Choline-phosphate cytidylyltransferase

Overview
NameCholine-phosphate cytidylyltransferase
Smed IDSMED30035391
Length (bp)736
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Choline-phosphate cytidylyltransferase (SMED30035391) t-SNE clustered cells

Violin plots show distribution of expression levels for Choline-phosphate cytidylyltransferase (SMED30035391) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Choline-phosphate cytidylyltransferase (SMED30035391) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Choline-phosphate cytidylyltransferase (SMED30035391) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035391

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30035391SMESG000055917.1 SMESG000055914.1 SMESG000055388.1 SmedASXL_014769SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035391SMESG000055917.1 SMESG000055914.1 SMESG000055388.1 dd_Smed_v4_9916_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035391SMESG000055917.1 SMESG000055914.1 SMESG000055388.1 dd_Smed_v4_9916_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035391SMESG000055917.1 SMESG000055914.1 SMESG000055388.1 dd_Smed_v4_9916_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
prepharyngeal regionSMED30035391SMESG000055917.1 SMESG000055914.1 SMESG000055388.1 dd_Smed_v6_9916_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035391SMESG000055917.1 SMESG000055914.1 SMESG000055388.1 OX_Smed_1.0.21106ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:HGNC Symbol;Acc:HGNC:8754])

HSP 1 Score: 143.28 bits (360), Expect = 5.670e-42
Identity = 66/138 (47.83%), Postives = 91/138 (65.94%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  ++    +K   +M   ER  +V+HCR+VDEV+ NAPW  T EFL EHRIDF  HD  PY S G  D+Y+ +K+   F P++RTE IST+ II  I R
Sbjct:    9 RPVRVYADGIFDLFHSGHARALMQAKNLFP-NTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVR 145          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:HGNC Symbol;Acc:HGNC:8754])

HSP 1 Score: 145.591 bits (366), Expect = 8.420e-42
Identity = 71/156 (45.51%), Postives = 97/156 (62.18%), Query Frame = 3
Query:  165 KPIPLYVAEKGSHG----RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            KP      E+ S G    RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  ++    +K   +M   ER  +V+HCR+VDEV+ NAPW  T EFL EHRIDF  HD  PY S G  D+Y+ +K+   F P++RTE IST+ II  I R
Sbjct:   57 KPYVRVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVR 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:HGNC Symbol;Acc:HGNC:8754])

HSP 1 Score: 144.821 bits (364), Expect = 8.209e-41
Identity = 71/156 (45.51%), Postives = 97/156 (62.18%), Query Frame = 3
Query:  165 KPIPLYVAEKGSHG----RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            KP      E+ S G    RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  ++    +K   +M   ER  +V+HCR+VDEV+ NAPW  T EFL EHRIDF  HD  PY S G  D+Y+ +K+   F P++RTE IST+ II  I R
Sbjct:   57 KPYVRVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFP-NTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVR 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:HGNC Symbol;Acc:HGNC:8754])

HSP 1 Score: 144.821 bits (364), Expect = 8.209e-41
Identity = 71/156 (45.51%), Postives = 97/156 (62.18%), Query Frame = 3
Query:  165 KPIPLYVAEKGSHG----RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            KP      E+ S G    RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  ++    +K   +M   ER  +V+HCR+VDEV+ NAPW  T EFL EHRIDF  HD  PY S G  D+Y+ +K+   F P++RTE IST+ II  I R
Sbjct:   57 KPYVRVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFP-NTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVR 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:HGNC Symbol;Acc:HGNC:8754])

HSP 1 Score: 145.206 bits (365), Expect = 8.737e-41
Identity = 71/156 (45.51%), Postives = 97/156 (62.18%), Query Frame = 3
Query:  165 KPIPLYVAEKGSHG----RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            KP      E+ S G    RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  ++    +K   +M   ER  +V+HCR+VDEV+ NAPW  T EFL EHRIDF  HD  PY S G  D+Y+ +K+   F P++RTE IST+ II  I R
Sbjct:   57 KPYVRVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFP-NTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVR 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: pcyt-1 (Putative choline-phosphate cytidylyltransferase [Source:UniProtKB/Swiss-Prot;Acc:P49583])

HSP 1 Score: 150.984 bits (380), Expect = 1.227e-43
Identity = 71/171 (41.52%), Postives = 105/171 (61.40%), Query Frame = 3
Query:  108 AYMSTDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            A  S +A     R  + + K I L +AE    GRP+RIY +G++D+FH+GHAN   Q K  FP  ++++ GV  ++D  KYK + +   EER   VRHCR+VDEV   APW  TVEFL   ++DF  HD  PY + G  D+YE+ +++  F+ ++RTE +ST+ ++  I R
Sbjct:   38 APFSDEALAITTREAVDYSKKITLAMAEANEAGRPVRIYADGIYDLFHHGHANQLRQVKKMFP-NVYLIVGVCGDRDTHKYKGRTVTSEEERYDGVRHCRYVDEVYREAPWFCTVEFLKNLKVDFIAHDAIPYVAPGEEDLYEKFRREGMFLETERTEGVSTSDVVCRIIR 207          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: pcyt-1 (Putative choline-phosphate cytidylyltransferase [Source:UniProtKB/Swiss-Prot;Acc:P49583])

HSP 1 Score: 150.599 bits (379), Expect = 1.845e-43
Identity = 71/171 (41.52%), Postives = 105/171 (61.40%), Query Frame = 3
Query:  108 AYMSTDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            A  S +A     R  + + K I L +AE    GRP+RIY +G++D+FH+GHAN   Q K  FP  ++++ GV  ++D  KYK + +   EER   VRHCR+VDEV   APW  TVEFL   ++DF  HD  PY + G  D+YE+ +++  F+ ++RTE +ST+ ++  I R
Sbjct:   46 APFSDEALAITTREAVDYSKKITLAMAEANEAGRPVRIYADGIYDLFHHGHANQLRQVKKMFPN-VYLIVGVCGDRDTHKYKGRTVTSEEERYDGVRHCRYVDEVYREAPWFCTVEFLKNLKVDFIAHDAIPYVAPGEEDLYEKFRREGMFLETERTEGVSTSDVVCRIIR 215          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: Y18H1A.11 (pep chromosome:WBcel235:I:680408:683257:1 gene:WBGene00021215.1 transcript:Y18H1A.11b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y18H1A.11)

HSP 1 Score: 137.117 bits (344), Expect = 4.766e-40
Identity = 70/171 (40.94%), Postives = 100/171 (58.48%), Query Frame = 3
Query:  108 AYMSTDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            A  S D E+   R  + +   I L  A  G+  RP+R+Y +GV+DMFHYGHAN FLQ K   P  ++++ GV  +++ MK K + +   EER  ++RHCR+VDEV   +PW   + FL E ++DF  HD  PY      DIYE+ +    F+ ++RTE IST+  I  I R
Sbjct:   12 APFSDDVEVIKQREAIDYSTQITLEDAISGNVTRPVRVYADGVYDMFHYGHANQFLQIKQTLPN-VYLIVGVCSDEETMKNKGRTVQGEEERYEAIRHCRYVDEVYKASPWTCPIPFLKELKVDFMSHDALPYQGPAGEDIYEKHRTAGMFLETQRTEGISTSDSICRIIR 181          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: Y18H1A.11 (pep chromosome:WBcel235:I:680408:683472:1 gene:WBGene00021215.1 transcript:Y18H1A.11a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y18H1A.11)

HSP 1 Score: 137.502 bits (345), Expect = 2.407e-39
Identity = 70/171 (40.94%), Postives = 100/171 (58.48%), Query Frame = 3
Query:  108 AYMSTDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            A  S D E+   R  + +   I L  A  G+  RP+R+Y +GV+DMFHYGHAN FLQ K   P  ++++ GV  +++ MK K + +   EER  ++RHCR+VDEV   +PW   + FL E ++DF  HD  PY      DIYE+ +    F+ ++RTE IST+  I  I R
Sbjct:   12 APFSDDVEVIKQREAIDYSTQITLEDAISGNVTRPVRVYADGVYDMFHYGHANQFLQIKQTLP-NVYLIVGVCSDEETMKNKGRTVQGEEERYEAIRHCRYVDEVYKASPWTCPIPFLKELKVDFMSHDALPYQGPAGEDIYEKHRTAGMFLETQRTEGISTSDSICRIIR 181          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: Y18H1A.11 (pep chromosome:WBcel235:I:681355:683257:1 gene:WBGene00021215.1 transcript:Y18H1A.11d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y18H1A.11)

HSP 1 Score: 111.694 bits (278), Expect = 6.611e-31
Identity = 54/126 (42.86%), Postives = 76/126 (60.32%), Query Frame = 3
Query:  243 MFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            MFHYGHAN FLQ K   P  ++++ GV  +++ MK K + +   EER  ++RHCR+VDEV   +PW   + FL E ++DF  HD  PY      DIYE+ +    F+ ++RTE IST+  I  I R
Sbjct:    1 MFHYGHANQFLQIKQTLPN-VYLIVGVCSDEETMKNKGRTVQGEEERYEAIRHCRYVDEVYKASPWTCPIPFLKELKVDFMSHDALPYQGPAGEDIYEKHRTAGMFLETQRTEGISTSDSICRIIR 125          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pcyt2 (gene:FBgn0035231 transcript:FBtr0072742)

HSP 1 Score: 147.517 bits (371), Expect = 5.399e-42
Identity = 64/148 (43.24%), Postives = 100/148 (67.57%), Query Frame = 3
Query:  171 IPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAI 614
            I  ++A  G   R +R+Y +G++D+FH GHA   +QAK+ FP  ++++ GV +++  ++ K + +M   ER  +VRHCR+VDE++PNAPW    EF++EH+IDF  HD  PY +GGV DIY  LK +  F+ ++RTE +ST+ I+  I
Sbjct:   65 ITYHMARAGKTTRRVRVYADGIYDLFHQGHARQLMQAKNVFP-NVYLIVGVCNDELTLRMKGRTVMNGFERYEAVRHCRYVDEIVPNAPWTLNEEFIEEHKIDFVAHDDIPYGAGGVNDIYAPLKAKGMFVATERTEGVSTSDIVARI 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pcyt1 (gene:FBgn0041342 transcript:FBtr0072741)

HSP 1 Score: 137.117 bits (344), Expect = 4.100e-37
Identity = 63/166 (37.95%), Postives = 103/166 (62.05%), Query Frame = 3
Query:  117 STDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAI 614
            S D E  + R +  + + I   +A  G   R +R+Y +G++D+FH GHA   +QAK+ FP  ++++ GV +++   + K + +M   ER   VRHCR+VDE++ NAPW  + EF+ +++IDF  HD  PY + G+ DIY  LK +  F+ ++RTE +ST+ I+  I
Sbjct:  174 SHDEEAMLERDRCDYTQRITYQMARSGQTTRRVRVYADGIYDLFHQGHARQLMQAKNIFPN-VYLIVGVCNDELTHRMKGRTVMNGFERYEGVRHCRYVDEIVQNAPWTLSDEFIADNKIDFVAHDDIPYVTDGMDDIYAPLKARGMFVATERTEGVSTSDIVARI 338          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pcyt1 (gene:FBgn0041342 transcript:FBtr0072738)

HSP 1 Score: 137.117 bits (344), Expect = 4.100e-37
Identity = 63/166 (37.95%), Postives = 103/166 (62.05%), Query Frame = 3
Query:  117 STDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAI 614
            S D E  + R +  + + I   +A  G   R +R+Y +G++D+FH GHA   +QAK+ FP  ++++ GV +++   + K + +M   ER   VRHCR+VDE++ NAPW  + EF+ +++IDF  HD  PY + G+ DIY  LK +  F+ ++RTE +ST+ I+  I
Sbjct:  174 SHDEEAMLERDRCDYTQRITYQMARSGQTTRRVRVYADGIYDLFHQGHARQLMQAKNIFPN-VYLIVGVCNDELTHRMKGRTVMNGFERYEGVRHCRYVDEIVQNAPWTLSDEFIADNKIDFVAHDDIPYVTDGMDDIYAPLKARGMFVATERTEGVSTSDIVARI 338          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pcyt1 (gene:FBgn0041342 transcript:FBtr0333396)

HSP 1 Score: 137.117 bits (344), Expect = 4.100e-37
Identity = 63/166 (37.95%), Postives = 103/166 (62.05%), Query Frame = 3
Query:  117 STDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAI 614
            S D E  + R +  + + I   +A  G   R +R+Y +G++D+FH GHA   +QAK+ FP  ++++ GV +++   + K + +M   ER   VRHCR+VDE++ NAPW  + EF+ +++IDF  HD  PY + G+ DIY  LK +  F+ ++RTE +ST+ I+  I
Sbjct:  174 SHDEEAMLERDRCDYTQRITYQMARSGQTTRRVRVYADGIYDLFHQGHARQLMQAKNIFPN-VYLIVGVCNDELTHRMKGRTVMNGFERYEGVRHCRYVDEIVQNAPWTLSDEFIADNKIDFVAHDDIPYVTDGMDDIYAPLKARGMFVATERTEGVSTSDIVARI 338          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pcyt1 (gene:FBgn0041342 transcript:FBtr0345365)

HSP 1 Score: 137.117 bits (344), Expect = 4.100e-37
Identity = 63/166 (37.95%), Postives = 103/166 (62.05%), Query Frame = 3
Query:  117 STDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAI 614
            S D E  + R +  + + I   +A  G   R +R+Y +G++D+FH GHA   +QAK+ FP  ++++ GV +++   + K + +M   ER   VRHCR+VDE++ NAPW  + EF+ +++IDF  HD  PY + G+ DIY  LK +  F+ ++RTE +ST+ I+  I
Sbjct:  174 SHDEEAMLERDRCDYTQRITYQMARSGQTTRRVRVYADGIYDLFHQGHARQLMQAKNIFPN-VYLIVGVCNDELTHRMKGRTVMNGFERYEGVRHCRYVDEIVQNAPWTLSDEFIADNKIDFVAHDDIPYVTDGMDDIYAPLKARGMFVATERTEGVSTSDIVARI 338          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt1ba (phosphate cytidylyltransferase 1, choline, beta a [Source:ZFIN;Acc:ZDB-GENE-061220-4])

HSP 1 Score: 147.517 bits (371), Expect = 2.762e-42
Identity = 67/150 (44.67%), Postives = 100/150 (66.67%), Query Frame = 3
Query:  183 VAEKGSHG----RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
              ++ SHG    RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  ++   KYK   +M  +ER  ++RHCR+VDEV+ +APW  T +FL++H+IDF  HD  PY S G  D+Y+ +K+   F+P+KRTE IST+ +I  I R
Sbjct:   37 TVDQASHGTPVDRPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLIVGVCSDELTHKYKGFTVMTEDERYEALRHCRYVDEVLRDAPWTLTQDFLEKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTKRTEGISTSDLITRIVR 185          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt1bb (phosphate cytidylyltransferase 1, choline, beta b [Source:ZFIN;Acc:ZDB-GENE-051120-48])

HSP 1 Score: 140.584 bits (353), Expect = 2.050e-39
Identity = 68/151 (45.03%), Postives = 96/151 (63.58%), Query Frame = 3
Query:  171 IPLYVAEKGSHG-RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            + L  A +G+   RP+R+Y +G+FD+FH GHA   +QAK+ FP    +V GV  +    KYK   +M  +ER  ++ HCR+VDEV+ +APW  T EFL +HRIDF  HD  PY S G  D+Y+ +K+   F+ ++RTE IST+ II  I R
Sbjct:   57 VTLAQARRGTPAQRPVRVYADGIFDLFHSGHARALMQAKNLFPNTQLIV-GVCSDALTHKYKGYTVMTEDERYEALIHCRYVDEVVRDAPWTLTSEFLKKHRIDFVAHDDIPYTSAGSEDVYKHIKEAGMFVATQRTEGISTSDIITRIVR 206          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt1ab (phosphate cytidylyltransferase 1, choline, alpha b [Source:ZFIN;Acc:ZDB-GENE-050522-114])

HSP 1 Score: 139.428 bits (350), Expect = 5.354e-39
Identity = 67/138 (48.55%), Postives = 86/138 (62.32%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            RP+R+Y +G+FDMFH GHA   +QAK  FP    +V G +  K   K+    +M  +ER  +V HCR+VDEV+ NAPW  + EFL EHRIDF  HD  PY S G  D+Y  +K    F P++RTE IST+ II  I R
Sbjct:   72 RPVRVYADGIFDMFHSGHARALMQAKCLFPNTYLIVGGCT-FKIVFKFDGFXVMNEDERYDAVCHCRYVDEVVRNAPWTLSPEFLAEHRIDFVAHDDIPYISAGTDDVYRHIKDAGMFAPTQRTEGISTSDIITRIVR 208          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt1aa (phosphate cytidylyltransferase 1, choline, alpha a [Source:ZFIN;Acc:ZDB-GENE-050417-108])

HSP 1 Score: 137.887 bits (346), Expect = 3.138e-38
Identity = 67/138 (48.55%), Postives = 86/138 (62.32%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            RP+R+Y +G+FDMFH GHA   +QAK  FP    +V GV  +    K K   +M  +ER  +V HCR+VDEV+ NAPW  T EFL +HRIDF  HD  PY S    D+Y+ +K    F P++RTE IST+ II  I R
Sbjct:   72 RPVRVYADGIFDMFHSGHARALMQAKCLFPNTHLIV-GVCSDDLTHKLKGFTVMNEDERYDAVSHCRYVDEVVRNAPWTLTPEFLTKHRIDFVAHDDIPYSSADSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 208          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt1aa (phosphate cytidylyltransferase 1, choline, alpha a [Source:ZFIN;Acc:ZDB-GENE-050417-108])

HSP 1 Score: 137.887 bits (346), Expect = 3.138e-38
Identity = 67/138 (48.55%), Postives = 86/138 (62.32%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            RP+R+Y +G+FDMFH GHA   +QAK  FP    +V GV  +    K K   +M  +ER  +V HCR+VDEV+ NAPW  T EFL +HRIDF  HD  PY S    D+Y+ +K    F P++RTE IST+ II  I R
Sbjct:   72 RPVRVYADGIFDMFHSGHARALMQAKCLFPNTHLIV-GVCSDDLTHKLKGFTVMNEDERYDAVSHCRYVDEVVRNAPWTLTPEFLTKHRIDFVAHDDIPYSSADSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 208          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: cmtm3 (CKLF-like MARVEL transmembrane domain containing 3 [Source:Xenbase;Acc:XB-GENE-1011270])

HSP 1 Score: 144.821 bits (364), Expect = 9.096e-41
Identity = 67/138 (48.55%), Postives = 92/138 (66.67%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            RP+R+Y +G+FD+FH GHA   +QAK+ FP    +V   SDE    KYK   +M   ER  ++RHCR+VDE+I +APW  T EFL++H+IDF  HD  PY S G  D+Y+ +K+   F+P++RTE IST+ II  I R
Sbjct:   75 RPVRVYADGIFDLFHSGHARALMQAKNLFPNSYLLVGVCSDEL-THKYKGFTVMNETERYEALRHCRYVDEIITDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVR 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:NCBI gene;Acc:100496938])

HSP 1 Score: 139.043 bits (349), Expect = 1.649e-38
Identity = 74/179 (41.34%), Postives = 99/179 (55.31%), Query Frame = 3
Query:  138 ILRHQMGHFKPIPL--------------YVAEKGSHG----RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            + RH MG  +P P                  E+   G    RP+R+Y +G+FD+FH GHA   +QAK+ FP    +V   SDE      K   +M   ER  +V+HCR+VDEV+ NAPW  + EFL++HRIDF  HD  PY S G  D+Y+ +K    F P++RTE IST+ II  I R
Sbjct:   46 VARHTMGVREPAPFSDELKVDRSKTYRRVSMEEAKLGTPIERPVRVYADGIFDLFHSGHARALMQAKNLFPNTHLIVGVCSDEL-THNLKGFTVMNEAERYDAVQHCRYVDEVVRNAPWTLSPEFLEKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 223          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:NCBI gene;Acc:100496938])

HSP 1 Score: 139.043 bits (349), Expect = 2.279e-38
Identity = 74/179 (41.34%), Postives = 99/179 (55.31%), Query Frame = 3
Query:  138 ILRHQMGHFKPIPL--------------YVAEKGSHG----RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            + RH MG  +P P                  E+   G    RP+R+Y +G+FD+FH GHA   +QAK+ FP    +V   SDE      K   +M   ER  +V+HCR+VDEV+ NAPW  + EFL++HRIDF  HD  PY S G  D+Y+ +K    F P++RTE IST+ II  I R
Sbjct:   67 VARHTMGVREPAPFSDELKVDRSKTYRRVSMEEAKLGTPIERPVRVYADGIFDLFHSGHARALMQAKNLFPNTHLIVGVCSDEL-THNLKGFTVMNEAERYDAVQHCRYVDEVVRNAPWTLSPEFLEKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 244          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:NCBI gene;Acc:100496938])

HSP 1 Score: 138.658 bits (348), Expect = 2.477e-38
Identity = 74/179 (41.34%), Postives = 99/179 (55.31%), Query Frame = 3
Query:  138 ILRHQMGHFKPIPL--------------YVAEKGSHG----RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            + RH MG  +P P                  E+   G    RP+R+Y +G+FD+FH GHA   +QAK+ FP    +V   SDE      K   +M   ER  +V+HCR+VDEV+ NAPW  + EFL++HRIDF  HD  PY S G  D+Y+ +K    F P++RTE IST+ II  I R
Sbjct:   34 VARHTMGVREPAPFSDELKVDRSKTYRRVSMEEAKLGTPIERPVRVYADGIFDLFHSGHARALMQAKNLFPNTHLIVGVCSDEL-THNLKGFTVMNEAERYDAVQHCRYVDEVVRNAPWTLSPEFLEKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: pcyt2 (phosphate cytidylyltransferase 2, ethanolamine [Source:NCBI gene;Acc:496753])

HSP 1 Score: 97.0561 bits (240), Expect = 7.467e-23
Identity = 44/131 (33.59%), Postives = 79/131 (60.31%), Query Frame = 3
Query:  213 IRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQII 605
            +R++ +G +DM HYGH+N   QA++      +++ GV  +++  ++K  P+   EER   V+  + VDE++P AP++TT+E LD++  DF +H      +    D YEE+K   R+   +RT+ +STT ++
Sbjct:   19 VRVWCDGCYDMVHYGHSNQLRQARAMGG---YLIVGVHTDEEISQHKGPPVFTQEERYKMVKAIKWVDEIVPGAPYVTTLETLDKYNCDFCVHGNDITLTVDGKDTYEEVKNAGRYRECQRTQGVSTTDLV 146          

HSP 2 Score: 77.0258 bits (188), Expect = 8.761e-16
Identity = 46/141 (32.62%), Postives = 74/141 (52.48%), Query Frame = 3
Query:  219 IYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRK--PIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSP-YPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISRTLVE 632
            IY+ G FD+FH GH + FL+       + +V+ G+  +++   YKRK  PIM   ER LSV  CR+V EV+  AP+  + + LD  ++D   H  +   P    +D Y E K++  F       +++T  I+  I +  +E
Sbjct:  211 IYVAGAFDLFHIGHID-FLEKVYSLAEKPYVIVGLHFDQEVNHYKRKNYPIMNIHERTLSVLACRYVAEVVIGAPYSVSADLLDHFKVDIVCHGKTDVLPDRDGSDPYAEPKRRAIFRVVDSGNSLTTDDIVQRIIKNRLE 350          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt1b (phosphate cytidylyltransferase 1, choline, beta isoform [Source:MGI Symbol;Acc:MGI:2147987])

HSP 1 Score: 143.28 bits (360), Expect = 1.219e-40
Identity = 65/138 (47.10%), Postives = 93/138 (67.39%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  +    K+K   +M   ER  ++RHCR+VDEVI +APW  T EFL++H+IDF  HD  PY S G  D+Y+ +K+   F+P++RTE IST+ II  I R
Sbjct:   45 RPVRVYADGIFDLFHSGHARALMQAKTLFPNS-YLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVR 181          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt1b (phosphate cytidylyltransferase 1, choline, beta isoform [Source:MGI Symbol;Acc:MGI:2147987])

HSP 1 Score: 143.28 bits (360), Expect = 2.743e-40
Identity = 65/138 (47.10%), Postives = 93/138 (67.39%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  +    K+K   +M   ER  ++RHCR+VDEVI +APW  T EFL++H+IDF  HD  PY S G  D+Y+ +K+   F+P++RTE IST+ II  I R
Sbjct:   75 RPVRVYADGIFDLFHSGHARALMQAKTLFPNS-YLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVR 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt1a (phosphate cytidylyltransferase 1, choline, alpha isoform [Source:MGI Symbol;Acc:MGI:88557])

HSP 1 Score: 142.895 bits (359), Expect = 2.927e-40
Identity = 70/156 (44.87%), Postives = 95/156 (60.90%), Query Frame = 3
Query:  165 KPIPLYVAEKGSHG----RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            KP      E+   G    RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  ++    +K   +M   ER  +V+HCR+VDEV+ NAPW  T EFL EHRIDF  HD  PY S G  D+Y+ +K    F P++RTE IST+ II  I R
Sbjct:   57 KPYVRVTMEEACRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFP-NTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt1a (phosphate cytidylyltransferase 1, choline, alpha isoform [Source:MGI Symbol;Acc:MGI:88557])

HSP 1 Score: 142.895 bits (359), Expect = 2.927e-40
Identity = 70/156 (44.87%), Postives = 95/156 (60.90%), Query Frame = 3
Query:  165 KPIPLYVAEKGSHG----RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            KP      E+   G    RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  ++    +K   +M   ER  +V+HCR+VDEV+ NAPW  T EFL EHRIDF  HD  PY S G  D+Y+ +K    F P++RTE IST+ II  I R
Sbjct:   57 KPYVRVTMEEACRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFP-NTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt1a (phosphate cytidylyltransferase 1, choline, alpha isoform [Source:MGI Symbol;Acc:MGI:88557])

HSP 1 Score: 142.895 bits (359), Expect = 2.927e-40
Identity = 70/156 (44.87%), Postives = 95/156 (60.90%), Query Frame = 3
Query:  165 KPIPLYVAEKGSHG----RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            KP      E+   G    RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  ++    +K   +M   ER  +V+HCR+VDEV+ NAPW  T EFL EHRIDF  HD  PY S G  D+Y+ +K    F P++RTE IST+ II  I R
Sbjct:   57 KPYVRVTMEEACRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFP-NTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 211          
BLAST of Choline-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|P49583|PCY1_CAEEL (Putative choline-phosphate cytidylyltransferase OS=Caenorhabditis elegans OX=6239 GN=F08C6.2 PE=3 SV=2)

HSP 1 Score: 150.599 bits (379), Expect = 2.347e-42
Identity = 71/171 (41.52%), Postives = 105/171 (61.40%), Query Frame = 3
Query:  108 AYMSTDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            A  S +A     R  + + K I L +AE    GRP+RIY +G++D+FH+GHAN   Q K  FP  ++++ GV  ++D  KYK + +   EER   VRHCR+VDEV   APW  TVEFL   ++DF  HD  PY + G  D+YE+ +++  F+ ++RTE +ST+ ++  I R
Sbjct:   46 APFSDEALAITTREAVDYSKKITLAMAEANEAGRPVRIYADGIYDLFHHGHANQLRQVKKMFPN-VYLIVGVCGDRDTHKYKGRTVTSEEERYDGVRHCRYVDEVYREAPWFCTVEFLKNLKVDFIAHDAIPYVAPGEEDLYEKFRREGMFLETERTEGVSTSDVVCRIIR 215          
BLAST of Choline-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|Q9ZV56|CCT1_ARATH (Choline-phosphate cytidylyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=CCT1 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 6.084e-41
Identity = 65/135 (48.15%), Postives = 92/135 (68.15%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYP--SGGVADIYEELKKQNRFIPSKRTENISTTQII 605
            RP+R+Y +G++D+FH+GHA    QAK  FP   +++ G  +++   KYK + +M  EER  S+RHC+ VDEVIP+APW+   EFLD+H+ID+  HD  PY   SG   D+YE +KK  RF  ++RTE IST+ II
Sbjct:   33 RPVRVYADGIYDLFHFGHARSLEQAKLAFPNNTYLLVGCCNDETTHKYKGRTVMTAEERYESLRHCKWVDEVIPDAPWVVNQEFLDKHQIDYVAHDSLPYADSSGAGKDVYEFVKKVGRFKETQRTEGISTSDII 167          
BLAST of Choline-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|P49585|PCY1A_HUMAN (Choline-phosphate cytidylyltransferase A OS=Homo sapiens OX=9606 GN=PCYT1A PE=1 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 3.942e-40
Identity = 71/156 (45.51%), Postives = 97/156 (62.18%), Query Frame = 3
Query:  165 KPIPLYVAEKGSHG----RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            KP      E+ S G    RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  ++    +K   +M   ER  +V+HCR+VDEV+ NAPW  T EFL EHRIDF  HD  PY S G  D+Y+ +K+   F P++RTE IST+ II  I R
Sbjct:   57 KPYVRVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFP-NTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVR 211          
BLAST of Choline-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|P19836|PCY1A_RAT (Choline-phosphate cytidylyltransferase A OS=Rattus norvegicus OX=10116 GN=Pcyt1a PE=1 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 1.461e-39
Identity = 70/156 (44.87%), Postives = 96/156 (61.54%), Query Frame = 3
Query:  165 KPIPLYVAEKGSHG----RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            KP      E+   G    RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  ++    +K   +M   ER  +V+HCR+VDEV+ NAPW  T EFL EHRIDF  HD  PY S G  D+Y+ +K+   F P++RTE IST+ II  I R
Sbjct:   57 KPYVRVTMEEACRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVR 211          
BLAST of Choline-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|Q811Q9|PCY1B_MOUSE (Choline-phosphate cytidylyltransferase B OS=Mus musculus OX=10090 GN=Pcyt1b PE=1 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 1.919e-39
Identity = 65/138 (47.10%), Postives = 93/138 (67.39%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  +    K+K   +M   ER  ++RHCR+VDEVI +APW  T EFL++H+IDF  HD  PY S G  D+Y+ +K+   F+P++RTE IST+ II  I R
Sbjct:   75 RPVRVYADGIFDLFHSGHARALMQAKTLFPNS-YLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVR 211          
BLAST of Choline-phosphate cytidylyltransferase vs. TrEMBL
Match: A0A044SQ69 (CTP_transf_like domain-containing protein OS=Onchocerca volvulus OX=6282 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 3.056e-47
Identity = 77/168 (45.83%), Postives = 112/168 (66.67%), Query Frame = 3
Query:  117 STDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            S D E+   R ++ + + I L +A  G  GRP+RIY +GV+D+FHYGHAN  LQAK  FP ++++V GV  ++D +KYK + +    ER   VRHCR+VDEV  NAPW  TVEFL + +IDF  HD  PY + G AD+YE+ +++  F+ ++RTE +ST+ ++  I R
Sbjct:   10 SDDPEIIAQRARIDYSRKITLEMARSGKAGRPVRIYADGVYDLFHYGHANQLLQAKCAFP-EVYLVVGVCGDEDTLKYKGRTVTSENERYEGVRHCRYVDEVYKNAPWFCTVEFLKDLKIDFIAHDAIPYVAPGDADLYEKFRREEMFLETQRTEGVSTSDVVCRIIR 176          
BLAST of Choline-phosphate cytidylyltransferase vs. TrEMBL
Match: A0A183H245 (CTP_transf_like domain-containing protein OS=Onchocerca flexuosa OX=387005 GN=OFLC_LOCUS1555 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 4.752e-47
Identity = 76/168 (45.24%), Postives = 112/168 (66.67%), Query Frame = 3
Query:  117 STDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            S D E+   R ++ + + I L +A  G  GRP+RIY +GV+D+FHYGHAN  LQAK  FP +++++ GV  ++D +KYK + +    ER   VRHCR+VDEV  NAPW  TVEFL + +IDF  HD  PY + G AD+YE+ +++  F+ ++RTE +ST+ ++  I R
Sbjct:   61 SDDPEIIAQRARIDYSRKITLEMARSGKAGRPVRIYADGVYDLFHYGHANQLLQAKCAFP-EVYLIVGVCGDEDTLKYKGRTVTSENERYEGVRHCRYVDEVYKNAPWFCTVEFLKDLKIDFIAHDAIPYVAPGDADLYEKFRREEMFVETQRTEGVSTSDVVCRIIR 227          
BLAST of Choline-phosphate cytidylyltransferase vs. TrEMBL
Match: A0A182E2S6 (CTP_transf_like domain-containing protein OS=Onchocerca ochengi OX=42157 GN=NOO_LOCUS2278 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 7.508e-47
Identity = 77/168 (45.83%), Postives = 112/168 (66.67%), Query Frame = 3
Query:  117 STDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            S D E+   R ++ + + I L +A  G  GRP+RIY +GV+D+FHYGHAN  LQAK  FP ++++V GV  ++D +KYK + +    ER   VRHCR+VDEV  NAPW  TVEFL + +IDF  HD  PY + G AD+YE+ +++  F+ ++RTE +ST+ ++  I R
Sbjct:   60 SDDPEIIAQRARIDYSRKITLEMARSGKAGRPVRIYADGVYDLFHYGHANQLLQAKCAFP-EVYLVVGVCGDEDTLKYKGRTVTSENERYEGVRHCRYVDEVYKNAPWFCTVEFLKDLKIDFIAHDAIPYVAPGDADLYEKFRREEMFLETQRTEGVSTSDVVCRIIR 226          
BLAST of Choline-phosphate cytidylyltransferase vs. TrEMBL
Match: A0A238BYB1 (Cytidyltransferase domain protein OS=Onchocerca flexuosa OX=387005 GN=X798_02799 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 2.946e-46
Identity = 76/168 (45.24%), Postives = 112/168 (66.67%), Query Frame = 3
Query:  117 STDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            S D E+   R ++ + + I L +A  G  GRP+RIY +GV+D+FHYGHAN  LQAK  FP +++++ GV  ++D +KYK + +    ER   VRHCR+VDEV  NAPW  TVEFL + +IDF  HD  PY + G AD+YE+ +++  F+ ++RTE +ST+ ++  I R
Sbjct:   61 SDDPEIIAQRARIDYSRKITLEMARSGKAGRPVRIYADGVYDLFHYGHANQLLQAKCAFP-EVYLIVGVCGDEDTLKYKGRTVTSENERYEGVRHCRYVDEVYKNAPWFCTVEFLKDLKIDFIAHDAIPYVAPGDADLYEKFRREEMFVETQRTEGVSTSDVVCRIIR 227          
BLAST of Choline-phosphate cytidylyltransferase vs. TrEMBL
Match: A0A3P3YAK3 (CTP_transf_like domain-containing protein OS=Plasmodiophora brassicae OX=37360 GN=PLBR_LOCUS4410 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 1.177e-45
Identity = 73/140 (52.14%), Postives = 103/140 (73.57%), Query Frame = 3
Query:  204 GRPIRIYIEGVFDMFHYGHANLFLQAKSYFPG-QIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYP--SGGVADIYEELKKQNRFIPSKRTENISTTQIIDAI 614
            GRPIR++ +G+FD+FH+GHA +  QAK+ FPG ++ +V G+  ++D  +YK K +M  EERI SVRHCRHVDE+I  +PW+ T EFL++HRID+  HD  PYP  SG   D+Y  +K+Q  F+P+KRTE IST+ +I+ I
Sbjct:   67 GRPIRVFADGIFDLFHFGHARVLEQAKNIFPGHEVHLVVGICSDEDTHRYKGKTVMTEEERIESVRHCRHVDEIIERSPWVLTNEFLEKHRIDYVAHDDLPYPDASGAADDVYAFVKQQGMFVPTKRTEGISTSDLINRI 206          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: pcyt1ba (phosphate cytidylyltransferase 1, choline, beta [Source:NCBI gene;Acc:103043836])

HSP 1 Score: 145.206 bits (365), Expect = 2.205e-41
Identity = 66/138 (47.83%), Postives = 93/138 (67.39%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            RP+R+Y +G+FD+FH GHA   +QAK+ FP    +V   SDE    KYK   +M  +ER  ++RHCR+VDEV+ +APW  T EFL++H+IDF  HD  PY S G  D+Y+ +K+   F+P++RTE IST+ +I  I R
Sbjct:   55 RPVRVYADGIFDLFHSGHARALMQAKNLFPNSYLIVGVCSDEL-THKYKGFTVMTEDERYEALRHCRYVDEVVRDAPWTLTQEFLEKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTQRTEGISTSDLITRIVR 191          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: pcyt1ba (phosphate cytidylyltransferase 1, choline, beta [Source:NCBI gene;Acc:103043836])

HSP 1 Score: 145.206 bits (365), Expect = 2.269e-41
Identity = 66/138 (47.83%), Postives = 93/138 (67.39%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            RP+R+Y +G+FD+FH GHA   +QAK+ FP    +V   SDE    KYK   +M  +ER  ++RHCR+VDEV+ +APW  T EFL++H+IDF  HD  PY S G  D+Y+ +K+   F+P++RTE IST+ +I  I R
Sbjct:   49 RPVRVYADGIFDLFHSGHARALMQAKNLFPNSYLIVGVCSDEL-THKYKGFTVMTEDERYEALRHCRYVDEVVRDAPWTLTQEFLEKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTQRTEGISTSDLITRIVR 185          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: pcyt1aa (choline-phosphate cytidylyltransferase A [Source:NCBI gene;Acc:103040438])

HSP 1 Score: 142.895 bits (359), Expect = 3.045e-40
Identity = 72/154 (46.75%), Postives = 96/154 (62.34%), Query Frame = 3
Query:  162 FKPIPLYVAEKGSH-GRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            +K + +  A++G+   RP+R+Y +G+FDMFH GHA   +QAK  FP    +V   SDE    K K   +M  +ER  +V HCR+VDEV+ NAPW  T EFL +HRIDF  HD  PY S G  D+Y+ +K    F P++RTE IST+ II  I R
Sbjct:   57 YKRVSMEEAKRGTPPERPVRVYADGIFDMFHSGHARALMQAKGLFPNTHLIVGVCSDEL-THKLKGFTVMNEDERYDAVTHCRYVDEVVRNAPWTLTPEFLTKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 209          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: pcyt1ab (choline-phosphate cytidylyltransferase A-like [Source:NCBI gene;Acc:103031553])

HSP 1 Score: 142.51 bits (358), Expect = 3.201e-40
Identity = 71/151 (47.02%), Postives = 94/151 (62.25%), Query Frame = 3
Query:  171 IPLYVAEKGS-HGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            + L  A +G+   RP+R+Y +G+FDMFH GHA   +QAK  FP    +V GV  +    K K   +M  +ER  +V HCR+VDEV+ +APW  T EFL EHRIDF  HD  PY S G  D+Y+ +K+   F P++RTE IST+ II  I R
Sbjct:   58 VSLEEARRGTPANRPVRVYADGIFDMFHSGHARALMQAKRLFPNTHLIV-GVCSDGLTHKLKGFTVMNEDERYDAVSHCRYVDEVVRDAPWTLTAEFLTEHRIDFVAHDDIPYVSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVR 207          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: pcyt1ab (choline-phosphate cytidylyltransferase A-like [Source:NCBI gene;Acc:103031553])

HSP 1 Score: 142.51 bits (358), Expect = 3.201e-40
Identity = 71/151 (47.02%), Postives = 94/151 (62.25%), Query Frame = 3
Query:  171 IPLYVAEKGS-HGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            + L  A +G+   RP+R+Y +G+FDMFH GHA   +QAK  FP    +V GV  +    K K   +M  +ER  +V HCR+VDEV+ +APW  T EFL EHRIDF  HD  PY S G  D+Y+ +K+   F P++RTE IST+ II  I R
Sbjct:   58 VSLEEARRGTPANRPVRVYADGIFDMFHSGHARALMQAKRLFPNTHLIV-GVCSDGLTHKLKGFTVMNEDERYDAVSHCRYVDEVVRDAPWTLTAEFLTEHRIDFVAHDDIPYVSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVR 207          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Yeast
Match: PCT1 (Cholinephosphate cytidylyltransferase; a rate-determining enzyme of the CDP-choline pathway for phosphatidylcholine synthesis, inhibited by Sec14p, activated upon lipid-binding; contains an element within the regulatory domain involved in both silencing and activation of enzymatic activity [Source:SGD;Acc:S000003434])

HSP 1 Score: 129.028 bits (323), Expect = 1.771e-35
Identity = 62/138 (44.93%), Postives = 86/138 (62.32%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            RPIRIY +GVFD+FH GH     Q K  FP  + ++ GV  +K   K K   ++  ++R  ++ HCR VDEV+PNAPW  T EFL EH+ID+  HD  PY S    DIY+ +K+  +F+ ++RT  +ST+ II  I R
Sbjct:  102 RPIRIYADGVFDLFHLGHMKQLEQCKKAFPN-VTLIVGVPSDKITHKLKGLTVLTDKQRCETLTHCRWVDEVVPNAPWCVTPEFLLEHKIDYVAHDDIPYVSADSDDIYKPIKEMGKFLTTQRTNGVSTSDIITKIIR 238          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Yeast
Match: ECT1 (Ethanolamine-phosphate cytidylyltransferase; catalyzes the second step of phosphatidylethanolamine biosynthesis; involved in the maintenance of plasma membrane; similar to mammalian CTP: phosphocholine cytidylyl-transferases; inability of the null mutant to synthesize phosphatidylethanolamine and phosphatidylcholine from ethanolamine is functionally complemented by human PCYT2 [Source:SGD;Acc:S000003239])

HSP 1 Score: 78.5666 bits (192), Expect = 1.180e-17
Identity = 45/138 (32.61%), Postives = 73/138 (52.90%), Query Frame = 3
Query:  210 PIRIYIEGVFDMFHYGHANLFLQAK---SYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAI 614
            P +++I+G FD  H+GHA   LQA+   S   G+++   GV  ++D    K  P+M + ER    R  R   EV+  AP++T   ++D+++  + +H           D Y+ +K+  RF   KRT  +STT+II  I
Sbjct:    7 PDKVWIDGCFDFTHHGHAGAILQARRTVSKENGKLF--CGVHTDEDIQHNKGTPVMNSSERYEHTRSNRWCSEVVEAAPYVTDPNWMDKYQCQYVVHGDDITIDANGEDCYKLVKEMGRFKVVKRTYGVSTTEIIHRI 142          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Nematostella
Match: EDO39372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC0])

HSP 1 Score: 135.191 bits (339), Expect = 5.582e-40
Identity = 59/135 (43.70%), Postives = 93/135 (68.89%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVA--DIYEELKKQNRFIPSKRTENISTTQII 605
            RPIR+Y +G++D FH+GHA   +QAK  FP +++++ GV  ++   K K   +M  +ER +S+ H R+VDEVI +APWI + +F+D H+IDF  HD  PY + G+   D+Y+++K   +F+ ++RTE IST+ II
Sbjct:    1 RPIRVYADGIYDCFHFGHARSLMQAKRAFPTEVYLMVGVCSDELTHKLKGFTVMTEDERYMSLLHSRYVDEVIRDAPWIVSPDFIDIHKIDFVAHDDIPYKTAGMQTDDVYKDIKAMGKFVATERTEGISTSDII 135          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Nematostella
Match: EDO31320 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY83])

HSP 1 Score: 97.4413 bits (241), Expect = 8.849e-24
Identity = 49/133 (36.84%), Postives = 72/133 (54.14%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQII 605
            + IR++ +G FDM H+GHAN   QAK+      W+  GV  + +    K  P+   EER   VR  + VDEVI NAP+ TT+E +D+H  +F +H      +    D Y  +K   R+   KRT  +STT ++
Sbjct:   11 KQIRVWTDGCFDMVHFGHANALRQAKAMGD---WLCVGVHSDAEIAHNKGPPVFNEEERYKMVRAIKWVDEVIENAPYTTTLETMDDHGCEFCVHGDDITLTADGTDTYHIVKDAGRYKECKRTAGVSTTNLV 140          

HSP 2 Score: 69.3218 bits (168), Expect = 7.516e-14
Identity = 43/137 (31.39%), Postives = 69/137 (50.36%), Query Frame = 3
Query:  219 IYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRK--PIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSG-GVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            IY  G FD+FH G  +   +AK+      +++ G+  ++   +YK    PIM   ER+LSV  CR+VD+VI  AP+  + E +D+ ++D  +H  +P  +     D Y   +K   F        I+T  I+  I R
Sbjct:  207 IYTAGAFDLFHVGFLDFLEKAKALGD---YLIVGLHTDQIVNRYKGSNYPIMNLHERVLSVLACRYVDQVIIGAPYSVSQELIDQFKVDLVVHGNTPVMNDVNGEDPYRIPRKLGIFKTINSESTITTADIVARIIR 340          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Nematostella
Match: EDO25505 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWA4])

HSP 1 Score: 46.9802 bits (110), Expect = 2.049e-7
Identity = 20/46 (43.48%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  474 IDFAMHDPSPYPSGGVA--DIYEELKKQNRFIPSKRTENISTTQII 605
            IDF  HD  PY + G+   D+Y+++K   +F+ ++RTE IST+ II
Sbjct:    1 IDFVAHDDIPYKTAGMQTDDVYKDIKAMGKFVATERTEGISTSDII 46          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: pcyt1ba (phosphate cytidylyltransferase 1, choline, beta [Source:NCBI gene;Acc:101166014])

HSP 1 Score: 144.821 bits (364), Expect = 7.964e-42
Identity = 65/138 (47.10%), Postives = 95/138 (68.84%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  ++   KYK   +M  +ER  ++RHCR+VDEV+ +APW  T +FLD+H+IDF  HD  PY S G  D+Y+ +K+   F+P++RTE IST+ II  I R
Sbjct:   49 RPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLLVGVCSDELTHKYKGFTVMTEQERYEALRHCRYVDEVLRDAPWTLTPKFLDKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTQRTEGISTSDIITRIVR 185          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: pcyt1ba (phosphate cytidylyltransferase 1, choline, beta [Source:NCBI gene;Acc:101166014])

HSP 1 Score: 144.436 bits (363), Expect = 3.799e-41
Identity = 65/138 (47.10%), Postives = 95/138 (68.84%), Query Frame = 3
Query:  207 RPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            RP+R+Y +G+FD+FH GHA   +QAK+ FP   +++ GV  ++   KYK   +M  +ER  ++RHCR+VDEV+ +APW  T +FLD+H+IDF  HD  PY S G  D+Y+ +K+   F+P++RTE IST+ II  I R
Sbjct:   49 RPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLLVGVCSDELTHKYKGFTVMTEQERYEALRHCRYVDEVLRDAPWTLTPKFLDKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTQRTEGISTSDIITRIVR 185          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: pcyt1aa (phosphate cytidylyltransferase 1, choline, alpha [Source:NCBI gene;Acc:101157809])

HSP 1 Score: 140.969 bits (354), Expect = 9.400e-40
Identity = 70/154 (45.45%), Postives = 97/154 (62.99%), Query Frame = 3
Query:  162 FKPIPLYVAEKGSH-GRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            +K + +  A++G+   RP+R+Y +G+FD+FH GHA   +QAK  FP    +V GV  +    KYK   +M  +ER  ++ HCR+VDEV+ NAPW  T EFL +HRIDF  HD  PY S G  D+Y+ +K    F P++RTE IST+ II  I R
Sbjct:   38 YKRVTMEEAKRGTPPDRPVRVYADGIFDVFHSGHARALMQAKRLFPNTHLIV-GVCSDDLTHKYKGFTVMNEDERYDAITHCRYVDEVVRNAPWTLTPEFLAKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 190          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: pcyt1aa (phosphate cytidylyltransferase 1, choline, alpha [Source:NCBI gene;Acc:101157809])

HSP 1 Score: 140.969 bits (354), Expect = 1.115e-39
Identity = 70/154 (45.45%), Postives = 97/154 (62.99%), Query Frame = 3
Query:  162 FKPIPLYVAEKGSH-GRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            +K + +  A++G+   RP+R+Y +G+FD+FH GHA   +QAK  FP    +V   SD+    KYK   +M  +ER  ++ HCR+VDEV+ NAPW  T EFL +HRIDF  HD  PY S G  D+Y+ +K    F P++RTE IST+ II  I R
Sbjct:   57 YKRVTMEEAKRGTPPDRPVRVYADGIFDVFHSGHARALMQAKRLFPNTHLIVGVCSDDL-THKYKGFTVMNEDERYDAITHCRYVDEVVRNAPWTLTPEFLAKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 209          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: pcyt1aa (phosphate cytidylyltransferase 1, choline, alpha [Source:NCBI gene;Acc:101157809])

HSP 1 Score: 141.739 bits (356), Expect = 1.394e-39
Identity = 70/154 (45.45%), Postives = 97/154 (62.99%), Query Frame = 3
Query:  162 FKPIPLYVAEKGSH-GRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISR 620
            +K + +  A++G+   RP+R+Y +G+FD+FH GHA   +QAK  FP    +V GV  +    KYK   +M  +ER  ++ HCR+VDEV+ NAPW  T EFL +HRIDF  HD  PY S G  D+Y+ +K    F P++RTE IST+ II  I R
Sbjct:   57 YKRVTMEEAKRGTPPDRPVRVYADGIFDVFHSGHARALMQAKRLFPNTHLIV-GVCSDDLTHKYKGFTVMNEDERYDAITHCRYVDEVVRNAPWTLTPEFLAKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 209          
BLAST of Choline-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000055917.1 (SMESG000055917.1)

HSP 1 Score: 386.726 bits (992), Expect = 1.845e-138
Identity = 181/190 (95.26%), Postives = 187/190 (98.42%), Query Frame = 3
Query:   63 MTFNIENITNRNSPLAYMSTDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISRTLVE 632
            MTFNIENITNRNSPLAYMSTDAEMGILRHQMGHFKPIPL++AEKGSHGRPIRIY+EGVFD+FHYGHANLFLQAKSYFPG+IWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSG VADIYEELKKQNRFIPSKRTEN STTQIIDAI RT+VE
Sbjct:    1 MTFNIENITNRNSPLAYMSTDAEMGILRHQMGHFKPIPLHIAEKGSHGRPIRIYVEGVFDLFHYGHANLFLQAKSYFPGKIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGDVADIYEELKKQNRFIPSKRTENTSTTQIIDAIGRTVVE 190          
BLAST of Choline-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000055914.1 (SMESG000055914.1)

HSP 1 Score: 385.571 bits (989), Expect = 6.163e-138
Identity = 181/190 (95.26%), Postives = 186/190 (97.89%), Query Frame = 3
Query:   63 MTFNIENITNRNSPLAYMSTDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISRTLVE 632
            MTFNIENITN NSPLAYMSTDAEMGILRHQMGHFKPIPL++AEKGSHGRPIRIY+EGVFD+FHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSG VADIYEELKKQNRFIPSKRTEN STTQIIDAI RT+VE
Sbjct:    1 MTFNIENITNLNSPLAYMSTDAEMGILRHQMGHFKPIPLHIAEKGSHGRPIRIYVEGVFDLFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGDVADIYEELKKQNRFIPSKRTENTSTTQIIDAIGRTVVE 190          
BLAST of Choline-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000055388.1 (SMESG000055388.1)

HSP 1 Score: 375.555 bits (963), Expect = 4.587e-134
Identity = 180/190 (94.74%), Postives = 184/190 (96.84%), Query Frame = 3
Query:   63 MTFNIENITNRNSPLAYMSTDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISRTLVE 632
            MTFNIENITNRNSPLAYMSTDAEMGILR+QMGHFKPIPLYVAEKGSH RPIRIYIEGVFDMFHYGHANLFLQAKSYFPG+I VVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDE+RIDFAM DPSPYPSG VADIYEELKKQNRFIPSKRTEN STTQII+AI RTLVE
Sbjct:    1 MTFNIENITNRNSPLAYMSTDAEMGILRYQMGHFKPIPLYVAEKGSHDRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGKIRVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEYRIDFAMIDPSPYPSGDVADIYEELKKQNRFIPSKRTENTSTTQIINAIGRTLVE 190          
BLAST of Choline-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000081359.1 (SMESG000081359.1)

HSP 1 Score: 273.478 bits (698), Expect = 1.261e-93
Identity = 123/187 (65.78%), Postives = 151/187 (80.75%), Query Frame = 3
Query:   63 MTFNIENITNRNSPLAYMSTDAEMGILRHQMGHFKPIPLYVAEKGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAISRT 623
            MTFN + I   NS LA +STD E+ I+R ++ +F PIP  +AEKG+  RPIRIY+EGV+D+FHYGHANL  QAK+YFPG +WVVAGVS+E +C KYKRKPIM+++ER+LSVRHCRHVDEVI N PWITT+ FL+E+++DF MHD   YPSG VAD+YEE K   RFIPSKRTEN STT+IID I R+
Sbjct:    1 MTFNFDEIKYNNSCLAKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRS 187          
BLAST of Choline-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000017201.1 (SMESG000017201.1)

HSP 1 Score: 100.523 bits (249), Expect = 1.208e-24
Identity = 48/139 (34.53%), Postives = 78/139 (56.12%), Query Frame = 3
Query:  198 SHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAI 614
            S  +P+R++++G FDM H+GHAN   QAK        ++ GV  + + + +K  P+   EER   ++  + VDEV+ NAP++T VE L+++  DF  H           D Y ++K  ++F   KRT  ISTT ++D +
Sbjct:    2 SENKPVRVWVDGCFDMLHFGHANALRQAKELGDA---LIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSADKFKEFKRTHGISTTDLVDRL 137          

HSP 2 Score: 56.6102 bits (135), Expect = 3.639e-9
Identity = 49/170 (28.82%), Postives = 75/170 (44.12%), Query Frame = 3
Query:  126 AEMGILRHQMGH-FKPIPLYVAE-----KGSHGRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRK-PIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGGVADIYEELKKQNRFIPSKRTENISTTQIIDAI 614
            A M I  +  G  F P  L +A+     +G       +Y+ G FD+FH GH  +FL+ + Y  G   +V   SDE     Y  K PIM   ER+LSV  C+ V  V+   P+  T   ++   ID  +H  +        DI+E  ++  +F        ++   +I  I
Sbjct:  154 ATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHC-MFLE-ECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDA--EDIFEVPRQLGQFSTVDSGSTLTFESLIQRI 319          
The following BLAST results are available for this feature:
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCYT1A5.670e-4247.83phosphate cytidylyltransferase 1, choline, alpha [... [more]
PCYT1A8.420e-4245.51phosphate cytidylyltransferase 1, choline, alpha [... [more]
PCYT1A8.209e-4145.51phosphate cytidylyltransferase 1, choline, alpha [... [more]
PCYT1A8.209e-4145.51phosphate cytidylyltransferase 1, choline, alpha [... [more]
PCYT1A8.737e-4145.51phosphate cytidylyltransferase 1, choline, alpha [... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcyt-11.227e-4341.52Putative choline-phosphate cytidylyltransferase [... [more]
pcyt-11.845e-4341.52Putative choline-phosphate cytidylyltransferase [... [more]
Y18H1A.114.766e-4040.94pep chromosome:WBcel235:I:680408:683257:1 gene:WBG... [more]
Y18H1A.112.407e-3940.94pep chromosome:WBcel235:I:680408:683472:1 gene:WBG... [more]
Y18H1A.116.611e-3142.86pep chromosome:WBcel235:I:681355:683257:1 gene:WBG... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcyt25.399e-4243.24gene:FBgn0035231 transcript:FBtr0072742[more]
Pcyt14.100e-3737.95gene:FBgn0041342 transcript:FBtr0072741[more]
Pcyt14.100e-3737.95gene:FBgn0041342 transcript:FBtr0072738[more]
Pcyt14.100e-3737.95gene:FBgn0041342 transcript:FBtr0333396[more]
Pcyt14.100e-3737.95gene:FBgn0041342 transcript:FBtr0345365[more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcyt1ba2.762e-4244.67phosphate cytidylyltransferase 1, choline, beta a ... [more]
pcyt1bb2.050e-3945.03phosphate cytidylyltransferase 1, choline, beta b ... [more]
pcyt1ab5.354e-3948.55phosphate cytidylyltransferase 1, choline, alpha b... [more]
pcyt1aa3.138e-3848.55phosphate cytidylyltransferase 1, choline, alpha a... [more]
pcyt1aa3.138e-3848.55phosphate cytidylyltransferase 1, choline, alpha a... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmtm39.096e-4148.55CKLF-like MARVEL transmembrane domain containing 3... [more]
PCYT1A1.649e-3841.34phosphate cytidylyltransferase 1, choline, alpha [... [more]
PCYT1A2.279e-3841.34phosphate cytidylyltransferase 1, choline, alpha [... [more]
PCYT1A2.477e-3841.34phosphate cytidylyltransferase 1, choline, alpha [... [more]
pcyt27.467e-2333.59phosphate cytidylyltransferase 2, ethanolamine [So... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcyt1b1.219e-4047.10phosphate cytidylyltransferase 1, choline, beta is... [more]
Pcyt1b2.743e-4047.10phosphate cytidylyltransferase 1, choline, beta is... [more]
Pcyt1a2.927e-4044.87phosphate cytidylyltransferase 1, choline, alpha i... [more]
Pcyt1a2.927e-4044.87phosphate cytidylyltransferase 1, choline, alpha i... [more]
Pcyt1a2.927e-4044.87phosphate cytidylyltransferase 1, choline, alpha i... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P49583|PCY1_CAEEL2.347e-4241.52Putative choline-phosphate cytidylyltransferase OS... [more]
sp|Q9ZV56|CCT1_ARATH6.084e-4148.15Choline-phosphate cytidylyltransferase 1 OS=Arabid... [more]
sp|P49585|PCY1A_HUMAN3.942e-4045.51Choline-phosphate cytidylyltransferase A OS=Homo s... [more]
sp|P19836|PCY1A_RAT1.461e-3944.87Choline-phosphate cytidylyltransferase A OS=Rattus... [more]
sp|Q811Q9|PCY1B_MOUSE1.919e-3947.10Choline-phosphate cytidylyltransferase B OS=Mus mu... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A044SQ693.056e-4745.83CTP_transf_like domain-containing protein OS=Oncho... [more]
A0A183H2454.752e-4745.24CTP_transf_like domain-containing protein OS=Oncho... [more]
A0A182E2S67.508e-4745.83CTP_transf_like domain-containing protein OS=Oncho... [more]
A0A238BYB12.946e-4645.24Cytidyltransferase domain protein OS=Onchocerca fl... [more]
A0A3P3YAK31.177e-4552.14CTP_transf_like domain-containing protein OS=Plasm... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcyt1ba2.205e-4147.83phosphate cytidylyltransferase 1, choline, beta [S... [more]
pcyt1ba2.269e-4147.83phosphate cytidylyltransferase 1, choline, beta [S... [more]
pcyt1aa3.045e-4046.75choline-phosphate cytidylyltransferase A [Source:N... [more]
pcyt1ab3.201e-4047.02choline-phosphate cytidylyltransferase A-like [Sou... [more]
pcyt1ab3.201e-4047.02choline-phosphate cytidylyltransferase A-like [Sou... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PCT11.771e-3544.93Cholinephosphate cytidylyltransferase; a rate-dete... [more]
ECT11.180e-1732.61Ethanolamine-phosphate cytidylyltransferase; catal... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO393725.582e-4043.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313208.849e-2436.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO255052.049e-743.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcyt1ba7.964e-4247.10phosphate cytidylyltransferase 1, choline, beta [S... [more]
pcyt1ba3.799e-4147.10phosphate cytidylyltransferase 1, choline, beta [S... [more]
pcyt1aa9.400e-4045.45phosphate cytidylyltransferase 1, choline, alpha [... [more]
pcyt1aa1.115e-3945.45phosphate cytidylyltransferase 1, choline, alpha [... [more]
pcyt1aa1.394e-3945.45phosphate cytidylyltransferase 1, choline, alpha [... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055917.11.845e-13895.26SMESG000055917.1[more]
SMESG000055914.16.163e-13895.26SMESG000055914.1[more]
SMESG000055388.14.587e-13494.74SMESG000055388.1[more]
SMESG000081359.11.261e-9365.78SMESG000081359.1[more]
SMESG000017201.11.208e-2434.53SMESG000017201.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035391 ID=SMED30035391|Name=Choline-phosphate cytidylyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=736bp
CAAATCTCTAACTAGCACGATAAAAACTATTTTTACAGAAAACGTATTCC
AAGAAATTGAAAATGACTTTTAATATAGAAAATATAACTAATCGCAATTC
TCCATTGGCCTACATGTCAACTGATGCGGAAATGGGGATACTACGACACC
AAATGGGCCATTTCAAACCAATCCCGCTCTATGTAGCGGAAAAAGGTTCT
CATGGTCGCCCAATTAGAATTTATATCGAAGGAGTTTTTGATATGTTTCA
TTATGGCCATGCCAATTTGTTTTTACAAGCAAAAAGTTATTTTCCGGGTC
AAATTTGGGTGGTTGCTGGAGTGTCAGACGAGAAAGATTGCATGAAATAC
AAACGAAAACCAATCATGAAAACGGAAGAAAGAATTCTCTCAGTGAGACA
TTGCCGACATGTCGATGAAGTGATTCCTAATGCACCATGGATAACTACTG
TGGAATTCTTGGATGAACATAGAATCGACTTTGCCATGCATGATCCATCA
CCATATCCGAGTGGAGGCGTGGCGGATATTTACGAGGAATTGAAAAAACA
GAACAGATTTATCCCGAGTAAAAGAACCGAAAACATCAGCACCACCCAAA
TTATTGATGCAATTAGTAGAACTTTGGTGGAATAAATTTGACATTTTCGA
CAATATTCTTCGATATTTACATTAGGCTTGGAACTGATGATGAAATTGTT
AATTATATATTATGTAATAGTTTAAAAATAAATCCC
back to top

protein sequence of SMED30035391-orf-1

>SMED30035391-orf-1 ID=SMED30035391-orf-1|Name=SMED30035391-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=191bp
MTFNIENITNRNSPLAYMSTDAEMGILRHQMGHFKPIPLYVAEKGSHGRP
IRIYIEGVFDMFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKP
IMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPS
GGVADIYEELKKQNRFIPSKRTENISTTQIIDAISRTLVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004821Cyt_trans-like
IPR014729Rossmann-like_a/b/a_fold
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0009058biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 14..189
e-value: 1.5E-56
score: 193.5
IPR004821Cytidyltransferase-like domainTIGRFAMTIGR00125TIGR00125coord: 52..120
e-value: 2.7E-12
score: 44.7
IPR004821Cytidyltransferase-like domainPFAMPF01467CTP_transf_likecoord: 55..182
e-value: 3.7E-22
score: 79.0
NoneNo IPR availablePANTHERPTHR10739CYTIDYLYLTRANSFERASEcoord: 39..184
NoneNo IPR availablePANTHERPTHR10739:SF13CTP:PHOSPHOCHOLINE CYTIDYLYLTRANSFERASE 1, ISOFORM A-RELATEDcoord: 39..184
NoneNo IPR availableSUPERFAMILYSSF52374Nucleotidylyl transferasecoord: 52..184