:  183 DECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRH 254          

HSP 2 Score: 57.3806 bits (137), Expect = 8.675e-9
Identity = 27/64 (42.19%), Postives = 35/64 (54.69%), Query Frame = 3
Query:  423 CGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C K F+    L RH++ H   K    FQC  C + F    HL  H R H+GEKP++C  CGK+F
Sbjct:  185 CDKKFSRSDELTRHIRIHTGQK---PFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKF 245          

HSP 3 Score: 55.0694 bits (131), Expect = 6.224e-8
Identity = 25/56 (44.64%), Postives = 33/56 (58.93%), Query Frame = 3
Query: 1665 HTGVRPFVCTI--CDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            H   RP+ C    CDK F     LT H R+H+G+KPFQC+ C +RFS S   + H+
Sbjct:  172 HLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHV 227          

HSP 4 Score: 48.521 bits (114), Expect = 7.147e-6
Identity = 24/65 (36.92%), Postives = 31/65 (47.69%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKR 1793
            F C  C + FS+   LT H   HTG +P+ C IC K F      T H ++H      + QR G R
Sbjct:  208 FQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHK-----KSQRSGSR 267          
BLAST of Zeb-1 vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 78.5666 bits (192), Expect = 6.669e-16
Identity = 31/76 (40.79%), Postives = 49/76 (64.47%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            F C  C K FS+ ++LT HK  HTG +PF+C +C++ F     L  H+R H+GE+P+ C +C K F+ S + ++H+
Sbjct:  166 FRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHL 241          

HSP 2 Score: 75.8702 bits (185), Expect = 6.403e-15
Identity = 34/76 (44.74%), Postives = 46/76 (60.53%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            F C  C + FS+ SSL  H+  HTG RP+ C  C+KAF     LT+H R H+G KP+ C  C  +F+ SG+  +HM
Sbjct:  194 FMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHM 269          

HSP 3 Score: 57.3806 bits (137), Expect = 8.097e-9
Identity = 25/49 (51.02%), Postives = 30/49 (61.22%), Query Frame = 3
Query: 1677 RPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQH 1823
            +PF C  C KAF    +LT HKR+H+GEKPF C  C + FS S S   H
Sbjct:  164 KPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTH 212          

HSP 4 Score: 51.2174 bits (121), Expect = 9.756e-7
Identity = 21/51 (41.18%), Postives = 31/51 (60.78%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLH 1751
            + C QC+K F+  S+LT+H   HTG +P+VC+IC   F    +L  H + H
Sbjct:  222 YPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 272          

HSP 5 Score: 49.6766 bits (117), Expect = 3.215e-6
Identity = 24/67 (35.82%), Postives = 31/67 (46.27%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C  CGK F+    L  H + H   K    F C  C++ F     L  H R H+GE+P+ C  C K F
Sbjct:  168 CQTCGKAFSQAANLTAHKRIHTGEKP---FMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAF 231          
BLAST of Zeb-1 vs. Ensembl Fly
Match: zfh1 (gene:FBgn0004606 transcript:FBtr0085701)

HSP 1 Score: 155.606 bits (392), Expect = 3.442e-39
Identity = 66/85 (77.65%), Postives = 72/85 (84.71%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP 1853
            + CDQC K F+K SSL RHKYEH+G RP+ C  C KAFKHKHHLTEHKRLHSGEKPFQC +C KRFSHSGS+SQHMNHRY YCKP
Sbjct:  967 YVCDQCDKAFAKQSSLARHKYEHSGQRPYQCIECPKAFKHKHHLTEHKRLHSGEKPFQCSKCLKRFSHSGSYSQHMNHRYSYCKP 1051          

HSP 2 Score: 122.094 bits (305), Expect = 2.329e-28
Identity = 67/92 (72.83%), Postives = 76/92 (82.61%), Query Frame = 3
Query:  408 QTCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKCSLNSGIDL 683
            QTC +C K FAN+YRL RH+ SHD S  LRKF+C +C KAFKFKHHLKEH RIHSGEKPF C NCGKRFSHSGS+SSHMTSKKC ++ G+ L
Sbjct:  324 QTCRICHKAFANVYRLQRHMISHDESALLRKFKCKECDKAFKFKHHLKEHVRIHSGEKPFGCDNCGKRFSHSGSFSSHMTSKKC-ISMGLKL 414          

HSP 3 Score: 77.0258 bits (188), Expect = 3.147e-14
Identity = 36/68 (52.94%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C+ C K FA    L RH   H      R +QC +C KAFK KHHL EH R+HSGEKPF C  C KRF
Sbjct:  968 VCDQCDKAFAKQSSLARHKYEHSGQ---RPYQCIECPKAFKHKHHLTEHKRLHSGEKPFQCSKCLKRF 1032          

HSP 4 Score: 74.3294 bits (181), Expect = 2.272e-13
Identity = 38/69 (55.07%), Postives = 42/69 (60.87%), Query Frame = 3
Query: 1602 SCDQCQKVFSKHSSLTRHKYEH---TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFS 1799
            +C  C K F+    L RH   H     +R F C  CDKAFK KHHL EH R+HSGEKPF C  CGKRFS
Sbjct:  325 TCRICHKAFANVYRLQRHMISHDESALLRKFKCKECDKAFKFKHHLKEHVRIHSGEKPFGCDNCGKRFS 393          
BLAST of Zeb-1 vs. Ensembl Fly
Match: zfh1 (gene:FBgn0004606 transcript:FBtr0085702)

HSP 1 Score: 154.836 bits (390), Expect = 3.462e-39
Identity = 66/85 (77.65%), Postives = 72/85 (84.71%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP 1853
            + CDQC K F+K SSL RHKYEH+G RP+ C  C KAFKHKHHLTEHKRLHSGEKPFQC +C KRFSHSGS+SQHMNHRY YCKP
Sbjct:  660 YVCDQCDKAFAKQSSLARHKYEHSGQRPYQCIECPKAFKHKHHLTEHKRLHSGEKPFQCSKCLKRFSHSGSYSQHMNHRYSYCKP 744          

HSP 2 Score: 119.783 bits (299), Expect = 9.670e-28
Identity = 66/92 (71.74%), Postives = 76/92 (82.61%), Query Frame = 3
Query:  408 QTCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKCSLNSGIDL 683
            +TC +C K FAN+YRL RH+ SHD S  LRKF+C +C KAFKFKHHLKEH RIHSGEKPF C NCGKRFSHSGS+SSHMTSKKC ++ G+ L
Sbjct:   17 KTCRICHKAFANVYRLQRHMISHDESALLRKFKCKECDKAFKFKHHLKEHVRIHSGEKPFGCDNCGKRFSHSGSFSSHMTSKKC-ISMGLKL 107          

HSP 3 Score: 76.2554 bits (186), Expect = 4.353e-14
Identity = 36/68 (52.94%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C+ C K FA    L RH   H      R +QC +C KAFK KHHL EH R+HSGEKPF C  C KRF
Sbjct:  661 VCDQCDKAFAKQSSLARHKYEHSGQ---RPYQCIECPKAFKHKHHLTEHKRLHSGEKPFQCSKCLKRF 725          

HSP 4 Score: 76.2554 bits (186), Expect = 4.828e-14
Identity = 42/80 (52.50%), Postives = 48/80 (60.00%), Query Frame = 3
Query: 1569 ITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEH---TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFS 1799
            ++S   SFE  +C  C K F+    L RH   H     +R F C  CDKAFK KHHL EH R+HSGEKPF C  CGKRFS
Sbjct:    8 LSSSTSSFEK-TCRICHKAFANVYRLQRHMISHDESALLRKFKCKECDKAFKFKHHLKEHVRIHSGEKPFGCDNCGKRFS 86          
BLAST of Zeb-1 vs. Ensembl Fly
Match: zfh1 (gene:FBgn0004606 transcript:FBtr0331180)

HSP 1 Score: 155.606 bits (392), Expect = 3.586e-39
Identity = 66/85 (77.65%), Postives = 72/85 (84.71%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP 1853
            + CDQC K F+K SSL RHKYEH+G RP+ C  C KAFKHKHHLTEHKRLHSGEKPFQC +C KRFSHSGS+SQHMNHRY YCKP
Sbjct:  967 YVCDQCDKAFAKQSSLARHKYEHSGQRPYQCIECPKAFKHKHHLTEHKRLHSGEKPFQCSKCLKRFSHSGSYSQHMNHRYSYCKP 1051          

HSP 2 Score: 122.479 bits (306), Expect = 2.124e-28
Identity = 67/92 (72.83%), Postives = 76/92 (82.61%), Query Frame = 3
Query:  408 QTCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKCSLNSGIDL 683
            QTC +C K FAN+YRL RH+ SHD S  LRKF+C +C KAFKFKHHLKEH RIHSGEKPF C NCGKRFSHSGS+SSHMTSKKC ++ G+ L
Sbjct:  324 QTCRICHKAFANVYRLQRHMISHDESALLRKFKCKECDKAFKFKHHLKEHVRIHSGEKPFGCDNCGKRFSHSGSFSSHMTSKKC-ISMGLKL 414          

HSP 3 Score: 77.411 bits (189), Expect = 2.960e-14
Identity = 36/68 (52.94%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C+ C K FA    L RH   H      R +QC +C KAFK KHHL EH R+HSGEKPF C  C KRF
Sbjct:  968 VCDQCDKAFAKQSSLARHKYEHSGQ---RPYQCIECPKAFKHKHHLTEHKRLHSGEKPFQCSKCLKRF 1032          

HSP 4 Score: 74.3294 bits (181), Expect = 2.207e-13
Identity = 38/69 (55.07%), Postives = 42/69 (60.87%), Query Frame = 3
Query: 1602 SCDQCQKVFSKHSSLTRHKYEH---TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFS 1799
            +C  C K F+    L RH   H     +R F C  CDKAFK KHHL EH R+HSGEKPF C  CGKRFS
Sbjct:  325 TCRICHKAFANVYRLQRHMISHDESALLRKFKCKECDKAFKFKHHLKEHVRIHSGEKPFGCDNCGKRFS 393          
BLAST of Zeb-1 vs. Ensembl Fly
Match: erm (gene:FBgn0031375 transcript:FBtr0330202)

HSP 1 Score: 90.5077 bits (223), Expect = 1.757e-18
Identity = 39/77 (50.65%), Postives = 51/77 (66.23%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQH 1823
            +TFSC +C KVF+ H +LTRH   HTG RPFVC +C K F+    L  HK +H+ EKP +CQ CGK F+ S + + H
Sbjct:  316 KTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTH 392          

HSP 2 Score: 64.6994 bits (156), Expect = 1.701e-10
Identity = 30/75 (40.00%), Postives = 40/75 (53.33%), Query Frame = 3
Query: 1605 CDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
            C  C K F++ S+L  H   H G +PFVC  C K F  K +   HK  HSGEK ++C  C K F    + + HM+
Sbjct:  376 CQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMH 450          

HSP 3 Score: 61.6178 bits (148), Expect = 1.640e-9
Identity = 27/80 (33.75%), Postives = 44/80 (55.00%), Query Frame = 3
Query: 1587 SFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
             ++ F C+ C K F +  +   HK  H+G + + C IC+KAF   ++LT H   H+ +KP+ C+ C K F  +    +HM
Sbjct:  398 GYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHM 477          

HSP 4 Score: 58.9214 bits (141), Expect = 1.044e-8
Identity = 31/68 (45.59%), Postives = 34/68 (50.00%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C VCGK F     L RH   H + K     +C  C KAF     L  HSRIH+G KPF C  CGK F
Sbjct:  347 VCKVCGKGFRQASTLCRHKIIHTSEKP---HKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGF 411          

HSP 5 Score: 58.151 bits (139), Expect = 2.079e-8
Identity = 28/68 (41.18%), Postives = 35/68 (51.47%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +C  CGK+F   Y L RH+  H  +   R F C  C K F+    L  H  IH+ EKP  C+ CGK F
Sbjct:  319 SCLECGKVFNAHYNLTRHMPVHTGA---RPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAF 383          
BLAST of Zeb-1 vs. Ensembl Fly
Match: erm (gene:FBgn0031375 transcript:FBtr0330201)

HSP 1 Score: 90.1225 bits (222), Expect = 2.046e-18
Identity = 39/77 (50.65%), Postives = 51/77 (66.23%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQH 1823
            +TFSC +C KVF+ H +LTRH   HTG RPFVC +C K F+    L  HK +H+ EKP +CQ CGK F+ S + + H
Sbjct:  316 KTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTH 392          

HSP 2 Score: 64.3142 bits (155), Expect = 2.082e-10
Identity = 30/75 (40.00%), Postives = 40/75 (53.33%), Query Frame = 3
Query: 1605 CDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
            C  C K F++ S+L  H   H G +PFVC  C K F  K +   HK  HSGEK ++C  C K F    + + HM+
Sbjct:  376 CQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMH 450          

HSP 3 Score: 61.2326 bits (147), Expect = 1.946e-9
Identity = 27/79 (34.18%), Postives = 44/79 (55.70%), Query Frame = 3
Query: 1590 FETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            ++ F C+ C K F +  +   HK  H+G + + C IC+KAF   ++LT H   H+ +KP+ C+ C K F  +    +HM
Sbjct:  399 YKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHM 477          

HSP 4 Score: 58.9214 bits (141), Expect = 1.169e-8
Identity = 31/68 (45.59%), Postives = 34/68 (50.00%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C VCGK F     L RH   H + K     +C  C KAF     L  HSRIH+G KPF C  CGK F
Sbjct:  347 VCKVCGKGFRQASTLCRHKIIHTSEKP---HKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGF 411          

HSP 5 Score: 57.7658 bits (138), Expect = 2.350e-8
Identity = 28/68 (41.18%), Postives = 35/68 (51.47%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +C  CGK+F   Y L RH+  H  +   R F C  C K F+    L  H  IH+ EKP  C+ CGK F
Sbjct:  319 SCLECGKVFNAHYNLTRHMPVHTGA---RPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAF 383          
BLAST of Zeb-1 vs. Ensembl Zebrafish
Match: zeb1a (zinc finger E-box binding homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-070912-124])

HSP 1 Score: 158.688 bits (400), Expect = 4.950e-40
Identity = 68/100 (68.00%), Postives = 78/100 (78.00%), Query Frame = 3
Query: 1551 DIDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            D +M  I  +K     ++CD C K+F K SSL RHKYEHTG RP  C+IC+KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  969 DEEMQIIKRRKTFTGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECSICNKAFKHKHHLIEHTRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 1068          

HSP 2 Score: 91.6633 bits (226), Expect = 1.198e-18
Identity = 54/96 (56.25%), Postives = 67/96 (69.79%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELR--------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKCSLNSGI 677
            C++C   F    +L RH+ +H   +E R        KF+C +CSKAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKCS   G+
Sbjct:  164 CSLCSYTFTYRTQLVRHMTAHRQLREKRTVTQSGSRKFKCTECSKAFKYKHHLKEHLRIHSGEKPYECPNCRKRFSHSGSYSSHISSKKCSSIIGV 259          

HSP 3 Score: 77.411 bits (189), Expect = 3.011e-14
Identity = 34/67 (50.75%), Postives = 43/67 (64.18%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C++C K+F     L RH   H      R  +C+ C+KAFK KHHL EH+R+HSGEKP+ C  CGKRF
Sbjct:  987 CDLCDKIFQKSSSLLRHKYEHTGK---RPHECSICNKAFKHKHHLIEHTRLHSGEKPYQCDKCGKRF 1050          

HSP 4 Score: 76.2554 bits (186), Expect = 8.018e-14
Identity = 35/77 (45.45%), Postives = 43/77 (55.84%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEH-----------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            + C  C   F+  + L RH   H           +G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  162 YCCSLCSYTFTYRTQLVRHMTAHRQLREKRTVTQSGSRKFKCTECSKAFKYKHHLKEHLRIHSGEKPYECPNCRKRF 238          
BLAST of Zeb-1 vs. Ensembl Zebrafish
Match: zeb1a (zinc finger E-box binding homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-070912-124])

HSP 1 Score: 158.688 bits (400), Expect = 5.133e-40
Identity = 68/100 (68.00%), Postives = 78/100 (78.00%), Query Frame = 3
Query: 1551 DIDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            D +M  I  +K     ++CD C K+F K SSL RHKYEHTG RP  C+IC+KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  983 DEEMQIIKRRKTFTGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECSICNKAFKHKHHLIEHTRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 1082          

HSP 2 Score: 91.6633 bits (226), Expect = 1.268e-18
Identity = 54/96 (56.25%), Postives = 67/96 (69.79%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELR--------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKCSLNSGI 677
            C++C   F    +L RH+ +H   +E R        KF+C +CSKAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKCS   G+
Sbjct:  178 CSLCSYTFTYRTQLVRHMTAHRQLREKRTVTQSGSRKFKCTECSKAFKYKHHLKEHLRIHSGEKPYECPNCRKRFSHSGSYSSHISSKKCSSIIGV 273          

HSP 3 Score: 77.411 bits (189), Expect = 3.130e-14
Identity = 34/67 (50.75%), Postives = 43/67 (64.18%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C++C K+F     L RH   H      R  +C+ C+KAFK KHHL EH+R+HSGEKP+ C  CGKRF
Sbjct: 1001 CDLCDKIFQKSSSLLRHKYEHTGK---RPHECSICNKAFKHKHHLIEHTRLHSGEKPYQCDKCGKRF 1064          

HSP 4 Score: 76.2554 bits (186), Expect = 8.190e-14
Identity = 35/77 (45.45%), Postives = 43/77 (55.84%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEH-----------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            + C  C   F+  + L RH   H           +G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  176 YCCSLCSYTFTYRTQLVRHMTAHRQLREKRTVTQSGSRKFKCTECSKAFKYKHHLKEHLRIHSGEKPYECPNCRKRF 252          
BLAST of Zeb-1 vs. Ensembl Zebrafish
Match: zeb1a (zinc finger E-box binding homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-070912-124])

HSP 1 Score: 158.688 bits (400), Expect = 5.315e-40
Identity = 68/100 (68.00%), Postives = 78/100 (78.00%), Query Frame = 3
Query: 1551 DIDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            D +M  I  +K     ++CD C K+F K SSL RHKYEHTG RP  C+IC+KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  967 DEEMQIIKRRKTFTGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECSICNKAFKHKHHLIEHTRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 1066          

HSP 2 Score: 91.6633 bits (226), Expect = 1.283e-18
Identity = 54/96 (56.25%), Postives = 67/96 (69.79%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELR--------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKCSLNSGI 677
            C++C   F    +L RH+ +H   +E R        KF+C +CSKAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKCS   G+
Sbjct:  162 CSLCSYTFTYRTQLVRHMTAHRQLREKRTVTQSGSRKFKCTECSKAFKYKHHLKEHLRIHSGEKPYECPNCRKRFSHSGSYSSHISSKKCSSIIGV 257          

HSP 3 Score: 77.411 bits (189), Expect = 3.196e-14
Identity = 34/67 (50.75%), Postives = 43/67 (64.18%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C++C K+F     L RH   H      R  +C+ C+KAFK KHHL EH+R+HSGEKP+ C  CGKRF
Sbjct:  985 CDLCDKIFQKSSSLLRHKYEHTGK---RPHECSICNKAFKHKHHLIEHTRLHSGEKPYQCDKCGKRF 1048          

HSP 4 Score: 76.2554 bits (186), Expect = 8.013e-14
Identity = 35/77 (45.45%), Postives = 43/77 (55.84%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEH-----------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            + C  C   F+  + L RH   H           +G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  160 YCCSLCSYTFTYRTQLVRHMTAHRQLREKRTVTQSGSRKFKCTECSKAFKYKHHLKEHLRIHSGEKPYECPNCRKRF 236          
BLAST of Zeb-1 vs. Ensembl Zebrafish
Match: zeb1b (zinc finger E-box binding homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-010621-1])

HSP 1 Score: 155.992 bits (393), Expect = 4.136e-39
Identity = 71/108 (65.74%), Postives = 78/108 (72.22%), Query Frame = 3
Query: 1533 ILETSMDIDMLNITSKKDSFET--FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ILE   D D      K    E+  ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  803 ILEEQTDSDSGPTKKKMKRTESGLYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICSKAFKHKHHLIEHLRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 910          

HSP 2 Score: 90.5077 bits (223), Expect = 2.722e-18
Identity = 52/94 (55.32%), Postives = 65/94 (69.15%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR-----------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ +H   +E R           KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  164 SCSLCSYTFAYRTQLDRHMTAHKAGREQRHVTQSGGGGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKC 257          

HSP 3 Score: 77.0258 bits (188), Expect = 3.830e-14
Identity = 35/68 (51.47%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K+F     L RH   H      R  +C  CSKAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  828 ACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICSKAFKHKHHLIEHLRLHSGEKPYQCDKCGKRF 892          

HSP 4 Score: 76.6406 bits (187), Expect = 6.361e-14
Identity = 38/84 (45.24%), Postives = 45/84 (53.57%), Query Frame = 3
Query: 1587 SFETFSCDQCQKVFSKHSSLTRHKYEH--------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            S + FSC  C   F+  + L RH   H               G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  159 SEDNFSCSLCSYTFAYRTQLDRHMTAHKAGREQRHVTQSGGGGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 242          
BLAST of Zeb-1 vs. Ensembl Zebrafish
Match: zeb1b (zinc finger E-box binding homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-010621-1])

HSP 1 Score: 155.992 bits (393), Expect = 4.303e-39
Identity = 71/108 (65.74%), Postives = 78/108 (72.22%), Query Frame = 3
Query: 1533 ILETSMDIDMLNITSKKDSFET--FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ILE   D D      K    E+  ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  807 ILEEQTDSDSGPTKKKMKRTESGLYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICSKAFKHKHHLIEHLRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 914          

HSP 2 Score: 90.5077 bits (223), Expect = 3.187e-18
Identity = 52/94 (55.32%), Postives = 65/94 (69.15%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR-----------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ +H   +E R           KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  168 SCSLCSYTFAYRTQLDRHMTAHKAGREQRHVTQSGGGGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKC 261          

HSP 3 Score: 77.0258 bits (188), Expect = 4.253e-14
Identity = 35/68 (51.47%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K+F     L RH   H      R  +C  CSKAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  832 ACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICSKAFKHKHHLIEHLRLHSGEKPYQCDKCGKRF 896          

HSP 4 Score: 76.2554 bits (186), Expect = 6.824e-14
Identity = 38/84 (45.24%), Postives = 45/84 (53.57%), Query Frame = 3
Query: 1587 SFETFSCDQCQKVFSKHSSLTRHKYEH--------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            S + FSC  C   F+  + L RH   H               G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  163 SEDNFSCSLCSYTFAYRTQLDRHMTAHKAGREQRHVTQSGGGGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 246          
BLAST of Zeb-1 vs. Ensembl Xenopus
Match: ankzf1 (ankyrin repeat and zinc finger peptidyl tRNA hydrolase 1 [Source:Xenbase;Acc:XB-GENE-984263])

HSP 1 Score: 155.221 bits (391), Expect = 1.051e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  881 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICAKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 964          

HSP 2 Score: 91.2781 bits (225), Expect = 2.059e-18
Identity = 53/92 (57.61%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + K+ R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  190 SCSMCSYTFAYRTQLDRHMTSHKSGKDQRHVTQSGGNRKFKCPECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 281          

HSP 3 Score: 77.411 bits (189), Expect = 4.897e-14
Identity = 34/68 (50.00%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K+F     L RH   H      R  +C  C+KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  882 ACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICAKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 946          

HSP 4 Score: 75.485 bits (184), Expect = 1.762e-13
Identity = 36/78 (46.15%), Postives = 42/78 (53.85%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHT------------GVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   F+  + L RH   H             G R F C  C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  189 FSCSMCSYTFAYRTQLDRHMTSHKSGKDQRHVTQSGGNRKFKCPECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 266          
BLAST of Zeb-1 vs. Ensembl Xenopus
Match: ankzf1 (ankyrin repeat and zinc finger peptidyl tRNA hydrolase 1 [Source:Xenbase;Acc:XB-GENE-984263])

HSP 1 Score: 154.836 bits (390), Expect = 1.133e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  873 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICAKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 956          

HSP 2 Score: 91.2781 bits (225), Expect = 2.256e-18
Identity = 53/92 (57.61%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + K+ R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  182 SCSMCSYTFAYRTQLDRHMTSHKSGKDQRHVTQSGGNRKFKCPECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 273          

HSP 3 Score: 77.0258 bits (188), Expect = 5.604e-14
Identity = 34/68 (50.00%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K+F     L RH   H      R  +C  C+KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  874 ACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICAKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 938          

HSP 4 Score: 75.485 bits (184), Expect = 1.713e-13
Identity = 36/78 (46.15%), Postives = 42/78 (53.85%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHT------------GVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   F+  + L RH   H             G R F C  C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  181 FSCSMCSYTFAYRTQLDRHMTSHKSGKDQRHVTQSGGNRKFKCPECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 258          
BLAST of Zeb-1 vs. Ensembl Xenopus
Match: ankzf1 (ankyrin repeat and zinc finger peptidyl tRNA hydrolase 1 [Source:Xenbase;Acc:XB-GENE-984263])

HSP 1 Score: 154.836 bits (390), Expect = 1.190e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  895 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICAKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 978          

HSP 2 Score: 91.2781 bits (225), Expect = 2.349e-18
Identity = 53/92 (57.61%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + K+ R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  204 SCSMCSYTFAYRTQLDRHMTSHKSGKDQRHVTQSGGNRKFKCPECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 295          

HSP 3 Score: 77.0258 bits (188), Expect = 5.886e-14
Identity = 34/68 (50.00%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K+F     L RH   H      R  +C  C+KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  896 ACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICAKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 960          

HSP 4 Score: 75.485 bits (184), Expect = 1.815e-13
Identity = 36/78 (46.15%), Postives = 42/78 (53.85%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHT------------GVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   F+  + L RH   H             G R F C  C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  203 FSCSMCSYTFAYRTQLDRHMTSHKSGKDQRHVTQSGGNRKFKCPECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 280          
BLAST of Zeb-1 vs. Ensembl Xenopus
Match: ankzf1 (ankyrin repeat and zinc finger peptidyl tRNA hydrolase 1 [Source:Xenbase;Acc:XB-GENE-984263])

HSP 1 Score: 154.836 bits (390), Expect = 1.217e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  895 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICAKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 978          

HSP 2 Score: 91.2781 bits (225), Expect = 2.379e-18
Identity = 53/92 (57.61%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + K+ R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  204 SCSMCSYTFAYRTQLDRHMTSHKSGKDQRHVTQSGGNRKFKCPECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 295          

HSP 3 Score: 77.0258 bits (188), Expect = 5.945e-14
Identity = 34/68 (50.00%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K+F     L RH   H      R  +C  C+KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  896 ACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICAKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 960          

HSP 4 Score: 75.485 bits (184), Expect = 1.832e-13
Identity = 36/78 (46.15%), Postives = 42/78 (53.85%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHT------------GVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   F+  + L RH   H             G R F C  C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  203 FSCSMCSYTFAYRTQLDRHMTSHKSGKDQRHVTQSGGNRKFKCPECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 280          
BLAST of Zeb-1 vs. Ensembl Xenopus
Match: ankzf1 (ankyrin repeat and zinc finger peptidyl tRNA hydrolase 1 [Source:Xenbase;Acc:XB-GENE-984263])

HSP 1 Score: 154.066 bits (388), Expect = 2.134e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  873 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICAKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 956          

HSP 2 Score: 90.8929 bits (224), Expect = 2.910e-18
Identity = 53/92 (57.61%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + K+ R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  182 SCSMCSYTFAYRTQLDRHMTSHKSGKDQRHVTQSGGNRKFKCPECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 273          

HSP 3 Score: 77.0258 bits (188), Expect = 6.980e-14
Identity = 34/68 (50.00%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K+F     L RH   H      R  +C  C+KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  874 ACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICAKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 938          

HSP 4 Score: 75.485 bits (184), Expect = 1.828e-13
Identity = 36/78 (46.15%), Postives = 42/78 (53.85%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHT------------GVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   F+  + L RH   H             G R F C  C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  181 FSCSMCSYTFAYRTQLDRHMTSHKSGKDQRHVTQSGGNRKFKCPECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 258          
BLAST of Zeb-1 vs. Ensembl Mouse
Match: Zeb1 (zinc finger E-box binding homeobox 1 [Source:MGI Symbol;Acc:MGI:1344313])

HSP 1 Score: 154.066 bits (388), Expect = 1.981e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  882 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICRKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 965          

HSP 2 Score: 92.4337 bits (228), Expect = 6.948e-19
Identity = 53/92 (57.61%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + +E R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  181 SCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 272          

HSP 3 Score: 76.6406 bits (187), Expect = 6.911e-14
Identity = 37/78 (47.44%), Postives = 43/78 (55.13%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEH------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   F+  + L RH   H             G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  180 FSCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 257          

HSP 4 Score: 75.8702 bits (185), Expect = 1.071e-13
Identity = 36/73 (49.32%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  399 QNGQ-TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +NG   C++C K+F     L RH   H      R  +C  C KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  878 ENGMYACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICRKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 947          
BLAST of Zeb-1 vs. Ensembl Mouse
Match: Zeb2 (zinc finger E-box binding homeobox 2 [Source:MGI Symbol;Acc:MGI:1344407])

HSP 1 Score: 152.14 bits (383), Expect = 9.269e-38
Identity = 66/91 (72.53%), Postives = 71/91 (78.02%), Query Frame = 3
Query: 1578 KKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            KK     ++CD C K F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct: 1036 KKTESGMYACDLCDKTFQKSSSLLRHKYEHTGKRPHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 1126          

HSP 2 Score: 86.2705 bits (212), Expect = 7.740e-17
Identity = 53/93 (56.99%), Postives = 65/93 (69.89%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSH----DNSKEL------RKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C +C   FA   +L RH+ +H    D  + L      RKF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  286 SCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 378          

HSP 3 Score: 78.1814 bits (191), Expect = 2.110e-14
Identity = 38/81 (46.91%), Postives = 44/81 (54.32%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEH-------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            E FSC  C   F+  + L RH   H              G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  283 ENFSCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 363          

HSP 4 Score: 76.6406 bits (187), Expect = 6.784e-14
Identity = 36/68 (52.94%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K F     L RH   H      R  QC  C KAFK KHHL EHSR+HSGEKP+ C  CGKRF
Sbjct: 1044 ACDLCDKTFQKSSSLLRHKYEHTGK---RPHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRF 1108          
BLAST of Zeb-1 vs. Ensembl Mouse
Match: Zeb2 (zinc finger E-box binding homeobox 2 [Source:MGI Symbol;Acc:MGI:1344407])

HSP 1 Score: 151.754 bits (382), Expect = 9.626e-38
Identity = 66/91 (72.53%), Postives = 71/91 (78.02%), Query Frame = 3
Query: 1578 KKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            KK     ++CD C K F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  991 KKTESGMYACDLCDKTFQKSSSLLRHKYEHTGKRPHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 1081          

HSP 2 Score: 85.8853 bits (211), Expect = 8.685e-17
Identity = 53/93 (56.99%), Postives = 65/93 (69.89%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSH----DNSKEL------RKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C +C   FA   +L RH+ +H    D  + L      RKF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  241 SCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 333          

HSP 3 Score: 78.1814 bits (191), Expect = 2.120e-14
Identity = 38/81 (46.91%), Postives = 44/81 (54.32%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEH-------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            E FSC  C   F+  + L RH   H              G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  238 ENFSCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 318          

HSP 4 Score: 76.6406 bits (187), Expect = 7.304e-14
Identity = 36/68 (52.94%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K F     L RH   H      R  QC  C KAFK KHHL EHSR+HSGEKP+ C  CGKRF
Sbjct:  999 ACDLCDKTFQKSSSLLRHKYEHTGK---RPHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRF 1063          
BLAST of Zeb-1 vs. Ensembl Mouse
Match: Zeb2 (zinc finger E-box binding homeobox 2 [Source:MGI Symbol;Acc:MGI:1344407])

HSP 1 Score: 151.754 bits (382), Expect = 9.807e-38
Identity = 66/91 (72.53%), Postives = 71/91 (78.02%), Query Frame = 3
Query: 1578 KKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            KK     ++CD C K F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  992 KKTESGMYACDLCDKTFQKSSSLLRHKYEHTGKRPHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 1082          

HSP 2 Score: 85.8853 bits (211), Expect = 8.688e-17
Identity = 53/93 (56.99%), Postives = 65/93 (69.89%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSH----DNSKEL------RKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C +C   FA   +L RH+ +H    D  + L      RKF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  242 SCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 334          

HSP 3 Score: 78.1814 bits (191), Expect = 2.158e-14
Identity = 38/81 (46.91%), Postives = 44/81 (54.32%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEH-------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            E FSC  C   F+  + L RH   H              G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  239 ENFSCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 319          

HSP 4 Score: 76.6406 bits (187), Expect = 7.306e-14
Identity = 36/68 (52.94%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K F     L RH   H      R  QC  C KAFK KHHL EHSR+HSGEKP+ C  CGKRF
Sbjct: 1000 ACDLCDKTFQKSSSLLRHKYEHTGK---RPHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRF 1064          
BLAST of Zeb-1 vs. Ensembl Mouse
Match: Zeb2 (zinc finger E-box binding homeobox 2 [Source:MGI Symbol;Acc:MGI:1344407])

HSP 1 Score: 151.754 bits (382), Expect = 9.807e-38
Identity = 66/91 (72.53%), Postives = 71/91 (78.02%), Query Frame = 3
Query: 1578 KKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            KK     ++CD C K F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  992 KKTESGMYACDLCDKTFQKSSSLLRHKYEHTGKRPHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 1082          

HSP 2 Score: 85.8853 bits (211), Expect = 8.688e-17
Identity = 53/93 (56.99%), Postives = 65/93 (69.89%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSH----DNSKEL------RKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C +C   FA   +L RH+ +H    D  + L      RKF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  242 SCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 334          

HSP 3 Score: 78.1814 bits (191), Expect = 2.158e-14
Identity = 38/81 (46.91%), Postives = 44/81 (54.32%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEH-------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            E FSC  C   F+  + L RH   H              G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  239 ENFSCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 319          

HSP 4 Score: 76.6406 bits (187), Expect = 7.306e-14
Identity = 36/68 (52.94%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K F     L RH   H      R  QC  C KAFK KHHL EHSR+HSGEKP+ C  CGKRF
Sbjct: 1000 ACDLCDKTFQKSSSLLRHKYEHTGK---RPHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRF 1064          
BLAST of Zeb-1 vs. UniProt/SwissProt
Match: sp|G5EBU4|ZAG1_CAEEL (Zinc finger E-box-binding homeobox protein zag-1 OS=Caenorhabditis elegans OX=6239 GN=zag-1 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 2.965e-42
Identity = 72/94 (76.60%), Postives = 78/94 (82.98%), Query Frame = 3
Query: 1572 TSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP 1853
            T  K+    FSCDQC KVF K SSL RHKYEH+G RP+ C IC+KAFKHKHHLTEHKRLHSGEKPFQC +C KRFSHSGS+SQHMNHRY YCKP
Sbjct:  472 TPLKEEEGLFSCDQCDKVFGKQSSLARHKYEHSGQRPYKCDICEKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMNHRYSYCKP 565          

HSP 2 Score: 80.1073 bits (196), Expect = 2.439e-14
Identity = 46/56 (82.14%), Postives = 51/56 (91.07%), Query Frame = 3
Query:  492 LRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            LRKF+C +C+KAFKFKHHLKEH RIHSGEKPF C+ C KRFSHSGSYSSHM+SKKC
Sbjct:   21 LRKFKCPECTKAFKFKHHLKEHIRIHSGEKPFECQQCHKRFSHSGSYSSHMSSKKC 76          

HSP 3 Score: 75.8702 bits (185), Expect = 5.712e-13
Identity = 34/68 (50.00%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +C+ C K+F     L RH   H      R ++C+ C KAFK KHHL EH R+HSGEKPF C  C KRF
Sbjct:  482 SCDQCDKVFGKQSSLARHKYEHSGQ---RPYKCDICEKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRF 546          

HSP 4 Score: 67.3958 bits (163), Expect = 2.429e-10
Identity = 28/42 (66.67%), Postives = 32/42 (76.19%), Query Frame = 3
Query: 1671 GVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
             +R F C  C KAFK KHHL EH R+HSGEKPF+CQ+C KRF
Sbjct:   20 ALRKFKCPECTKAFKFKHHLKEHIRIHSGEKPFECQQCHKRF 61          
BLAST of Zeb-1 vs. UniProt/SwissProt
Match: sp|P28166|ZFH1_DROME (Zinc finger protein 1 OS=Drosophila melanogaster OX=7227 GN=zfh1 PE=1 SV=2)

HSP 1 Score: 155.606 bits (392), Expect = 3.450e-38
Identity = 66/85 (77.65%), Postives = 72/85 (84.71%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP 1853
            + CDQC K F+K SSL RHKYEH+G RP+ C  C KAFKHKHHLTEHKRLHSGEKPFQC +C KRFSHSGS+SQHMNHRY YCKP
Sbjct:  967 YVCDQCDKAFAKQSSLARHKYEHSGQRPYQCIECPKAFKHKHHLTEHKRLHSGEKPFQCSKCLKRFSHSGSYSQHMNHRYSYCKP 1051          

HSP 2 Score: 122.094 bits (305), Expect = 2.335e-27
Identity = 67/92 (72.83%), Postives = 76/92 (82.61%), Query Frame = 3
Query:  408 QTCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKCSLNSGIDL 683
            QTC +C K FAN+YRL RH+ SHD S  LRKF+C +C KAFKFKHHLKEH RIHSGEKPF C NCGKRFSHSGS+SSHMTSKKC ++ G+ L
Sbjct:  324 QTCRICHKAFANVYRLQRHMISHDESALLRKFKCKECDKAFKFKHHLKEHVRIHSGEKPFGCDNCGKRFSHSGSFSSHMTSKKC-ISMGLKL 414          

HSP 3 Score: 77.0258 bits (188), Expect = 3.154e-13
Identity = 36/68 (52.94%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C+ C K FA    L RH   H      R +QC +C KAFK KHHL EH R+HSGEKPF C  C KRF
Sbjct:  968 VCDQCDKAFAKQSSLARHKYEHSGQ---RPYQCIECPKAFKHKHHLTEHKRLHSGEKPFQCSKCLKRF 1032          

HSP 4 Score: 74.3294 bits (181), Expect = 2.278e-12
Identity = 38/69 (55.07%), Postives = 42/69 (60.87%), Query Frame = 3
Query: 1602 SCDQCQKVFSKHSSLTRHKYEH---TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFS 1799
            +C  C K F+    L RH   H     +R F C  CDKAFK KHHL EH R+HSGEKPF C  CGKRFS
Sbjct:  325 TCRICHKAFANVYRLQRHMISHDESALLRKFKCKECDKAFKFKHHLKEHVRIHSGEKPFGCDNCGKRFS 393          
BLAST of Zeb-1 vs. UniProt/SwissProt
Match: sp|P36197|ZEB1_CHICK (Zinc finger E-box-binding homeobox 1 OS=Gallus gallus OX=9031 GN=ZEB1 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 6.832e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  904 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 987          

HSP 2 Score: 91.2781 bits (225), Expect = 1.257e-17
Identity = 52/92 (56.52%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + ++ R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  201 SCSLCSYTFAYRTQLDRHMTSHKSGRDQRHVTQSSGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 292          

HSP 3 Score: 78.1814 bits (191), Expect = 1.607e-13
Identity = 37/78 (47.44%), Postives = 44/78 (56.41%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEH------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   F+  + L RH   H            +G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  200 FSCSLCSYTFAYRTQLDRHMTSHKSGRDQRHVTQSSGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 277          

HSP 4 Score: 76.2554 bits (186), Expect = 5.589e-13
Identity = 36/73 (49.32%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  399 QNGQ-TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +NG   C++C K+F     L RH   H      R  +C  C KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  900 ENGMYACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 969          
BLAST of Zeb-1 vs. UniProt/SwissProt
Match: sp|P37275|ZEB1_HUMAN (Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 7.812e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  904 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 987          

HSP 2 Score: 91.6633 bits (226), Expect = 9.737e-18
Identity = 52/92 (56.52%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + ++ R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  201 SCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 292          

HSP 3 Score: 76.2554 bits (186), Expect = 5.325e-13
Identity = 36/73 (49.32%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  399 QNGQ-TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +NG   C++C K+F     L RH   H      R  +C  C KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  900 ENGMYACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 969          

HSP 4 Score: 74.7146 bits (182), Expect = 1.585e-12
Identity = 37/78 (47.44%), Postives = 44/78 (56.41%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEH-----------TGV-RPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   F+  + L RH   H           +G  R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  200 FSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 277          
BLAST of Zeb-1 vs. UniProt/SwissProt
Match: sp|Q60542|ZEB1_MESAU (Zinc finger E-box-binding homeobox 1 OS=Mesocricetus auratus OX=10036 GN=ZEB1 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 8.360e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  827 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 910          

HSP 2 Score: 92.8189 bits (229), Expect = 3.843e-18
Identity = 53/92 (57.61%), Postives = 66/92 (71.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ SH + +E R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  125 SCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 216          

HSP 3 Score: 77.0258 bits (188), Expect = 3.423e-13
Identity = 37/80 (46.25%), Postives = 44/80 (55.00%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEH------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            + FSC  C   F+  + L RH   H             G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  122 DNFSCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 201          

HSP 4 Score: 76.2554 bits (186), Expect = 5.588e-13
Identity = 36/73 (49.32%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  399 QNGQ-TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +NG   C++C K+F     L RH   H      R  +C  C KAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  823 ENGMYACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 892          
BLAST of Zeb-1 vs. TrEMBL
Match: A0A221SAL4 (Zeb-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1039.64 bits (2687), Expect = 0.000e+0
Identity = 574/575 (99.83%), Postives = 575/575 (100.00%), Query Frame = 3
Query:  129 MTNCTEFLQKTISDSPILNEFSEVTSSTPDQIADVSESQLLTIDDLKSSINLQTFSPTSSNNTKTTANQDQXXXXXXXXXXXXXXXXXXXQNGQTCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKCSLNSGIDLQISQSMNGILATKSEPDCGYELSSINKILQTVKSGSHNLTNPHNNDISSLFSPPAVNWQEKSDQESGWSNKVQSMTNYTQMKKSSLGDFERFPVLLNNRGWNXXXXXXXXELNHYFQLDNIFNNLVPSSTADNNPLLMHLIFGNKFPLFPSSHCPLNQSPIQASENPNISSMFFIPTLPQQSFPPTNASQYEPLDLSVTKSEPYSNGPSNENFTDLNSNFSLWQQKSSEKSFSFNDSPLNLSQKNPISKSHFSDLSTESDDLXXXXXXXXXXXXXXXXXXXQLILETSMDIDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP 1853
            MTNCTEFLQK+ISDSPILNEFSEVTSSTPDQIADVSESQLLTIDDLKSSINLQTFSPTSSNNTKTTANQDQLLSSLSNSSTNSKSISSPLQNGQTCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFSHSGSYSSHMTSKKCSLNSGIDLQISQSMNGILATKSEPDCGYELSSINKILQTVKSGSHNLTNPHNNDISSLFSPPAVNWQEKSDQESGWSNKVQSMTNYTQMKKSSLGDFERFPVLLNNRGWNSSSLPSPLELNHYFQLDNIFNNLVPSSTADNNPLLMHLIFGNKFPLFPSSHCPLNQSPIQASENPNISSMFFIPTLPQQSFPPTNASQYEPLDLSVTKSEPYSNGPSNENFTDLNSNFSLWQQKSSEKSFSFNDSPLNLSQKNPISKSHFSDLSTESDDLNSENSINNENKSIISSKSNQLILETSMDIDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP
Sbjct:    1 MTNCTEFLQKSISDSPILNEFSEVTSSTPDQIADVSESQLLTIDDLKSSINLQTFSPTSSNNTKTTANQDQLLSSLSNSSTNSKSISSPLQNGQTCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFSHSGSYSSHMTSKKCSLNSGIDLQISQSMNGILATKSEPDCGYELSSINKILQTVKSGSHNLTNPHNNDISSLFSPPAVNWQEKSDQESGWSNKVQSMTNYTQMKKSSLGDFERFPVLLNNRGWNSSSLPSPLELNHYFQLDNIFNNLVPSSTADNNPLLMHLIFGNKFPLFPSSHCPLNQSPIQASENPNISSMFFIPTLPQQSFPPTNASQYEPLDLSVTKSEPYSNGPSNENFTDLNSNFSLWQQKSSEKSFSFNDSPLNLSQKNPISKSHFSDLSTESDDLNSENSINNENKSIISSKSNQLILETSMDIDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP 575          
BLAST of Zeb-1 vs. TrEMBL
Match: A0A3P7MNP0 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS15704 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.631e-46
Identity = 74/87 (85.06%), Postives = 81/87 (93.10%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP 1853
            ETFSCDQCQK+FSKHSSL RHKYEHTG+RPFVC  C KAFKHKHHLTEH+RLH+GEKPF+C RCGKRFSHSGS+SQHMN RYKYC+P
Sbjct:   25 ETFSCDQCQKIFSKHSSLARHKYEHTGLRPFVCRTCSKAFKHKHHLTEHRRLHTGEKPFECHRCGKRFSHSGSYSQHMNMRYKYCRP 111          

HSP 2 Score: 74.7146 bits (182), Expect = 1.689e-12
Identity = 37/68 (54.41%), Postives = 43/68 (63.24%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +C+ C K+F+    L RH   H     LR F C  CSKAFK KHHL EH R+H+GEKPF C  CGKRF
Sbjct:   28 SCDQCQKIFSKHSSLARHKYEHTG---LRPFVCRTCSKAFKHKHHLTEHRRLHTGEKPFECHRCGKRF 92          
BLAST of Zeb-1 vs. TrEMBL
Match: A0A0X3NQA7 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR113993 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.593e-43
Identity = 74/87 (85.06%), Postives = 81/87 (93.10%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP 1853
            ETFSCDQCQK+FSKHSSL RHKYEHTG+RPFVC  C KAFKHKHHLTEH+RLH+GEKPF+C RCGKRFSHSGS+SQHMN RYKYC+P
Sbjct:  711 ETFSCDQCQKIFSKHSSLARHKYEHTGLRPFVCRTCSKAFKHKHHLTEHRRLHTGEKPFECHRCGKRFSHSGSYSQHMNMRYKYCRP 797          

HSP 2 Score: 122.479 bits (306), Expect = 3.673e-25
Identity = 65/85 (76.47%), Postives = 71/85 (83.53%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKCSL 665
             C  CGK FANIYRL RH  SH  S+ELRKF+C QCSKAFKFKHHLKEH+RIHSGEKPF C  CGKRFSHSGSYSSH +SKKC++
Sbjct:  175 ACGQCGKRFANIYRLQRHHLSHTESQELRKFKCEQCSKAFKFKHHLKEHARIHSGEKPFVCLQCGKRFSHSGSYSSHTSSKKCAV 259          

HSP 3 Score: 81.6481 bits (200), Expect = 2.858e-12
Identity = 37/68 (54.41%), Postives = 43/68 (63.24%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +C+ C K+F+    L RH   H     LR F C  CSKAFK KHHL EH R+H+GEKPF C  CGKRF
Sbjct:  714 SCDQCQKIFSKHSSLARHKYEHTG---LRPFVCRTCSKAFKHKHHLTEHRRLHTGEKPFECHRCGKRF 778          

HSP 4 Score: 79.7221 bits (195), Expect = 1.298e-11
Identity = 39/69 (56.52%), Postives = 44/69 (63.77%), Query Frame = 3
Query: 1602 SCDQCQKVFSKHSSLTRHKYEHTG---VRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFS 1799
            +C QC K F+    L RH   HT    +R F C  C KAFK KHHL EH R+HSGEKPF C +CGKRFS
Sbjct:  175 ACGQCGKRFANIYRLQRHHLSHTESQELRKFKCEQCSKAFKFKHHLKEHARIHSGEKPFVCLQCGKRFS 243          
BLAST of Zeb-1 vs. TrEMBL
Match: A0A5K4EUN3 (Transcription factor, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.383e-43
Identity = 73/86 (84.88%), Postives = 83/86 (96.51%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            E F+CDQCQKVFSKHSSL+RHKYEHTG+RPF+C IC KAFKHKHHLTEHKRLH+GEKPF+CQ+CGKRFSHSGS+SQH+NHRYKYC+
Sbjct:  941 EVFACDQCQKVFSKHSSLSRHKYEHTGLRPFICRICSKAFKHKHHLTEHKRLHTGEKPFECQKCGKRFSHSGSYSQHINHRYKYCQ 1026          

HSP 2 Score: 125.561 bits (314), Expect = 5.178e-26
Identity = 68/89 (76.40%), Postives = 76/89 (85.39%), Query Frame = 3
Query:  399 QNGQTCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKCSL 665
            +N   C+ CGK FANIYRLHRHL SH  S ELRKF+C+QC+KAFKFKHHLKEH RIHSGEKPF C  CGKRFSHSGSYSSHM+SKKC++
Sbjct:  185 RNTPICSQCGKQFANIYRLHRHLLSHTESYELRKFRCSQCTKAFKFKHHLKEHERIHSGEKPFMCSQCGKRFSHSGSYSSHMSSKKCNI 273          

HSP 3 Score: 81.6481 bits (200), Expect = 3.759e-12
Identity = 39/68 (57.35%), Postives = 45/68 (66.18%), Query Frame = 3
Query: 1605 CDQCQKVFSKHSSLTRHKYEHTG---VRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFS 1799
            C QC K F+    L RH   HT    +R F C+ C KAFK KHHL EH+R+HSGEKPF C +CGKRFS
Sbjct:  190 CSQCGKQFANIYRLHRHLLSHTESYELRKFRCSQCTKAFKFKHHLKEHERIHSGEKPFMCSQCGKRFS 257          

HSP 4 Score: 79.337 bits (194), Expect = 1.712e-11
Identity = 37/68 (54.41%), Postives = 43/68 (63.24%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C+ C K+F+    L RH   H     LR F C  CSKAFK KHHL EH R+H+GEKPF C+ CGKRF
Sbjct:  944 ACDQCQKVFSKHSSLSRHKYEHTG---LRPFICRICSKAFKHKHHLTEHKRLHTGEKPFECQKCGKRF 1008          
BLAST of Zeb-1 vs. TrEMBL
Match: A0A4Z2CYM9 (Zinc finger E-box-binding homeobox protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_006284 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 5.835e-43
Identity = 72/86 (83.72%), Postives = 82/86 (95.35%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            E F+CDQC+KVFSKHSSL+RHKYEHTG+RPF C IC KAFKHKHHLTEHKRLH+GEKPF+CQ+CGKRFSHSGS+SQH+NHRYKYC+
Sbjct:  702 EVFTCDQCRKVFSKHSSLSRHKYEHTGLRPFTCRICSKAFKHKHHLTEHKRLHTGEKPFECQKCGKRFSHSGSYSQHINHRYKYCQ 787          

HSP 2 Score: 83.1889 bits (204), Expect = 1.085e-12
Identity = 38/68 (55.88%), Postives = 44/68 (64.71%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            TC+ C K+F+    L RH   H     LR F C  CSKAFK KHHL EH R+H+GEKPF C+ CGKRF
Sbjct:  705 TCDQCRKVFSKHSSLSRHKYEHTG---LRPFTCRICSKAFKHKHHLTEHKRLHTGEKPFECQKCGKRF 769          
BLAST of Zeb-1 vs. Ensembl Cavefish
Match: zeb1b (zinc finger E-box binding homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-010621-1])

HSP 1 Score: 154.836 bits (390), Expect = 7.971e-39
Identity = 66/91 (72.53%), Postives = 72/91 (79.12%), Query Frame = 3
Query: 1578 KKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            KK     ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  827 KKTENGLYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICSKAFKHKHHLIEHLRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 917          

HSP 2 Score: 89.3521 bits (220), Expect = 6.352e-18
Identity = 51/94 (54.26%), Postives = 65/94 (69.15%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR-----------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ +H   ++ R           KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  165 SCSLCSYTFAYRTQLDRHMSAHKTDRDQRHVNQTGGGGNRKFKCTECDKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKC 258          

HSP 3 Score: 79.337 bits (194), Expect = 7.843e-15
Identity = 39/84 (46.43%), Postives = 46/84 (54.76%), Query Frame = 3
Query: 1587 SFETFSCDQCQKVFSKHSSLTRHKYEH--------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            S + FSC  C   F+  + L RH   H               G R F CT CDKAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  160 SEDNFSCSLCSYTFAYRTQLDRHMSAHKTDRDQRHVNQTGGGGNRKFKCTECDKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 243          

HSP 4 Score: 77.411 bits (189), Expect = 3.025e-14
Identity = 35/68 (51.47%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K+F     L RH   H      R  +C  CSKAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  835 ACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICSKAFKHKHHLIEHLRLHSGEKPYQCDKCGKRF 899          
BLAST of Zeb-1 vs. Ensembl Cavefish
Match: zeb1a (zinc finger E-box-binding homeobox 1-like [Source:NCBI gene;Acc:103041929])

HSP 1 Score: 154.836 bits (390), Expect = 9.409e-39
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct: 1103 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHTRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 1186          

HSP 2 Score: 94.3597 bits (233), Expect = 1.791e-19
Identity = 53/92 (57.61%), Postives = 67/92 (72.83%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   F+   +L RH+ +H N +E R         KF+C +CSKAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  162 SCSLCSYTFSYRTQLDRHMTAHKNGREQRAVPQSGGNRKFKCTECSKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKC 253          

HSP 3 Score: 78.1814 bits (191), Expect = 1.971e-14
Identity = 38/78 (48.72%), Postives = 43/78 (55.13%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHT------------GVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   FS  + L RH   H             G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  161 FSCSLCSYTFSYRTQLDRHMTAHKNGREQRAVPQSGGNRKFKCTECSKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 238          

HSP 4 Score: 77.7962 bits (190), Expect = 2.464e-14
Identity = 36/72 (50.00%), Postives = 43/72 (59.72%), Query Frame = 3
Query:  402 NGQ-TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             GQ  C++C K+F     L RH   H      R  +C  C KAFK KHHL EH+R+HSGEKP+ C  CGKRF
Sbjct: 1100 GGQYACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICKKAFKHKHHLIEHTRLHSGEKPYQCDKCGKRF 1168          
BLAST of Zeb-1 vs. Ensembl Cavefish
Match: zeb1a (zinc finger E-box-binding homeobox 1-like [Source:NCBI gene;Acc:103041929])

HSP 1 Score: 154.451 bits (389), Expect = 1.104e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct: 1117 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHTRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 1200          

HSP 2 Score: 93.9745 bits (232), Expect = 1.960e-19
Identity = 53/92 (57.61%), Postives = 67/92 (72.83%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   F+   +L RH+ +H N +E R         KF+C +CSKAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  176 SCSLCSYTFSYRTQLDRHMTAHKNGREQRAVPQSGGNRKFKCTECSKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKC 267          

HSP 3 Score: 77.7962 bits (190), Expect = 2.155e-14
Identity = 38/78 (48.72%), Postives = 43/78 (55.13%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHT------------GVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   FS  + L RH   H             G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  175 FSCSLCSYTFSYRTQLDRHMTAHKNGREQRAVPQSGGNRKFKCTECSKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 252          

HSP 4 Score: 77.411 bits (189), Expect = 2.787e-14
Identity = 34/68 (50.00%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K+F     L RH   H      R  +C  C KAFK KHHL EH+R+HSGEKP+ C  CGKRF
Sbjct: 1118 ACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICKKAFKHKHHLIEHTRLHSGEKPYQCDKCGKRF 1182          
BLAST of Zeb-1 vs. Ensembl Cavefish
Match: zeb1b (zinc finger E-box binding homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-010621-1])

HSP 1 Score: 154.451 bits (389), Expect = 1.131e-38
Identity = 66/91 (72.53%), Postives = 72/91 (79.12%), Query Frame = 3
Query: 1578 KKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            KK     ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  827 KKTENGLYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICSKAFKHKHHLIEHLRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 917          

HSP 2 Score: 88.9669 bits (219), Expect = 7.913e-18
Identity = 51/94 (54.26%), Postives = 65/94 (69.15%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR-----------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   FA   +L RH+ +H   ++ R           KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  165 SCSLCSYTFAYRTQLDRHMSAHKTDRDQRHVNQTGGGGNRKFKCTECDKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKC 258          

HSP 3 Score: 78.9518 bits (193), Expect = 8.620e-15
Identity = 39/84 (46.43%), Postives = 46/84 (54.76%), Query Frame = 3
Query: 1587 SFETFSCDQCQKVFSKHSSLTRHKYEH--------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            S + FSC  C   F+  + L RH   H               G R F CT CDKAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  160 SEDNFSCSLCSYTFAYRTQLDRHMSAHKTDRDQRHVNQTGGGGNRKFKCTECDKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 243          

HSP 4 Score: 77.0258 bits (188), Expect = 3.415e-14
Identity = 35/68 (51.47%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K+F     L RH   H      R  +C  CSKAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  835 ACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICSKAFKHKHHLIEHLRLHSGEKPYQCDKCGKRF 899          
BLAST of Zeb-1 vs. Ensembl Cavefish
Match: zeb1a (zinc finger E-box-binding homeobox 1-like [Source:NCBI gene;Acc:103041929])

HSP 1 Score: 154.066 bits (388), Expect = 1.643e-38
Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct: 1023 YACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHTRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 1106          

HSP 2 Score: 94.7449 bits (234), Expect = 1.134e-19
Identity = 53/89 (59.55%), Postives = 67/89 (75.28%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKEL------RKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C++C   F+   +L RH+ +H N +E       RKF+C +CSKAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  164 SCSLCSYTFSYRTQLDRHMTAHKNGREQVPSGGNRKFKCTECSKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKC 252          

HSP 3 Score: 78.9518 bits (193), Expect = 1.046e-14
Identity = 38/75 (50.67%), Postives = 43/75 (57.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHT---------GVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            FSC  C   FS  + L RH   H          G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  163 FSCSLCSYTFSYRTQLDRHMTAHKNGREQVPSGGNRKFKCTECSKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 237          

HSP 4 Score: 77.411 bits (189), Expect = 3.170e-14
Identity = 36/72 (50.00%), Postives = 43/72 (59.72%), Query Frame = 3
Query:  402 NGQ-TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             GQ  C++C K+F     L RH   H      R  +C  C KAFK KHHL EH+R+HSGEKP+ C  CGKRF
Sbjct: 1020 GGQYACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICKKAFKHKHHLIEHTRLHSGEKPYQCDKCGKRF 1088          
BLAST of Zeb-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005616.1 (pep scaffold:Pmarinus_7.0:GL480643:10592:21548:1 gene:ENSPMAG00000005091.1 transcript:ENSPMAT00000005616.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.14 bits (383), Expect = 1.117e-38
Identity = 64/85 (75.29%), Postives = 71/85 (83.53%), Query Frame = 3
Query: 1596 TFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            ++SCD C K F K SSL RHKYEHTG RP  C +C+KAFKHKHHL EH RLHSGEKP+QC RCGKRFSHSGS+SQHMNHRY YC+
Sbjct:  764 SYSCDLCDKTFHKSSSLLRHKYEHTGKRPHQCDVCNKAFKHKHHLIEHSRLHSGEKPYQCDRCGKRFSHSGSYSQHMNHRYSYCR 848          

HSP 2 Score: 81.2629 bits (199), Expect = 3.563e-16
Identity = 52/83 (62.65%), Postives = 60/83 (72.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            T N+C  L A      R +KS   S   RKF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:   93 TNNLCNVLKA------RAVKSQSQSTGNRKFKCTECGKAFKYKHHLKEHFRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 169          

HSP 3 Score: 76.6406 bits (187), Expect = 1.007e-14
Identity = 36/68 (52.94%), Postives = 43/68 (63.24%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +C++C K F     L RH   H      R  QC+ C+KAFK KHHL EHSR+HSGEKP+ C  CGKRF
Sbjct:  766 SCDLCDKTFHKSSSLLRHKYEHTGK---RPHQCDVCNKAFKHKHHLIEHSRLHSGEKPYQCDRCGKRF 830          

HSP 4 Score: 67.781 bits (164), Expect = 5.910e-12
Identity = 29/43 (67.44%), Postives = 33/43 (76.74%), Query Frame = 3
Query: 1668 TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            TG R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  112 TGNRKFKCTECGKAFKYKHHLKEHFRIHSGEKPYECPNCKKRF 154          
BLAST of Zeb-1 vs. Ensembl Sea Lamprey
Match: zeb2b (zinc finger E-box binding homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-080717-1])

HSP 1 Score: 150.599 bits (379), Expect = 2.704e-38
Identity = 66/100 (66.00%), Postives = 74/100 (74.00%), Query Frame = 3
Query: 1551 DIDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            D  +     +K     FSCD C K F K SSL RHKYEHTG RP  C +C+KAFKHKHHL EH RLHSGEKP++C RCGKRFSHSGS+SQHMNHRY YC+
Sbjct:  755 DTGLPRKKLRKAESGNFSCDLCDKTFQKSSSLLRHKYEHTGKRPHQCEVCNKAFKHKHHLIEHSRLHSGEKPYRCDRCGKRFSHSGSYSQHMNHRYSYCR 854          

HSP 2 Score: 76.6406 bits (187), Expect = 8.299e-15
Identity = 43/55 (78.18%), Postives = 49/55 (89.09%), Query Frame = 3
Query:  495 RKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            RKF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:   28 RKFKCGECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKC 82          

HSP 3 Score: 75.485 bits (184), Expect = 1.803e-14
Identity = 36/68 (52.94%), Postives = 42/68 (61.76%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +C++C K F     L RH   H      R  QC  C+KAFK KHHL EHSR+HSGEKP+ C  CGKRF
Sbjct:  772 SCDLCDKTFQKSSSLLRHKYEHTGK---RPHQCEVCNKAFKHKHHLIEHSRLHSGEKPYRCDRCGKRF 836          

HSP 4 Score: 63.929 bits (154), Expect = 7.145e-11
Identity = 27/45 (60.00%), Postives = 33/45 (73.33%), Query Frame = 3
Query: 1662 EHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            ++ G R F C  C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:   23 QNAGHRKFKCGECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 67          
BLAST of Zeb-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000923.1 (pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 gene:ENSPMAG00000000839.1 transcript:ENSPMAT00000000923.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 2.839e-20
Identity = 30/76 (39.47%), Postives = 49/76 (64.47%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            ++C  C + F++ ++  RH+  HTG RP+ C  C + F+ K HL  H RLH+GE+P+ C  CG+RF+   S ++H+
Sbjct:   22 YACGDCGRRFARGANEERHRRVHTGERPYACAACGRRFRQKPHLAAHTRLHTGERPYACAACGRRFAKPYSLTRHL 97          

HSP 2 Score: 63.5438 bits (153), Expect = 1.113e-12
Identity = 26/67 (38.81%), Postives = 37/67 (55.22%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C  CG+ FA      RH + H      R + C  C + F+ K HL  H+R+H+GE+P+ C  CG+RF
Sbjct:   24 CGDCGRRFARGANEERHRRVHTGE---RPYACAACGRRFRQKPHLAAHTRLHTGERPYACAACGRRF 87          

HSP 3 Score: 56.9954 bits (136), Expect = 1.719e-10
Identity = 24/70 (34.29%), Postives = 36/70 (51.43%), Query Frame = 3
Query: 1614 CQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQH 1823
            C  VF+    L  +   HTG RP+ C  C + F    +   H+R+H+GE+P+ C  CG+RF      + H
Sbjct:    1 CGSVFA--VCLGSNIRNHTGERPYACGDCGRRFARGANEERHRRVHTGERPYACAACGRRFRQKPHLAAH 68          

HSP 4 Score: 48.521 bits (114), Expect = 1.591e-7
Identity = 21/64 (32.81%), Postives = 35/64 (54.69%), Query Frame = 3
Query:  423 CGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            CG +FA    L  ++++H      R + C  C + F    + + H R+H+GE+P+ C  CG+RF
Sbjct:    1 CGSVFAVC--LGSNIRNHTGE---RPYACGDCGRRFARGANEERHRRVHTGERPYACAACGRRF 59          

HSP 5 Score: 43.5134 bits (101), Expect = 9.740e-6
Identity = 17/49 (34.69%), Postives = 24/49 (48.98%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKR 1745
            ++C  C + F +   L  H   HTG RP+ C  C + F   + LT H R
Sbjct:   50 YACAACGRRFRQKPHLAAHTRLHTGERPYACAACGRRFAKPYSLTRHLR 98          
BLAST of Zeb-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005514.1 (pep scaffold:Pmarinus_7.0:GL480807:15328:23606:1 gene:ENSPMAG00000005009.1 transcript:ENSPMAT00000005514.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 1.202e-19
Identity = 60/114 (52.63%), Postives = 73/114 (64.04%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKS-HDNSKEL----------RKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC-SLNSGIDLQISQSMNGILA 716
            TC  CG  F    +L RHL S H + +E           RKF+C++C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC  L  G +  +S    G+ A
Sbjct:  117 TCQTCGCSFVYRSQLERHLASSHGSPREQAQAWAQNVANRKFKCSECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKCIGLGVGANAALSGGAGGMRA 230          

HSP 2 Score: 63.929 bits (154), Expect = 7.357e-11
Identity = 34/79 (43.04%), Postives = 40/79 (50.63%), Query Frame = 3
Query: 1602 SCDQCQKVFSKHSSLTRHKYEHTGV--------------RPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            +C  C   F   S L RH     G               R F C+ C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  117 TCQTCGCSFVYRSQLERHLASSHGSPREQAQAWAQNVANRKFKCSECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 195          
BLAST of Zeb-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008351.1 (pep scaffold:Pmarinus_7.0:GL476515:232573:234573:1 gene:ENSPMAG00000007556.1 transcript:ENSPMAT00000008351.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 9.949e-19
Identity = 37/78 (47.44%), Postives = 45/78 (57.69%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            + F C +C   F +   L  H+ +H+GVRP  C  C K F   H L  H+R H+GEKPF CQ CGKRFS S   S HM
Sbjct:    8 QPFICQECGTCFKRKWYLVAHERKHSGVRPHACEHCGKRFLASHDLVRHRRTHTGEKPFACQLCGKRFSRSYGLSCHM 85          

HSP 2 Score: 62.7734 bits (151), Expect = 4.874e-12
Identity = 27/75 (36.00%), Postives = 39/75 (52.00%), Query Frame = 3
Query: 1602 SCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            +C+ C K F     L RH+  HTG +PF C +C K F   + L+ H + H   K FQC++C + F H      H+
Sbjct:   39 ACEHCGKRFLASHDLVRHRRTHTGEKPFACQLCGKRFSRSYGLSCHMKTHGLPKEFQCEQCEESFPHLHMMRVHL 113          

HSP 3 Score: 60.4622 bits (145), Expect = 3.652e-11
Identity = 28/64 (43.75%), Postives = 38/64 (59.38%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCG 605
            C +CGK F+  Y L  H+K+H   KE   FQC QC ++F   H ++ H R H+GEK + C  CG
Sbjct:   68 CQLCGKRFSRSYGLSCHMKTHGLPKE---FQCEQCEESFPHLHMMRVHLRKHTGEKLYTCEYCG 128          

HSP 4 Score: 57.3806 bits (137), Expect = 4.133e-10
Identity = 28/67 (41.79%), Postives = 33/67 (49.25%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C  CG  F   + L  H + H     +R   C  C K F   H L  H R H+GEKPF C+ CGKRF
Sbjct:   12 CQECGTCFKRKWYLVAHERKHSG---VRPHACEHCGKRFLASHDLVRHRRTHTGEKPFACQLCGKRF 75          

HSP 5 Score: 55.0694 bits (131), Expect = 2.141e-9
Identity = 25/67 (37.31%), Postives = 37/67 (55.22%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFS 1799
            F+C  C K FS+   L+ H   H   + F C  C+++F H H +  H R H+GEK + C+ CG  +S
Sbjct:   66 FACQLCGKRFSRSYGLSCHMKTHGLPKEFQCEQCEESFPHLHMMRVHLRKHTGEKLYTCEYCGISYS 132          

HSP 6 Score: 55.0694 bits (131), Expect = 2.204e-9
Identity = 24/52 (46.15%), Postives = 31/52 (59.62%), Query Frame = 3
Query: 1668 TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQH 1823
            TG +PF+C  C   FK K +L  H+R HSG +P  C+ CGKRF  S    +H
Sbjct:    5 TGDQPFICQECGTCFKRKWYLVAHERKHSGVRPHACEHCGKRFLASHDLVRH 56          

HSP 7 Score: 45.0542 bits (105), Expect = 7.771e-6
Identity = 19/38 (50.00%), Postives = 23/38 (60.53%), Query Frame = 3
Query:  501 FQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            F C +C   FK K +L  H R HSG +P  C +CGKRF
Sbjct:   10 FICQECGTCFKRKWYLVAHERKHSGVRPHACEHCGKRF 47          
BLAST of Zeb-1 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 78.9518 bits (193), Expect = 9.883e-16
Identity = 39/98 (39.80%), Postives = 58/98 (59.18%), Query Frame = 3
Query: 1554 IDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM-NHRYKY 1844
            I  L + SK   ++ + C  C++ FS   +L +H   H+G +P+ C IC+K F     L  H R H+GEKP QC+ CGKRF+ S + S+H+  H+ KY
Sbjct:  756 IRHLKVHSK---YKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQKKY 850          

HSP 2 Score: 65.0846 bits (157), Expect = 2.499e-11
Identity = 29/91 (31.87%), Postives = 49/91 (53.85%), Query Frame = 3
Query: 1554 IDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            ++ +++T  K  ++    D C + F +   L RH   H+  +P+ C  C + F  +  L +H R HSGEKP++C  C K+F+ S S   H+
Sbjct:  726 LEAVHLTRGKSEYQCLWHD-CHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHI 815          

HSP 3 Score: 55.4546 bits (132), Expect = 1.909e-8
Identity = 26/67 (38.81%), Postives = 38/67 (56.72%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C  C + F++   L +H ++H   K    ++C+ C+K F     LK H R H+GEKP  C+ CGKRF
Sbjct:  770 CKTCKRCFSSEETLVQHTRTHSGEK---PYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRF 833          

HSP 4 Score: 53.1434 bits (126), Expect = 1.193e-7
Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  423 CGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C + F    +L RHLK H    + + ++C  C + F  +  L +H+R HSGEKP+ C  C K+F
Sbjct:  745 CHRTFPQRQKLIRHLKVH---SKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKF 805          
BLAST of Zeb-1 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 78.9518 bits (193), Expect = 1.018e-15
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 3
Query: 1605 CDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            C  C ++FS+ + L  H   H G +PFVC  C K F    +L  H+RLH+GEKP+ C  C K+FS  G+ + H+
Sbjct:  595 CPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 668          

HSP 2 Score: 71.2478 bits (173), Expect = 3.120e-13
Identity = 33/87 (37.93%), Postives = 46/87 (52.87%), Query Frame = 3
Query: 1587 SFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQC--QRCGKRFSHSGSFSQHMNHRYK 1841
             ++ F CD C K F++  +L  H+  HTG +P+ C ICDK F  K +L  H   H   KPF C  + C K F+  G+   H N  +K
Sbjct:  617 GYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHK 703          

HSP 3 Score: 58.5362 bits (140), Expect = 2.671e-9
Identity = 26/67 (38.81%), Postives = 38/67 (56.72%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C  C +LF+    L  H++SH   K    F C+ C K F    +L+ H R+H+GEKP++C  C K+F
Sbjct:  595 CPYCHRLFSQATHLEVHVRSHIGYK---PFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKF 658          

HSP 4 Score: 48.521 bits (114), Expect = 3.033e-6
Identity = 21/49 (42.86%), Postives = 28/49 (57.14%), Query Frame = 3
Query:  468 KSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            K   N++ ++K +C  C + F    HL+ H R H G KPF C  CGKRF
Sbjct:  582 KGTQNTRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRF 630          
BLAST of Zeb-1 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 75.485 bits (184), Expect = 1.252e-14
Identity = 33/94 (35.11%), Postives = 52/94 (55.32%), Query Frame = 3
Query: 1569 ITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQ---------RCGKRFSHSGSFSQH 1823
            +T+ + +   F+CD C K F++  +L  H   HT  RPF+C+IC KAF  +H    H+ LH+G+K + C           CGK+F+ S +  +H
Sbjct:  559 VTNNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRH 652          

HSP 2 Score: 61.2326 bits (147), Expect = 2.676e-10
Identity = 30/77 (38.96%), Postives = 40/77 (51.95%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCR---------NCGKRF 614
             C+VCGK F   Y L  HL++H N    R F C+ C KAF  +H  K H  +H+G+K + C           CGK+F
Sbjct:  570 ACDVCGKKFTRPYNLKSHLRTHTNE---RPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKF 643          
BLAST of Zeb-1 vs. Ensembl Yeast
Match: MSN2 (Stress-responsive transcriptional activator; activated in stochastic pulses of nuclear localization in response to various stress conditions; binds DNA at stress response elements of responsive genes; relative distribution to nucleus increases upon DNA replication stress [Source:SGD;Acc:S000004640])

HSP 1 Score: 62.3882 bits (150), Expect = 1.419e-10
Identity = 30/73 (41.10%), Postives = 41/73 (56.16%), Query Frame = 3
Query: 1629 SKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKR-LHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKY 1844
            S+ SS+     +    +PF C IC K+FK   HL  H R +HS E+PF C  C K+FS S + SQH+    K+
Sbjct:  629 SRRSSVVIESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKKH 701          

HSP 2 Score: 49.2914 bits (116), Expect = 1.679e-6
Identity = 23/49 (46.94%), Postives = 32/49 (65.31%), Query Frame = 3
Query:  477 DNSKEL--RKFQCNQCSKAFKFKHHLKEHSR-IHSGEKPFNCRNCGKRF 614
            +++KEL  + F C+ C K+FK   HLK H R +HS E+PF C  C K+F
Sbjct:  637 ESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKF 685          

HSP 3 Score: 46.9802 bits (110), Expect = 8.424e-6
Identity = 21/52 (40.38%), Postives = 28/52 (53.85%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRH-KYEHTGVRPFVCTICDKAFKHKHHLTEHKRLH 1751
            F C  C K F +   L RH +  H+  RPF C ICDK F    +L++H + H
Sbjct:  647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTH 698          
BLAST of Zeb-1 vs. Ensembl Yeast
Match: GIS1 (Histone demethylase and transcription factor; regulates genes during nutrient limitation; activity modulated by proteasome-mediated proteolysis; has JmjC and JmjN domain in N-terminus that interact, promoting stability and proper transcriptional activity; contains two transactivating domains downstream of Jmj domains and a C-terminal DNA binding domain; relocalizes to the cytosol in response to hypoxia; GIS1 has a paralog, RPH1, that arose from the whole genome duplication [Source:SGD;Acc:S000002503])

HSP 1 Score: 61.6178 bits (148), Expect = 2.596e-10
Identity = 25/52 (48.08%), Postives = 33/52 (63.46%), Query Frame = 3
Query: 1683 FVCTICDKAFKHKHHLTEHKR-LHSGEKPFQCQRCGKRFSHSGSFSQHMNHR 1835
            ++C  C++ F   HHLT HK+ +HSGEKP  C RCGKRF       QH+N +
Sbjct:  828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879          

HSP 2 Score: 48.521 bits (114), Expect = 2.940e-6
Identity = 19/39 (48.72%), Postives = 26/39 (66.67%), Query Frame = 3
Query:  501 FQCNQCSKAFKFKHHLKEHSR-IHSGEKPFNCRNCGKRF 614
            + C +C++ F   HHL  H + +HSGEKP +C  CGKRF
Sbjct:  828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRF 866          
BLAST of Zeb-1 vs. Ensembl Nematostella
Match: EDO49112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGT8])

HSP 1 Score: 79.337 bits (194), Expect = 2.707e-18
Identity = 35/73 (47.95%), Postives = 45/73 (61.64%), Query Frame = 3
Query: 1608 DQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            + C + FS+   LTRH   HTG +PF C IC + F    HLT H R H+GEKPF C+ CG+RF+ S    +HM
Sbjct:    9 ETCPRRFSRSDELTRHMRTHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACETCGRRFARSDERRRHM 81          

HSP 2 Score: 58.151 bits (139), Expect = 9.536e-11
Identity = 27/64 (42.19%), Postives = 35/64 (54.69%), Query Frame = 3
Query:  423 CGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C + F+    L RH+++H   K    FQC  C + F    HL  H R H+GEKPF C  CG+RF
Sbjct:   11 CPRRFSRSDELTRHMRTHTGQK---PFQCRICMRNFSRSDHLTTHIRTHTGEKPFACETCGRRF 71          
BLAST of Zeb-1 vs. Ensembl Nematostella
Match: EDO42609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V3])

HSP 1 Score: 77.411 bits (189), Expect = 3.187e-17
Identity = 39/89 (43.82%), Postives = 54/89 (60.67%), Query Frame = 3
Query: 1563 LNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTI--CDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQH 1823
            L +  +  S + F CDQC K F    SL RH+  H+G RP+ CT   C+++F  + HLT+H R H+GE+PFQC  C K F  SG  ++H
Sbjct:   23 LAVHVRTHSDKVFQCDQCGKSFRHSRSLARHELLHSGQRPYRCTEPECEQSFGRQDHLTDHLRTHTGERPFQCPHCSKTFRQSGVMNRH 111          

HSP 2 Score: 46.595 bits (109), Expect = 1.855e-6
Identity = 26/69 (37.68%), Postives = 38/69 (55.07%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQ--CSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C+ CGK F +   L RH   H      R ++C +  C ++F  + HL +H R H+GE+PF C +C K F
Sbjct:   37 CDQCGKSFRHSRSLARHELLHSGQ---RPYRCTEPECEQSFGRQDHLTDHLRTHTGERPFQCPHCSKTF 102          

HSP 3 Score: 44.669 bits (104), Expect = 9.567e-6
Identity = 21/60 (35.00%), Postives = 33/60 (55.00%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNC 593
            C  C   F    RL  H+++H +    + FQC+QC K+F+    L  H  +HSG++P+ C
Sbjct:   10 CPKCPMTFPRRSRLAVHVRTHSD----KVFQCDQCGKSFRHSRSLARHELLHSGQRPYRC 65          
BLAST of Zeb-1 vs. Ensembl Nematostella
Match: EDO47692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLH7])

HSP 1 Score: 77.7962 bits (190), Expect = 3.630e-17
Identity = 36/75 (48.00%), Postives = 50/75 (66.67%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQH 1823
            F C  C + FS+ SS+T H   H G RP+ C +C+KAF     LT+H R H+GEKP+QC+ C +RFS SG+ ++H
Sbjct:   50 FRCRVCGRQFSQSSSVTTHMRTHNGERPYKCKVCNKAFADSSTLTKHVRTHTGEKPYQCEICHQRFSQSGNMNRH 124          

HSP 2 Score: 70.8626 bits (172), Expect = 9.001e-15
Identity = 31/68 (45.59%), Postives = 47/68 (69.12%), Query Frame = 3
Query: 1626 FSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
            +++ S+L  H   H+GV+P+ C +C K+F    +LT H R+HSGEKPF+C+ CG++FS S S + HM 
Sbjct:    3 YARLSTLRLHMRTHSGVKPYQCMVCLKSFTQAANLTAHFRIHSGEKPFRCRVCGRQFSQSSSVTTHMR 70          

HSP 3 Score: 62.3882 bits (150), Expect = 8.220e-12
Identity = 27/77 (35.06%), Postives = 47/77 (61.04%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
            + C  C K F++ ++LT H   H+G +PF C +C + F     +T H R H+GE+P++C+ C K F+ S + ++H+ 
Sbjct:   22 YQCMVCLKSFTQAANLTAHFRIHSGEKPFRCRVCGRQFSQSSSVTTHMRTHNGERPYKCKVCNKAFADSSTLTKHVR 98          

HSP 4 Score: 53.1434 bits (126), Expect = 1.435e-8
Identity = 26/60 (43.33%), Postives = 36/60 (60.00%), Query Frame = 3
Query:  435 FANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +A +  L  H+++H   K    +QC  C K+F    +L  H RIHSGEKPF CR CG++F
Sbjct:    3 YARLSTLRLHMRTHSGVKP---YQCMVCLKSFTQAANLTAHFRIHSGEKPFRCRVCGRQF 59          

HSP 5 Score: 53.1434 bits (126), Expect = 1.463e-8
Identity = 25/67 (37.31%), Postives = 39/67 (58.21%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C VCG+ F+    +  H+++H+     R ++C  C+KAF     L +H R H+GEKP+ C  C +RF
Sbjct:   52 CRVCGRQFSQSSSVTTHMRTHNGE---RPYKCKVCNKAFADSSTLTKHVRTHTGEKPYQCEICHQRF 115          

HSP 6 Score: 47.3654 bits (111), Expect = 1.704e-6
Identity = 20/51 (39.22%), Postives = 30/51 (58.82%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLH 1751
            + C  C K F+  S+LT+H   HTG +P+ C IC + F    ++  HKR+H
Sbjct:   78 YKCKVCNKAFADSSTLTKHVRTHTGEKPYQCEICHQRFSQSGNMNRHKRIH 128          
BLAST of Zeb-1 vs. Ensembl Nematostella
Match: EDO38419 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX8])

HSP 1 Score: 84.3445 bits (207), Expect = 4.069e-17
Identity = 37/75 (49.33%), Postives = 52/75 (69.33%), Query Frame = 3
Query: 1605 CDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
            C QC KVF++  +LT H   H+G +P  CT C KAF H  +LT+H R+HSGEKP++C +CGK F+H+   ++HM 
Sbjct:  459 CTQCGKVFAQAGNLTTHMRTHSGEKPHKCTQCGKAFAHASNLTKHMRIHSGEKPYKCTQCGKVFAHTSHLTKHMR 533          

HSP 2 Score: 82.4185 bits (202), Expect = 1.675e-16
Identity = 38/80 (47.50%), Postives = 50/80 (62.50%), Query Frame = 3
Query: 1590 FETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
            ++ + C QC K F+  SSLT H   H+G +P  CT C KAF     LT H R HSGEKP +C +CGK F+H+G+ + HM 
Sbjct:  286 YKPYKCTQCGKAFAHASSLTEHMRTHSGEKPHKCTQCGKAFARASVLTRHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMR 365          

HSP 3 Score: 80.4925 bits (197), Expect = 7.251e-16
Identity = 37/75 (49.33%), Postives = 47/75 (62.67%), Query Frame = 3
Query: 1605 CDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
            C QC K F++ S LTRH   H+G +P  CT C K F H  +LT H R HSGEKP +C +CGK F+ +G  + HM 
Sbjct:  319 CTQCGKAFARASVLTRHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVFAQAGILTTHMR 393          

HSP 4 Score: 79.337 bits (194), Expect = 1.667e-15
Identity = 37/75 (49.33%), Postives = 48/75 (64.00%), Query Frame = 3
Query: 1605 CDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
            C QC KVF++   LT H   H+G +P  CT C KAF    +LT H R HSGEKP +C +CGK F+H+G+ + HM 
Sbjct:  375 CTQCGKVFAQAGILTTHMRTHSGEKPHKCTQCGKAFAQASNLTTHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMR 449          

HSP 5 Score: 77.7962 bits (190), Expect = 4.770e-15
Identity = 36/75 (48.00%), Postives = 48/75 (64.00%), Query Frame = 3
Query: 1605 CDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
            C QC K F++ S+LT H   H+G +P  CT C K F H  +LT H R HSGEKP +C +CGK F+ +G+ + HM 
Sbjct:  403 CTQCGKAFAQASNLTTHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVFAQAGNLTTHMR 477          

HSP 6 Score: 75.8702 bits (185), Expect = 2.056e-14
Identity = 35/75 (46.67%), Postives = 47/75 (62.67%), Query Frame = 3
Query: 1605 CDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
            C QC KVF+   +LT H   H+G +P  CT C K F    +LT H R HSGEKP +C +CGK F+H+ + ++HM 
Sbjct:  431 CTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVFAQAGNLTTHMRTHSGEKPHKCTQCGKAFAHASNLTKHMR 505          

HSP 7 Score: 71.2478 bits (173), Expect = 5.199e-13
Identity = 33/75 (44.00%), Postives = 44/75 (58.67%), Query Frame = 3
Query: 1605 CDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
            C  C+K F  +  +  H   HT  +P+ CT C KAF H   LTEH R HSGEKP +C +CGK F+ +   ++HM 
Sbjct:  263 CPICEKDFCDYRYMIMHILTHTKYKPYKCTQCGKAFAHASSLTEHMRTHSGEKPHKCTQCGKAFARASVLTRHMR 337          

HSP 8 Score: 70.8626 bits (172), Expect = 7.054e-13
Identity = 34/75 (45.33%), Postives = 44/75 (58.67%), Query Frame = 3
Query: 1605 CDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
            C QC KVF+   +LT H   H+G +P  CT C K F     LT H R HSGEKP +C +CGK F+ + + + HM 
Sbjct:  347 CTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVFAQAGILTTHMRTHSGEKPHKCTQCGKAFAQASNLTTHMR 421          

HSP 9 Score: 64.3142 bits (155), Expect = 8.979e-11
Identity = 31/67 (46.27%), Postives = 39/67 (58.21%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C  CGK+FA    L  H+++H   K     +C QC KAF    +L +H RIHSGEKP+ C  CGK F
Sbjct:  459 CTQCGKVFAQAGNLTTHMRTHSGEKP---HKCTQCGKAFAHASNLTKHMRIHSGEKPYKCTQCGKVF 522          

HSP 10 Score: 59.6918 bits (143), Expect = 2.534e-9
Identity = 30/67 (44.78%), Postives = 35/67 (52.24%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C  CGK FA    L RH+++H   K     +C QC K F    +L  H R HSGEKP  C  CGK F
Sbjct:  319 CTQCGKAFARASVLTRHMRTHSGEKP---HKCTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVF 382          

HSP 11 Score: 58.151 bits (139), Expect = 6.630e-9
Identity = 30/67 (44.78%), Postives = 35/67 (52.24%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C  CGK FA+   L  H+++H   K     +C QC KAF     L  H R HSGEKP  C  CGK F
Sbjct:  291 CTQCGKAFAHASSLTEHMRTHSGEKP---HKCTQCGKAFARASVLTRHMRTHSGEKPHKCTQCGKVF 354          

HSP 12 Score: 57.7658 bits (138), Expect = 8.162e-9
Identity = 30/67 (44.78%), Postives = 36/67 (53.73%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C  CGK+FA    L  H+++H   K     +C QC KAF    +L  H R HSGEKP  C  CGK F
Sbjct:  375 CTQCGKVFAQAGILTTHMRTHSGEKP---HKCTQCGKAFAQASNLTTHMRTHSGEKPHKCTQCGKVF 438          

HSP 13 Score: 57.7658 bits (138), Expect = 1.031e-8
Identity = 29/67 (43.28%), Postives = 36/67 (53.73%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C  CGK+FA+   L  H+++H   K     +C QC K F    +L  H R HSGEKP  C  CGK F
Sbjct:  431 CTQCGKVFAHAGNLTTHMRTHSGEKP---HKCTQCGKVFAQAGNLTTHMRTHSGEKPHKCTQCGKAF 494          

HSP 14 Score: 56.9954 bits (136), Expect = 1.549e-8
Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 3
Query: 1605 CDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEK 1763
            C QC K F+  S+LT+H   H+G +P+ CT C K F H  HLT+H R HS EK
Sbjct:  487 CTQCGKAFAHASNLTKHMRIHSGEKPYKCTQCGKVFAHTSHLTKHMRTHSREK 539          

HSP 15 Score: 56.6102 bits (135), Expect = 1.907e-8
Identity = 29/67 (43.28%), Postives = 34/67 (50.75%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C  CGK FA    L  H+++H   K     +C QC K F    +L  H R HSGEKP  C  CGK F
Sbjct:  403 CTQCGKAFAQASNLTTHMRTHSGEKP---HKCTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVF 466          

HSP 16 Score: 56.6102 bits (135), Expect = 2.152e-8
Identity = 29/67 (43.28%), Postives = 35/67 (52.24%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C  CGK+FA+   L  H+++H   K     +C QC K F     L  H R HSGEKP  C  CGK F
Sbjct:  347 CTQCGKVFAHAGNLTTHMRTHSGEKP---HKCTQCGKVFAQAGILTTHMRTHSGEKPHKCTQCGKAF 410          

HSP 17 Score: 55.0694 bits (131), Expect = 7.042e-8
Identity = 28/69 (40.58%), Postives = 36/69 (52.17%), Query Frame = 3
Query:  408 QTCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            + C +C K F +   +  H+ +H   K    ++C QC KAF     L EH R HSGEKP  C  CGK F
Sbjct:  261 RVCPICEKDFCDYRYMIMHILTHTKYKP---YKCTQCGKAFAHASSLTEHMRTHSGEKPHKCTQCGKAF 326          

HSP 18 Score: 48.9062 bits (115), Expect = 5.769e-6
Identity = 27/78 (34.62%), Postives = 41/78 (52.56%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKY-EHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
              C  CQ+  +   +LT H   EH      VC IC+K F    ++  H   H+  KP++C +CGK F+H+ S ++HM 
Sbjct:  232 LKCKLCQQQCATPKTLTGHIVSEHCENSSRVCPICEKDFCDYRYMIMHILTHTKYKPYKCTQCGKAFAHASSLTEHMR 309          
BLAST of Zeb-1 vs. Ensembl Nematostella
Match: EDO25459 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWF0])

HSP 1 Score: 78.5666 bits (192), Expect = 9.675e-17
Identity = 31/75 (41.33%), Postives = 46/75 (61.33%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQH 1823
            F C  C K F++  +L RH   H  ++P+ C+IC + F+ K +L EH   HSGEKP+QC +C  RF+  G+  +H
Sbjct:  123 FPCKICDKRFTQRGNLARHMLIHLKLKPYECSICKRRFRQKAYLREHMNFHSGEKPYQCPKCDSRFTFHGTLRKH 197          

HSP 2 Score: 63.929 bits (154), Expect = 1.108e-11
Identity = 28/76 (36.84%), Postives = 39/76 (51.32%), Query Frame = 3
Query: 1602 SCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN 1829
            +C++C K F +   L  H   H   RPF C ICDK F  + +L  H  +H   KP++C  C +RF       +HMN
Sbjct:   96 ACERCGKEFKEQRLLDLHMRLHNEDRPFPCKICDKRFTQRGNLARHMLIHLKLKPYECSICKRRFRQKAYLREHMN 171          

HSP 3 Score: 57.7658 bits (138), Expect = 1.193e-9
Identity = 26/67 (38.81%), Postives = 38/67 (56.72%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C +C K F     L RH+  H    +L+ ++C+ C + F+ K +L+EH   HSGEKP+ C  C  RF
Sbjct:  125 CKICDKRFTQRGNLARHMLIH---LKLKPYECSICKRRFRQKAYLREHMNFHSGEKPYQCPKCDSRF 188          

HSP 4 Score: 47.7506 bits (112), Expect = 3.076e-6
Identity = 26/72 (36.11%), Postives = 34/72 (47.22%), Query Frame = 3
Query:  399 QNGQTCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            + G  C  CGK F     L  H++ H+   E R F C  C K F  + +L  H  IH   KP+ C  C +RF
Sbjct:   92 EGGVACERCGKEFKEQRLLDLHMRLHN---EDRPFPCKICDKRFTQRGNLARHMLIHLKLKPYECSICKRRF 160          
BLAST of Zeb-1 vs. Ensembl Medaka
Match: zeb1b (zinc finger E-box binding homeobox 1 [Source:NCBI gene;Acc:101158561])

HSP 1 Score: 154.451 bits (389), Expect = 9.851e-39
Identity = 66/91 (72.53%), Postives = 72/91 (79.12%), Query Frame = 3
Query: 1578 KKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            KK     ++CD C K+F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  809 KKTESGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICSKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 899          

HSP 2 Score: 88.1965 bits (217), Expect = 1.266e-17
Identity = 52/92 (56.52%), Postives = 63/92 (68.48%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELR---------KFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            +C  C   FA   +L RH+  H N ++ R         KF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  161 SCPECSYSFAYRAQLERHMTVHRNGRDQRHITQSGGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKC 252          

HSP 3 Score: 78.5666 bits (192), Expect = 1.151e-14
Identity = 38/80 (47.50%), Postives = 46/80 (57.50%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEH------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            E+FSC +C   F+  + L RH   H             G R F CT C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  158 ESFSCPECSYSFAYRAQLERHMTVHRNGRDQRHITQSGGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 237          

HSP 4 Score: 77.0258 bits (188), Expect = 3.259e-14
Identity = 35/68 (51.47%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K+F     L RH   H      R  +C  CSKAFK KHHL EH R+HSGEKP+ C  CGKRF
Sbjct:  817 ACDLCDKIFQKSSSLLRHKYEHTGK---RPHECGICSKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRF 881          
BLAST of Zeb-1 vs. Ensembl Medaka
Match: zeb2b (zinc finger E-box binding homeobox 2 [Source:NCBI gene;Acc:101172796])

HSP 1 Score: 151.369 bits (381), Expect = 1.035e-37
Identity = 66/91 (72.53%), Postives = 71/91 (78.02%), Query Frame = 3
Query: 1578 KKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            KK     ++CD C K F K SSL RHKYEHTG RP  C IC KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  975 KKTESGMYACDLCDKTFQKSSSLLRHKYEHTGKRPHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 1065          

HSP 2 Score: 87.0409 bits (214), Expect = 2.630e-17
Identity = 53/107 (49.53%), Postives = 70/107 (65.42%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKEL----------RKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKCSLNSGIDLQISQSM 701
             C +C   FA   +L RH+ +H  +++           RKF+C +C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC     ++ ++  SM
Sbjct:  216 ACPLCNYTFAYRTQLERHMATHKPARDQHQMLNQEAGNRKFKCAECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLIAVNGRMRNSM 322          

HSP 3 Score: 75.8702 bits (185), Expect = 8.557e-14
Identity = 36/68 (52.94%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K F     L RH   H      R  QC  C KAFK KHHL EHSR+HSGEKP+ C  CGKRF
Sbjct:  983 ACDLCDKTFQKSSSLLRHKYEHTGK---RPHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRF 1047          

HSP 4 Score: 75.0998 bits (183), Expect = 1.657e-13
Identity = 36/81 (44.44%), Postives = 43/81 (53.09%), Query Frame = 3
Query: 1593 ETFSCDQCQKVFSKHSSLTRHKYEH-------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            E F+C  C   F+  + L RH   H              G R F C  C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  213 ENFACPLCNYTFAYRTQLERHMATHKPARDQHQMLNQEAGNRKFKCAECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 293          
BLAST of Zeb-1 vs. Ensembl Medaka
Match: ENSORLT00000031578.1 (zinc finger E-box-binding homeobox 2 [Source:NCBI gene;Acc:101167278])

HSP 1 Score: 148.673 bits (374), Expect = 8.472e-37
Identity = 65/91 (71.43%), Postives = 70/91 (76.92%), Query Frame = 3
Query: 1578 KKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            KK     ++CD C K F K SSL RHKYEHTG RP  C  C KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  920 KKTESGMYACDLCDKTFQKTSSLLRHKYEHTGKRPHQCQTCKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 1010          

HSP 2 Score: 84.7297 bits (208), Expect = 1.479e-16
Identity = 51/93 (54.84%), Postives = 63/93 (67.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKEL----------RKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
             C +C   F +   L RH+ +H   +E           RKF+C++C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  192 ACQLCTGTFDSSSLLDRHMTTHKLGREKPPPLSEEAENRKFKCSECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKC 284          

HSP 3 Score: 77.411 bits (189), Expect = 3.098e-14
Identity = 36/68 (52.94%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K F     L RH   H      R  QC  C KAFK KHHL EHSR+HSGEKP+ C  CGKRF
Sbjct:  928 ACDLCDKTFQKTSSLLRHKYEHTGK---RPHQCQTCKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRF 992          

HSP 4 Score: 73.1738 bits (178), Expect = 5.318e-13
Identity = 40/98 (40.82%), Postives = 51/98 (52.04%), Query Frame = 3
Query: 1542 TSMDIDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEH-------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            TS+   ++N   + D  E+F+C  C   F   S L RH   H                R F C+ C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  174 TSLKEHIMNRHKRND--ESFACQLCTGTFDSSSLLDRHMTTHKLGREKPPPLSEEAENRKFKCSECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 269          
BLAST of Zeb-1 vs. Ensembl Medaka
Match: ENSORLT00000025013.2 (zinc finger E-box-binding homeobox 2 [Source:NCBI gene;Acc:101167278])

HSP 1 Score: 148.288 bits (373), Expect = 1.151e-36
Identity = 65/91 (71.43%), Postives = 70/91 (76.92%), Query Frame = 3
Query: 1578 KKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            KK     ++CD C K F K SSL RHKYEHTG RP  C  C KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  862 KKTESGMYACDLCDKTFQKTSSLLRHKYEHTGKRPHQCQTCKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 952          

HSP 2 Score: 84.3445 bits (207), Expect = 1.904e-16
Identity = 51/93 (54.84%), Postives = 63/93 (67.74%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKEL----------RKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
             C +C   F +   L RH+ +H   +E           RKF+C++C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:  134 ACQLCTGTFDSSSLLDRHMTTHKLGREKPPPLSEEAENRKFKCSECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKC 226          

HSP 3 Score: 77.0258 bits (188), Expect = 3.763e-14
Identity = 36/68 (52.94%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K F     L RH   H      R  QC  C KAFK KHHL EHSR+HSGEKP+ C  CGKRF
Sbjct:  870 ACDLCDKTFQKTSSLLRHKYEHTGK---RPHQCQTCKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRF 934          

HSP 4 Score: 73.1738 bits (178), Expect = 6.468e-13
Identity = 40/98 (40.82%), Postives = 51/98 (52.04%), Query Frame = 3
Query: 1542 TSMDIDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEH-------------TGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            TS+   ++N   + D  E+F+C  C   F   S L RH   H                R F C+ C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:  116 TSLKEHIMNRHKRND--ESFACQLCTGTFDSSSLLDRHMTTHKLGREKPPPLSEEAENRKFKCSECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 211          
BLAST of Zeb-1 vs. Ensembl Medaka
Match: ENSORLT00000045744.1 (zinc finger E-box-binding homeobox 2 [Source:NCBI gene;Acc:101167278])

HSP 1 Score: 147.517 bits (371), Expect = 1.349e-36
Identity = 65/91 (71.43%), Postives = 70/91 (76.92%), Query Frame = 3
Query: 1578 KKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCK 1850
            KK     ++CD C K F K SSL RHKYEHTG RP  C  C KAFKHKHHL EH RLHSGEKP+QC +CGKRFSHSGS+SQHMNHRY YCK
Sbjct:  710 KKTESGMYACDLCDKTFQKTSSLLRHKYEHTGKRPHQCQTCKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK 800          

HSP 2 Score: 77.0258 bits (188), Expect = 3.061e-14
Identity = 44/57 (77.19%), Postives = 51/57 (89.47%), Query Frame = 3
Query:  489 ELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKC 659
            E RKF+C++C KAFK+KHHLKEH RIHSGEKP+ C NC KRFSHSGSYSSH++SKKC
Sbjct:   18 ENRKFKCSECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKC 74          

HSP 3 Score: 76.6406 bits (187), Expect = 4.395e-14
Identity = 36/68 (52.94%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C++C K F     L RH   H      R  QC  C KAFK KHHL EHSR+HSGEKP+ C  CGKRF
Sbjct:  718 ACDLCDKTFQKTSSLLRHKYEHTGK---RPHQCQTCKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRF 782          

HSP 4 Score: 63.929 bits (154), Expect = 3.848e-10
Identity = 26/40 (65.00%), Postives = 31/40 (77.50%), Query Frame = 3
Query: 1677 RPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRF 1796
            R F C+ C KAFK+KHHL EH R+HSGEKP++C  C KRF
Sbjct:   20 RKFKCSECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 59          
BLAST of Zeb-1 vs. Planmine SMEST
Match: SMESG000013012.1 (SMESG000013012.1)

HSP 1 Score: 1037.71 bits (2682), Expect = 0.000e+0
Identity = 573/575 (99.65%), Postives = 575/575 (100.00%), Query Frame = 3
Query:  129 MTNCTEFLQKTISDSPILNEFSEVTSSTPDQIADVSESQLLTIDDLKSSINLQTFSPTSSNNTKTTANQDQXXXXXXXXXXXXXXXXXXXQNGQTCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKCSLNSGIDLQISQSMNGILATKSEPDCGYELSSINKILQTVKSGSHNLTNPHNNDISSLFSPPAVNWQEKSDQESGWSNKVQSMTNYTQMKKSSLGDFERFPVLLNNRGWNXXXXXXXXELNHYFQLDNIFNNLVPSSTADNNPLLMHLIFGNKFPLFPSSHCPLNQSPIQASENPNISSMFFIPTLPQQSFPPTNASQYEPLDLSVTKSEPYSNGPSNENFTDLNSNFSLWQQKSSEKSFSFNDSPLNLSQKNPISKSHFSDLSTESDDLXXXXXXXXXXXXXXXXXXXQLILETSMDIDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP 1853
            MTNCTEFLQK+ISDSPILNEFSEVTSSTPDQIADVSESQLLTIDDLKSSINLQTFSPTSSNNTKTTANQDQLLSSLSNSSTNSKSISSPLQNGQTCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFSHSGSYSSHMTSKKCSLNSGIDLQISQSMNGILATKSEP+CGYELSSINKILQTVKSGSHNLTNPHNNDISSLFSPPAVNWQEKSDQESGWSNKVQSMTNYTQMKKSSLGDFERFPVLLNNRGWNSSSLPSPLELNHYFQLDNIFNNLVPSSTADNNPLLMHLIFGNKFPLFPSSHCPLNQSPIQASENPNISSMFFIPTLPQQSFPPTNASQYEPLDLSVTKSEPYSNGPSNENFTDLNSNFSLWQQKSSEKSFSFNDSPLNLSQKNPISKSHFSDLSTESDDLNSENSINNENKSIISSKSNQLILETSMDIDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP
Sbjct:    1 MTNCTEFLQKSISDSPILNEFSEVTSSTPDQIADVSESQLLTIDDLKSSINLQTFSPTSSNNTKTTANQDQLLSSLSNSSTNSKSISSPLQNGQTCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFSHSGSYSSHMTSKKCSLNSGIDLQISQSMNGILATKSEPECGYELSSINKILQTVKSGSHNLTNPHNNDISSLFSPPAVNWQEKSDQESGWSNKVQSMTNYTQMKKSSLGDFERFPVLLNNRGWNSSSLPSPLELNHYFQLDNIFNNLVPSSTADNNPLLMHLIFGNKFPLFPSSHCPLNQSPIQASENPNISSMFFIPTLPQQSFPPTNASQYEPLDLSVTKSEPYSNGPSNENFTDLNSNFSLWQQKSSEKSFSFNDSPLNLSQKNPISKSHFSDLSTESDDLNSENSINNENKSIISSKSNQLILETSMDIDMLNITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMNHRYKYCKP 575          
BLAST of Zeb-1 vs. Planmine SMEST
Match: SMESG000000960.1 (SMESG000000960.1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.718e-17
Identity = 38/90 (42.22%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 1563 LNITSKKDSFET--FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            L+  S+K  F    F+C+ C+K F +   L RH+  HTG RP  C  CDK F    HL+ H R+H+GEKP+QC  C + FS S    +H+
Sbjct:   92 LSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHI 181          

HSP 2 Score: 54.6842 bits (130), Expect = 2.458e-8
Identity = 28/68 (41.18%), Postives = 34/68 (50.00%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            TCN C K F     L RH + H   + L    C+ C K F    HL  H RIH+GEKP+ C  C + F
Sbjct:  107 TCNTCKKSFYRRDELKRHERIHTGERPL---ACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLF 171          

HSP 3 Score: 51.2174 bits (121), Expect = 3.562e-7
Identity = 20/41 (48.78%), Postives = 27/41 (65.85%), Query Frame = 3
Query:  492 LRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            +++F CN C K+F  +  LK H RIH+GE+P  C  C KRF
Sbjct:  103 IKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRF 143          
BLAST of Zeb-1 vs. Planmine SMEST
Match: SMESG000064097.1 (SMESG000064097.1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.888e-17
Identity = 36/76 (47.37%), Postives = 47/76 (61.84%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            F C+QC + F++ S L  H   HTG RP+ C IC +AFK K  L  H+R+HSGE+PF C+ CGK F       QH+
Sbjct:  209 FKCNQCDRAFAQKSGLEAHLKLHTGERPYECQICGRAFKLKAQLQTHERVHSGERPFGCKICGKLFRQQCHVVQHL 284          

HSP 2 Score: 70.0922 bits (170), Expect = 1.568e-12
Identity = 31/67 (46.27%), Postives = 39/67 (58.21%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            CN C + FA    L  HLK H      R ++C  C +AFK K  L+ H R+HSGE+PF C+ CGK F
Sbjct:  211 CNQCDRAFAQKSGLEAHLKLHTGE---RPYECQICGRAFKLKAQLQTHERVHSGERPFGCKICGKLF 274          

HSP 3 Score: 53.1434 bits (126), Expect = 4.060e-7
Identity = 20/45 (44.44%), Postives = 30/45 (66.67%), Query Frame = 3
Query:  480 NSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            N    R F+CNQC +AF  K  L+ H ++H+GE+P+ C+ CG+ F
Sbjct:  202 NDASRRPFKCNQCDRAFAQKSGLEAHLKLHTGERPYECQICGRAF 246          
BLAST of Zeb-1 vs. Planmine SMEST
Match: SMESG000000959.1 (SMESG000000959.1)

HSP 1 Score: 79.7221 bits (195), Expect = 7.992e-17
Identity = 33/87 (37.93%), Postives = 48/87 (55.17%), Query Frame = 3
Query: 1566 NITSKKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM 1826
            N +  ++    F+C+ C+K F +   L RH+  HTG RP  C  CDK F    HL+ H R+H+GEKP++C  C + F  S    +H 
Sbjct:  106 NSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 192          

HSP 2 Score: 58.151 bits (139), Expect = 1.756e-9
Identity = 29/68 (42.65%), Postives = 35/68 (51.47%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            TCN C K F     L RH + H   + L    CN C K F    HL  H+RIH+GEKP+ C  C + F
Sbjct:  118 TCNTCKKAFYRRDELKRHERIHTGERPL---ACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLF 182          

HSP 3 Score: 53.9138 bits (128), Expect = 5.044e-8
Identity = 22/42 (52.38%), Postives = 27/42 (64.29%), Query Frame = 3
Query:  489 ELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             +R+F CN C KAF  +  LK H RIH+GE+P  C  C KRF
Sbjct:  113 RVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRF 154          
BLAST of Zeb-1 vs. Planmine SMEST
Match: SMESG000005754.1 (SMESG000005754.1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.653e-16
Identity = 38/87 (43.68%), Postives = 51/87 (58.62%), Query Frame = 3
Query: 1578 KKDSFETFSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHMN-HR 1835
            K D    ++C  C+K+F + S+L  H+  HTG RPFVC  C K F    HL +H  +H+GEKP +C  C KRFS + +   HM  HR
Sbjct:  380 KTDGKSKYNCSVCKKIFGQLSNLKVHQRTHTGERPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKTHMRLHR 466          

HSP 2 Score: 70.4774 bits (171), Expect = 2.214e-12
Identity = 35/98 (35.71%), Postives = 51/98 (52.04%), Query Frame = 3
Query: 1599 FSCDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQHM----NHRYKYCKP*PRCFLSKS 1880
            F C  C K F++ + L +H   HTG +P  C++C K F    +L  H RLH GEKPF+C+ C  +F+       H+    N R   C    +C++S S
Sbjct:  415 FVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKFTQLVHLQLHLRLHTNERPFICPRCNKCYISIS 512          

HSP 3 Score: 60.4622 bits (145), Expect = 2.989e-9
Identity = 27/67 (40.30%), Postives = 37/67 (55.22%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
            C+VC K+F  +  L  H ++H      R F C  C K F    HL++H+ +H+GEKP  C  C KRF
Sbjct:  389 CSVCKKIFGQLSNLKVHQRTHTGE---RPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRF 452          

HSP 4 Score: 59.3066 bits (142), Expect = 5.769e-9
Identity = 29/73 (39.73%), Postives = 34/73 (46.58%), Query Frame = 3
Query: 1605 CDQCQKVFSKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQRCGKRFSHSGSFSQH 1823
            C  C K FS  S+L  H   H G +PF C  C   F    HL  H RLH+ E+PF C RC K +        H
Sbjct:  445 CSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKFTQLVHLQLHLRLHTNERPFICPRCNKCYISISGIRTH 517          

HSP 5 Score: 55.0694 bits (131), Expect = 1.307e-7
Identity = 27/68 (39.71%), Postives = 34/68 (50.00%), Query Frame = 3
Query:  411 TCNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRF 614
             C  CGK F  +  L +H   H   K     +C+ CSK F    +LK H R+H GEKPF C  C  +F
Sbjct:  416 VCQTCGKGFTQLAHLQKHNLVHTGEKP---HECSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKF 480          

HSP 6 Score: 51.2174 bits (121), Expect = 2.235e-6
Identity = 34/120 (28.33%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  414 CNVCGKLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGEKPFNCRNCGKRFXXXXXXXXXXXXKKCSLNS----GIDLQISQSM----NGILATKSEPDCGYEL 749
            C+VC K F++   L  H++ H   K    F+C  C   F    HL+ H R+H+ E+PF C  C K +       +H ++  C  +S     + L++ + +    NG ++ K+E  C Y +
Sbjct:  445 CSVCSKRFSSTSNLKTHMRLHRGEKP---FKCEFCKTKFTQLVHLQLHLRLHTNERPFICPRCNKCYISISGIRTHWSNSSCYDSSDDTDNVLLEMIEDLEHKYNGKISFKAETKCVYNI 561          
The following BLAST results are available for this feature:
BLAST of Zeb-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZEB11.522e-3876.19zinc finger E-box binding homeobox 1 [Source:HGNC ... [more]
ZEB11.599e-3876.19zinc finger E-box binding homeobox 1 [Source:HGNC ... [more]
ZEB11.617e-3876.19zinc finger E-box binding homeobox 1 [Source:HGNC ... [more]
ZEB11.627e-3876.19zinc finger E-box binding homeobox 1 [Source:HGNC ... [more]
ZEB11.829e-3876.19zinc finger E-box binding homeobox 1 [Source:HGNC ... [more]
back to top
BLAST of Zeb-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zag-12.331e-4376.60Zinc finger E-box-binding homeobox protein zag-1 ... [more]
egrh-14.937e-1648.61EGR (Early Growth factor Response factor) Homolog ... [more]
che-16.590e-1640.79Transcription factor che-1 [Source:UniProtKB/Swis... [more]
egrh-26.660e-1647.22EGR (Early Growth factor Response factor) Homolog ... [more]
che-16.669e-1640.79Transcription factor che-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Zeb-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zfh13.442e-3977.65gene:FBgn0004606 transcript:FBtr0085701[more]
zfh13.462e-3977.65gene:FBgn0004606 transcript:FBtr0085702[more]
zfh13.586e-3977.65gene:FBgn0004606 transcript:FBtr0331180[more]
erm1.757e-1850.65gene:FBgn0031375 transcript:FBtr0330202[more]
erm2.046e-1850.65gene:FBgn0031375 transcript:FBtr0330201[more]
back to top
BLAST of Zeb-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zeb1a4.950e-4068.00zinc finger E-box binding homeobox 1a [Source:ZFIN... [more]
zeb1a5.133e-4068.00zinc finger E-box binding homeobox 1a [Source:ZFIN... [more]
zeb1a5.315e-4068.00zinc finger E-box binding homeobox 1a [Source:ZFIN... [more]
zeb1b4.136e-3965.74zinc finger E-box binding homeobox 1b [Source:ZFIN... [more]
zeb1b4.303e-3965.74zinc finger E-box binding homeobox 1b [Source:ZFIN... [more]
back to top
BLAST of Zeb-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankzf11.051e-3876.19ankyrin repeat and zinc finger peptidyl tRNA hydro... [more]
ankzf11.133e-3876.19ankyrin repeat and zinc finger peptidyl tRNA hydro... [more]
ankzf11.190e-3876.19ankyrin repeat and zinc finger peptidyl tRNA hydro... [more]
ankzf11.217e-3876.19ankyrin repeat and zinc finger peptidyl tRNA hydro... [more]
ankzf12.134e-3876.19ankyrin repeat and zinc finger peptidyl tRNA hydro... [more]
back to top
BLAST of Zeb-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zeb11.981e-3876.19zinc finger E-box binding homeobox 1 [Source:MGI S... [more]
Zeb29.269e-3872.53zinc finger E-box binding homeobox 2 [Source:MGI S... [more]
Zeb29.626e-3872.53zinc finger E-box binding homeobox 2 [Source:MGI S... [more]
Zeb29.807e-3872.53zinc finger E-box binding homeobox 2 [Source:MGI S... [more]
Zeb29.807e-3872.53zinc finger E-box binding homeobox 2 [Source:MGI S... [more]
back to top
BLAST of Zeb-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5EBU4|ZAG1_CAEEL2.965e-4276.60Zinc finger E-box-binding homeobox protein zag-1 O... [more]
sp|P28166|ZFH1_DROME3.450e-3877.65Zinc finger protein 1 OS=Drosophila melanogaster O... [more]
sp|P36197|ZEB1_CHICK6.832e-3876.19Zinc finger E-box-binding homeobox 1 OS=Gallus gal... [more]
sp|P37275|ZEB1_HUMAN7.812e-3876.19Zinc finger E-box-binding homeobox 1 OS=Homo sapie... [more]
sp|Q60542|ZEB1_MESAU8.360e-3876.19Zinc finger E-box-binding homeobox 1 OS=Mesocricet... [more]
back to top
BLAST of Zeb-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A221SAL40.000e+099.83Zeb-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A3P7MNP01.631e-4685.06Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A0X3NQA72.593e-4385.06Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A5K4EUN34.383e-4384.88Transcription factor, putative OS=Schistosoma mans... [more]
A0A4Z2CYM95.835e-4383.72Zinc finger E-box-binding homeobox protein isoform... [more]
back to top
BLAST of Zeb-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zeb1b7.971e-3972.53zinc finger E-box binding homeobox 1b [Source:ZFIN... [more]
zeb1a9.409e-3976.19zinc finger E-box-binding homeobox 1-like [Source:... [more]
zeb1a1.104e-3876.19zinc finger E-box-binding homeobox 1-like [Source:... [more]
zeb1b1.131e-3872.53zinc finger E-box binding homeobox 1b [Source:ZFIN... [more]
zeb1a1.643e-3876.19zinc finger E-box-binding homeobox 1-like [Source:... [more]
back to top
BLAST of Zeb-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005616.11.117e-3875.29pep scaffold:Pmarinus_7.0:GL480643:10592:21548:1 g... [more]
zeb2b2.704e-3866.00zinc finger E-box binding homeobox 2b [Source:ZFIN... [more]
ENSPMAT00000000923.12.839e-2039.47pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 ... [more]
ENSPMAT00000005514.11.202e-1952.63pep scaffold:Pmarinus_7.0:GL480807:15328:23606:1 g... [more]
ENSPMAT00000008351.19.949e-1947.44pep scaffold:Pmarinus_7.0:GL476515:232573:234573:1... [more]
back to top
BLAST of Zeb-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP19.883e-1639.80Zinc-regulated transcription factor; binds to zinc... [more]
AZF11.018e-1541.89Zinc-finger transcription factor; involved in diau... [more]
CRZ11.252e-1435.11Transcription factor, activates transcription of s... [more]
MSN21.419e-1041.10Stress-responsive transcriptional activator; activ... [more]
GIS12.596e-1048.08Histone demethylase and transcription factor; regu... [more]
back to top
BLAST of Zeb-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491122.707e-1847.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426093.187e-1743.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476923.630e-1748.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384194.069e-1749.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO254599.675e-1741.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Zeb-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zeb1b9.851e-3972.53zinc finger E-box binding homeobox 1 [Source:NCBI ... [more]
zeb2b1.035e-3772.53zinc finger E-box binding homeobox 2 [Source:NCBI ... [more]
ENSORLT00000031578.18.472e-3771.43zinc finger E-box-binding homeobox 2 [Source:NCBI ... [more]
ENSORLT00000025013.21.151e-3671.43zinc finger E-box-binding homeobox 2 [Source:NCBI ... [more]
ENSORLT00000045744.11.349e-3671.43zinc finger E-box-binding homeobox 2 [Source:NCBI ... [more]
back to top
BLAST of Zeb-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013012.10.000e+099.65SMESG000013012.1[more]
SMESG000000960.12.718e-1742.22SMESG000000960.1[more]
SMESG000064097.12.888e-1747.37SMESG000064097.1[more]
SMESG000000959.17.992e-1737.93SMESG000000959.1[more]
SMESG000005754.11.653e-1643.68SMESG000005754.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035408 ID=SMED30035408|Name=Zeb-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1940bp
CTAATTTACCAACAATCTTTTAAATTTTATATTTTTTTCAAAGGGAAAAA
GTTTTCAGTGTTTTCCAGTTAAAATCTCAACAAAAAATCACCAAAACAAA
GATCTATCGATTCTACACAATTTAATCAATGACGAATTGTACTGAATTTC
TTCAAAAGACAATTTCCGATTCTCCAATACTAAATGAATTTTCAGAAGTA
ACTTCATCAACTCCAGATCAAATTGCCGACGTAAGTGAAAGCCAGTTACT
TACAATTGACGACTTGAAATCTTCAATAAACTTACAAACGTTTTCGCCTA
CCTCAAGCAACAACACCAAAACCACAGCAAATCAAGACCAACTGTTGAGT
AGTCTGTCGAATAGTTCAACGAATTCAAAGTCAATTTCTTCACCTCTTCA
AAATGGACAAACCTGCAATGTTTGTGGGAAACTATTCGCAAATATCTATC
GATTGCATCGCCATCTAAAAAGCCATGATAACAGCAAAGAACTTCGAAAG
TTCCAGTGCAATCAATGTTCGAAAGCATTCAAATTTAAACATCACTTGAA
AGAGCACTCGAGAATTCATAGTGGTGAAAAGCCGTTCAACTGTCGCAATT
GCGGTAAACGTTTCAGCCATTCTGGATCCTACAGTAGCCACATGACTAGC
AAAAAATGTTCACTAAATTCTGGGATAGATTTACAGATATCCCAATCAAT
GAACGGAATTCTGGCTACGAAATCCGAGCCTGACTGCGGATATGAGCTGA
GTTCTATAAATAAAATACTCCAAACAGTGAAAAGTGGCTCTCATAACTTA
ACGAACCCTCATAATAATGATATTTCGTCTCTGTTTTCTCCACCAGCAGT
GAATTGGCAAGAGAAATCTGATCAAGAATCAGGGTGGTCAAATAAGGTTC
AATCAATGACAAATTATACACAAATGAAAAAATCTTCTCTAGGAGATTTT
GAAAGATTCCCCGTTTTATTAAATAATAGAGGATGGAATTCTTCGAGTCT
TCCATCACCATTGGAGTTAAACCATTACTTTCAACTTGATAATATCTTTA
ACAATCTCGTACCCTCATCTACCGCAGACAATAACCCACTTCTCATGCAT
TTAATATTTGGTAACAAATTCCCATTATTTCCCAGTTCCCATTGTCCATT
GAATCAGTCTCCGATTCAAGCCTCAGAAAACCCGAATATATCATCAATGT
TTTTCATTCCGACTTTACCCCAACAATCATTTCCCCCAACGAACGCCAGT
CAGTATGAGCCACTGGATCTGTCTGTCACAAAATCTGAGCCTTATTCAAA
TGGTCCTTCAAATGAAAACTTTACAGATTTGAATTCAAATTTCTCATTAT
GGCAACAGAAATCATCCGAGAAAAGTTTTTCTTTTAACGATTCACCTTTA
AATCTGAGTCAGAAAAATCCGATTTCCAAATCTCATTTCTCAGACTTGTC
TACGGAATCAGATGATTTGAATTCGGAGAACTCCATAAATAATGAAAATA
AATCAATAATATCATCGAAATCCAATCAATTAATTTTAGAAACTTCAATG
GATATAGATATGCTAAATATTACCAGTAAAAAAGACTCTTTTGAAACATT
CTCATGCGATCAGTGTCAAAAAGTGTTTTCAAAGCACAGCTCCCTCACTC
GGCACAAATATGAGCACACAGGCGTTCGTCCATTTGTTTGCACGATCTGT
GACAAAGCTTTTAAACACAAGCATCATCTCACTGAACACAAACGCCTTCA
CAGCGGAGAGAAACCCTTCCAATGTCAGAGATGTGGTAAAAGGTTCAGTC
ATTCTGGCTCCTTTTCCCAGCACATGAATCACAGATACAAATACTGCAAA
CCATAACCCAGATGTTTCTTATCAAAATCATTTCAACTGTATATTGTATT
TATATATTTCTTTTAATTAAAATTTCTATCGAAAAAAAAA
back to top

protein sequence of SMED30035408-orf-1

>SMED30035408-orf-1 ID=SMED30035408-orf-1|Name=SMED30035408-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=576bp
MTNCTEFLQKTISDSPILNEFSEVTSSTPDQIADVSESQLLTIDDLKSSI
NLQTFSPTSSNNTKTTANQDQLLSSLSNSSTNSKSISSPLQNGQTCNVCG
KLFANIYRLHRHLKSHDNSKELRKFQCNQCSKAFKFKHHLKEHSRIHSGE
KPFNCRNCGKRFSHSGSYSSHMTSKKCSLNSGIDLQISQSMNGILATKSE
PDCGYELSSINKILQTVKSGSHNLTNPHNNDISSLFSPPAVNWQEKSDQE
SGWSNKVQSMTNYTQMKKSSLGDFERFPVLLNNRGWNSSSLPSPLELNHY
FQLDNIFNNLVPSSTADNNPLLMHLIFGNKFPLFPSSHCPLNQSPIQASE
NPNISSMFFIPTLPQQSFPPTNASQYEPLDLSVTKSEPYSNGPSNENFTD
LNSNFSLWQQKSSEKSFSFNDSPLNLSQKNPISKSHFSDLSTESDDLNSE
NSINNENKSIISSKSNQLILETSMDIDMLNITSKKDSFETFSCDQCQKVF
SKHSSLTRHKYEHTGVRPFVCTICDKAFKHKHHLTEHKRLHSGEKPFQCQ
RCGKRFSHSGSFSQHMNHRYKYCKP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000136whole organism
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0003677DNA binding
GO:0003705transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006355regulation of transcription, DNA-templated
GO:0007280pole cell migration
GO:0007399nervous system development
GO:0007498mesoderm development
GO:0007507heart development
GO:0007516hemocyte development
GO:0008045motor neuron axon guidance
GO:0008354germ cell migration
GO:0008406gonad development
GO:0019730antimicrobial humoral response
GO:0048103somatic stem cell division
GO:0048542lymph gland development
GO:0061321garland nephrocyte differentiation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 125..147
e-value: 0.1
score: 21.7
coord: 547..568
e-value: 1.8
score: 17.5
coord: 153..173
e-value: 26.0
score: 9.7
coord: 94..116
e-value: 0.032
score: 23.4
coord: 519..541
e-value: 0.01
score: 25.0
coord: 491..513
e-value: 0.015
score: 24.5
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 519..541
e-value: 7.6E-4
score: 19.8
coord: 125..147
e-value: 0.011
score: 16.1
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 127..147
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 493..513
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 96..116
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 521..541
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 94..121
score: 11.427
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 125..152
score: 16.643
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 491..518
score: 14.69
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 547..575
score: 10.97
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 153..172
score: 8.974
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 519..546
score: 16.352
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 124..148
e-value: 1.6E-10
score: 42.6
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 483..514
e-value: 1.5E-7
score: 33.1
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 543..569
e-value: 2.9E-9
score: 38.5
coord: 149..176
e-value: 1.1E-8
score: 36.7
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 48..123
e-value: 6.4E-5
score: 25.4
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 515..542
e-value: 1.1E-13
score: 52.6
NoneNo IPR availablePANTHERPTHR24391:SF27ZINC FINGER PROTEIN 1coord: 48..262
NoneNo IPR availablePANTHERPTHR24391FAMILY NOT NAMEDcoord: 364..575
NoneNo IPR availablePANTHERPTHR24391FAMILY NOT NAMEDcoord: 48..262
NoneNo IPR availablePANTHERPTHR24391:SF27ZINC FINGER PROTEIN 1coord: 364..575
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 513..565
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 95..134
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 123..173
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 490..522