Nuclear envelope integral membrane protein 1

Overview
NameNuclear envelope integral membrane protein 1
Smed IDSMED30035387
Length (bp)1291
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear envelope integral membrane protein 1 (SMED30035387) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear envelope integral membrane protein 1 (SMED30035387) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear envelope integral membrane protein 1 (SMED30035387) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear envelope integral membrane protein 1 (SMED30035387) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035387

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035387h1SMcG0012350 SmedASXL_014060SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035387h1SMcG0012350 SmedASXL_014060SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30035387h1SMcG0012350 dd_Smed_v4_10531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30035387h1SMcG0012350 dd_Smed_v4_10531_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Human
Match: NEMP1 (nuclear envelope integral membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:29001])

HSP 1 Score: 81.2629 bits (199), Expect = 4.924e-16
Identity = 65/278 (23.38%), Postives = 134/278 (48.20%), Query Frame = 2
Query:  443 EKPYRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV---IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEY---------PKILQE---------NTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSE 1213
            +  Y + +  +F+  LF++ ++ +M+FF    LS+S +F++S G+ + + ASLL+ +FILS+ +P +   Y I + G S    +   +F    ++W  + + L++   YVL V  ++ ++ Y Y P + N ++ N            ++ +++ L  +  +  GI I  P     ++   L       PI+ +YI   +          P++L E          T   L E R++  SP+C+ WK + + ++  +  +FV+   H++  E+  ++ E
Sbjct:  148 DTKYSVIVIRRFDPKLFLVFLLGLMLFFCGDLLSRSQIFYYSTGMTVGIVASLLIIIFILSKFMPKKSPIYVILVGGWSFSLYLIQLVFKNLQEIWRCYWQYLLS---YVLTVGFMSFAVCYKYGPLE-NERSIN------------LLTWTLQLMGLCFMYSGIQI--PHIALAIIIIALCTKNLEHPIQWLYITCRKVCKGAEKPVPPRLLTEEEYRIQGEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQE 407          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Human
Match: NEMP2 (nuclear envelope integral membrane protein 2 [Source:HGNC Symbol;Acc:HGNC:33700])

HSP 1 Score: 64.3142 bits (155), Expect = 1.676e-10
Identity = 57/267 (21.35%), Postives = 119/267 (44.57%), Query Frame = 2
Query:  479 NFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIA---GSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLALYKRYFPIKRI-------------------YIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSE 1213
            +F LF++ V  + +FF ++ LS+S  F++S G ++ +  +L+  + ++ R +P    F+A+ +     S  I   L  ++D  W+ +E N + V  YVL V   +  + Y + P   +   S            ++MW  + L S+ ++  G+ +  P F    +   ++ +  ++P++                     Y+  +EY +     T++ L E R+    P+   W  + +     K  +FV  G H+S +EI  ++ +
Sbjct:  151 DFKLFLVFVAGVFLFFYARTLSQSPTFYYSSGTVLGVLMTLVFVLLLVKRFIPKYSTFWALMVGCWFASVYIVCQL--MEDLKWLWYE-NRIYVLGYVLIVGFFSFVVCYKHGPLADDRSRS------------LLMWM-LRLLSLVLVYAGVAV--PQFAYAAIILLMSSWSLHYPLRACSYMRWKMEQWFTSKELVVKYLTEDEYREQADAETNSALEELRRACRKPDFPSWLVVSRLHTPSKFADFVLGGSHLSPEEISLHEEQ 399          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Human
Match: NEMP1 (nuclear envelope integral membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:29001])

HSP 1 Score: 63.5438 bits (153), Expect = 2.011e-10
Identity = 59/261 (22.61%), Postives = 120/261 (45.98%), Query Frame = 2
Query:  494 IITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSS---VIFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEY---------PKILQE---------NTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSE 1213
            ++ V  +      K L +S +F++S G+ + + ASLL+ +FILS+ +P +   Y I + G S    +   +F    ++W  + + L++   YVL V  ++ ++ Y Y P + N ++ N            ++ +++ L  +  +  GI I  P     ++   L       PI+ +YI   +          P++L E          T   L E R++  SP+C+ WK + + ++  +  +FV+   H++  E+  ++ E
Sbjct:   92 LVRVTQVENEEKLKELEQSQIFYYSTGMTVGIVASLLIIIFILSKFMPKKSPIYVILVGGWSFSLYLIQLVFKNLQEIWRCYWQYLLS---YVLTVGFMSFAVCYKYGPLE-NERSIN------------LLTWTLQLMGLCFMYSGIQI--PHIALAIIIIALCTKNLEHPIQWLYITCRKVCKGAEKPVPPRLLTEEEYRIQGEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQE 334          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Celegans
Match: nemp-1 (Nuclear Envelope integral Membrane Protein homolog [Source:UniProtKB/TrEMBL;Acc:Q19293])

HSP 1 Score: 90.1225 bits (222), Expect = 3.124e-19
Identity = 85/349 (24.36%), Postives = 167/349 (47.85%), Query Frame = 2
Query:  221 FLSIQNLKMGEFKMYYGENDTSVHDLCESTNSNYVFMDTLIYKLKLLIFGPNSKSLNFEFNPFNRLSIGIKPLLEKPYRIKIYT-KFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVL--FVTCLTCSMMY-YYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFL-------ALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDS-GRHISEKEIEDYDSEDNVVDE 1231
            FL        +++ Y G N T+V  L ++ N  +     ++ K  LL         + + NPFN   +G+     +PY I +   K N+    + V +I++F ++  L ++++F+++ G    L ASLLL  FI+ R+ P +     I I G SV   Y+ H     W   +  ++    YV+  F T L  SM   Y      + ++ +I  ++++++A+ +++FSV +  +    +G LI+  +   +L +          A+++++FP +R  +  EEY +  ++ T  +L + R+Y        WK     ++  +L  F++    HI+E EI  ++   +V+D+
Sbjct:   63 FLQTNLTNADQYQFYQGTNCTTVQQLYDNDNRYF----GILRKAALL--------RSHQLNPFNDTIVGVS--TTEPYEISVLIWKVNYFRVGVYVGAIVLFLLASKLVRNVVFYYTSGCSFGLLASLLLVAFIVWRVAPKKTIGVPILIGGWSVSL-YMLHFA---WSNLQSIMIEYQKYVIGYFATVLLISMAVCYKRGPPTDARSHDIAQWTLQLVALALIYFSVQMVEVSTGTIGALIIQQICRGFLFAGIRWYFVGLKAVWRKFFPARRRLLNEEEYEEQAEKTTKEQLAQLREYCKKEGNRPWKIAGNVRSARRLARFIEGEDDHITEDEIYAHELTGDVLDD 393          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Celegans
Match: nemp-1 (Nuclear Envelope integral Membrane Protein homolog [Source:UniProtKB/TrEMBL;Acc:Q19293])

HSP 1 Score: 90.1225 bits (222), Expect = 3.124e-19
Identity = 85/349 (24.36%), Postives = 167/349 (47.85%), Query Frame = 2
Query:  221 FLSIQNLKMGEFKMYYGENDTSVHDLCESTNSNYVFMDTLIYKLKLLIFGPNSKSLNFEFNPFNRLSIGIKPLLEKPYRIKIYT-KFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVL--FVTCLTCSMMY-YYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFL-------ALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDS-GRHISEKEIEDYDSEDNVVDE 1231
            FL        +++ Y G N T+V  L ++ N  +     ++ K  LL         + + NPFN   +G+     +PY I +   K N+    + V +I++F ++  L ++++F+++ G    L ASLLL  FI+ R+ P +     I I G SV   Y+ H     W   +  ++    YV+  F T L  SM   Y      + ++ +I  ++++++A+ +++FSV +  +    +G LI+  +   +L +          A+++++FP +R  +  EEY +  ++ T  +L + R+Y        WK     ++  +L  F++    HI+E EI  ++   +V+D+
Sbjct:   63 FLQTNLTNADQYQFYQGTNCTTVQQLYDNDNRYF----GILRKAALL--------RSHQLNPFNDTIVGVS--TTEPYEISVLIWKVNYFRVGVYVGAIVLFLLASKLVRNVVFYYTSGCSFGLLASLLLVAFIVWRVAPKKTIGVPILIGGWSVSL-YMLHFA---WSNLQSIMIEYQKYVIGYFATVLLISMAVCYKRGPPTDARSHDIAQWTLQLVALALIYFSVQMVEVSTGTIGALIIQQICRGFLFAGIRWYFVGLKAVWRKFFPARRRLLNEEEYEEQAEKTTKEQLAQLREYCKKEGNRPWKIAGNVRSARRLARFIEGEDDHITEDEIYAHELTGDVLDD 393          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Fly
Match: CG9723 (gene:FBgn0030768 transcript:FBtr0074376)

HSP 1 Score: 101.293 bits (251), Expect = 5.899e-23
Identity = 74/286 (25.87%), Postives = 142/286 (49.65%), Query Frame = 2
Query:  392 FEFNPFNRLSIGIKPLLEKPYRIKIYTKFNFTLFIIT--VISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVL---FVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSEDNVVDES 1234
             + +PF +  IGI     + Y + I       L+ +    + I+I F ++ L+K+ +F++  G++I + ASLL+ +++ +++ P R   Y + I G ++ F  +  L D L ++    L+T   +VL    +T L   ++ Y      N ++  I+ + ++ I  +M +FS    S  I ++ ++ V   F     +    +Y+R FP+KR  +  EEY +     T   L + RKY+ SPEC  W  M + ++  +   F +   H+ ++EIED+      ++ES
Sbjct:  113 LQLSPFEQQCIGISS--RQAYTV-ILNSIPLDLWRLAQFAVGILILFSARRLAKNSVFYYLVGIVIGICASLLVVIYLAAKLFPRRTMMYGVLIGGWTIGFYVIKQLADNLRLI----LITYRDHVLGYLVITGLISFLICYRIGPPKNPRSQTIVMWVLQAIGAVMAYFSSWHTSAVIFIMVLVFVAHYFPISWTNQIKFMYRRRFPLKRRMLTQEEYEQQTAVETSKSLADLRKYVNSPECKQWAVMGKLRDPLRFASFANGAPHLDDEEIEDH---SRTIEES 388          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Zebrafish
Match: nemp1 (nuclear envelope integral membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-090313-182])

HSP 1 Score: 78.5666 bits (192), Expect = 2.704e-15
Identity = 61/258 (23.64%), Postives = 132/258 (51.16%), Query Frame = 2
Query:  452 YRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSM-FILLLGILIVFPLFHPYLLSPFLALYKRYFPIK---RIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSE 1213
            Y ++    F+  LF++ +  +++FF +  LS+S +FH+S G+   + ASLL+ +FI+ R +P +  FY + + G S     +  +   L V+   +      YV  V  ++ ++ Y Y P  +  ++ NI++++++I  +++++  + ++ + F +++       L +P+  +    LY +  P K   R  +  EE+ +  +  T   L E RKY  SP+ N WK + + ++  +  +F++   H+   E+  +  E
Sbjct:  144 YTVQPSRHFDIYLFLVFLAGVLLFFYADVLSRSQVFHYSAGMSTGMIASLLILIFIVYRFLPKKSPFYMLVVGGWSFSLYIIQLVFRNLQVILTDHWHLAIGYVFVVGFISFAVCYRYGP-LVEERSINILSWALQIFGLLLVYAGIQVQQVAFAIMIAAFCSKNLEYPF--NTAFMLYHKLKPKKLEPRRLLTEEEFQRQSEVETQKALEELRKYCGSPDFNTWKTVSRLQSPKRFADFIEGSPHLLSNEVSVHMQE 398          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Zebrafish
Match: nemp2 (nuclear envelope integral membrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-081104-413])

HSP 1 Score: 70.8626 bits (172), Expect = 9.669e-13
Identity = 61/279 (21.86%), Postives = 141/279 (50.54%), Query Frame = 2
Query:  473 KFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILI---VFPLFHPYLLS------PFLALY-KRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDS---------EDNVVDESSVTDSS 1252
            + N   F++ V  +++FF ++N+ +S +F ++ GV + + A+ +    +L   VP R  F  +  AGS + +  +  + ++   +  ++ + +  YVL     + ++ Y + P   N  T N +  S++ + I+++++ ++    + +L+ +L+   + PL    L+        FLAL+ +R  P  R+ +  EEY +  + +T   L E R+Y   P    W+ + + ++  +  EF+  G HI+++E +++++         E+ + + SS +D+ 
Sbjct:  145 RLNRMCFLLFVCGLILFFGARNICRSSLFFYTTGVSLGIIATFVFLTLLLRNFVPKRGLFLVLLGAGSGLSYMGIQRVLNEWDDIVTEHWMELLAYVLISGLFSFAVCYKHGP-ITNKHTLNFMTCSMQAVGIVLLYYGITFPPAYFVLVAVLLCWKILPLAWSLLMGICSLFYSFLALFRRRRRPTVRL-LTEEEYREQGEIHTRASLDELREYCNRPGFPAWETVLRLRSPQRFAEFLRQGSHITQEEHQNHENHYGLGGAYYENVIFNNSSSSDTQ 421          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Xenopus
Match: nemp1 (nuclear envelope integral membrane protein 1 [Source:NCBI gene;Acc:594887])

HSP 1 Score: 85.1149 bits (209), Expect = 1.771e-17
Identity = 75/292 (25.68%), Postives = 144/292 (49.32%), Query Frame = 2
Query:  452 YRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV-------IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGIL-----IVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDS---------EDNVVDESSVTDSSIEMN 1264
            Y + +   F+  LF + +  +++FF    LS+S +F++S G+ + + AS+L+ +F+LS+++P +  F A+ + G SV       +F  L  +  + W      L  V F V F  C      Y Y P + N ++ NI+N+++++I +++M+ SV ++ + + ++ I      I +P+   Y+L   + L KR  P     +  EEY K     T   L E R Y  SP+   WK + + ++  +  +FV+   H++  E+  ++          ED +  E S  +  +E+ 
Sbjct:  114 YSVALSRGFDPRLFFVFLCGLLLFFYGDTLSRSQIFYYSTGITVGMLASMLILVFMLSKLMPKKSPFVALLLGGWSVSIYVIQLVFKNLQAICTEYWQYLLGYLGIVGF-VSFAFC------YKYGPLE-NERSINILNWTLQLIGLLLMYISVQIRHIAVTMVVIAFCTKQIEYPVRWIYILYRKIKL-KRGKPSPPRLLTEEEYRKQGDVETRKALEELRGYCSSPDFAAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEHEYGFGGSFLEDELFGEDSDVEEEMEIE 396          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Xenopus
Match: nemp1 (nuclear envelope integral membrane protein 1 [Source:NCBI gene;Acc:594887])

HSP 1 Score: 85.1149 bits (209), Expect = 1.918e-17
Identity = 75/292 (25.68%), Postives = 144/292 (49.32%), Query Frame = 2
Query:  452 YRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV-------IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGIL-----IVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDS---------EDNVVDESSVTDSSIEMN 1264
            Y + +   F+  LF + +  +++FF    LS+S +F++S G+ + + AS+L+ +F+LS+++P +  F A+ + G SV       +F  L  +  + W      L  V F V F  C      Y Y P + N ++ NI+N+++++I +++M+ SV ++ + + ++ I      I +P+   Y+L   + L KR  P     +  EEY K     T   L E R Y  SP+   WK + + ++  +  +FV+   H++  E+  ++          ED +  E S  +  +E+ 
Sbjct:  122 YSVALSRGFDPRLFFVFLCGLLLFFYGDTLSRSQIFYYSTGITVGMLASMLILVFMLSKLMPKKSPFVALLLGGWSVSIYVIQLVFKNLQAICTEYWQYLLGYLGIVGF-VSFAFC------YKYGPLE-NERSINILNWTLQLIGLLLMYISVQIRHIAVTMVVIAFCTKQIEYPVRWIYILYRKIKL-KRGKPSPPRLLTEEEYRKQGDVETRKALEELRGYCSSPDFAAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEHEYGFGGSFLEDELFGEDSDVEEEMEIE 404          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Xenopus
Match: nemp1 (nuclear envelope integral membrane protein 1 [Source:NCBI gene;Acc:594887])

HSP 1 Score: 85.8853 bits (211), Expect = 2.029e-17
Identity = 75/292 (25.68%), Postives = 144/292 (49.32%), Query Frame = 2
Query:  452 YRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV-------IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGIL-----IVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDS---------EDNVVDESSVTDSSIEMN 1264
            Y + +   F+  LF + +  +++FF    LS+S +F++S G+ + + AS+L+ +F+LS+++P +  F A+ + G SV       +F  L  +  + W      L  V F V F  C      Y Y P + N ++ NI+N+++++I +++M+ SV ++ + + ++ I      I +P+   Y+L   + L KR  P     +  EEY K     T   L E R Y  SP+   WK + + ++  +  +FV+   H++  E+  ++          ED +  E S  +  +E+ 
Sbjct:  232 YSVALSRGFDPRLFFVFLCGLLLFFYGDTLSRSQIFYYSTGITVGMLASMLILVFMLSKLMPKKSPFVALLLGGWSVSIYVIQLVFKNLQAICTEYWQYLLGYLGIVGF-VSFAFC------YKYGPLE-NERSINILNWTLQLIGLLLMYISVQIRHIAVTMVVIAFCTKQIEYPVRWIYILYRKIKL-KRGKPSPPRLLTEEEYRKQGDVETRKALEELRGYCSSPDFAAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEHEYGFGGSFLEDELFGEDSDVEEEMEIE 514          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Xenopus
Match: nemp1 (nuclear envelope integral membrane protein 1 [Source:NCBI gene;Acc:594887])

HSP 1 Score: 74.3294 bits (181), Expect = 1.014e-13
Identity = 68/255 (26.67%), Postives = 130/255 (50.98%), Query Frame = 2
Query:  452 YRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV-------IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGIL-----IVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHI 1180
            Y + +   F+  LF + +  +++FF    LS+S +F++S G+ + + AS+L+ +F+LS+++P +  F A+ + G SV       +F  L  +  + W      L  V F V F  C      Y Y P + N ++ NI+N+++++I +++M+ SV ++ + + ++ I      I +P+   Y+L   + L KR  P     +  EEY K     T   L E R Y  SP+   WK + + ++  + ++ + + R I
Sbjct:  232 YSVALSRGFDPRLFFVFLCGLLLFFYGDTLSRSQIFYYSTGITVGMLASMLILVFMLSKLMPKKSPFVALLLGGWSVSIYVIQLVFKNLQAICTEYWQYLLGYLGIVGF-VSFAFC------YKYGPLE-NERSINILNWTLQLIGLLLMYISVQIRHIAVTMVVIAFCTKQIEYPVRWIYILYRKIKL-KRGKPSPPRLLTEEEYRKQGDVETRKALEELRGYCSSPDFAAWKTVSRIQSPKRKSQAIKNYRRI 477          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Mouse
Match: Nemp1 (nuclear envelope integral membrane protein 1 [Source:MGI Symbol;Acc:MGI:2446113])

HSP 1 Score: 88.1965 bits (217), Expect = 1.359e-18
Identity = 64/264 (24.24%), Postives = 143/264 (54.17%), Query Frame = 2
Query:  443 EKPYRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV---IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSM-FILLLGILIVFPLFHP--YLLSPFLALYKRYF-PIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSE 1213
            +  Y + +  +F+  LF++ ++ + +FF    LS+S +F++S G+ + + ASLL+ +F++S+ +P R   Y I + G S    +   +F    ++W  +   L++   Y+L V  ++ ++ Y Y P + N ++ N++ ++++++ + +M+ S+ +  + F L++  L    L +P  +L S +  + K    P+    +  EEY    +  T   L+E R++  SPEC+ WK + + ++  +  +FV+   H++  E+  ++ E
Sbjct:   97 DTTYSVTVTRRFDPKLFLVFLLGLTLFFCGDLLSRSQIFYYSTGMSVGIVASLLIVIFMISKFMPKRSPIYVILVGGWSFSLYLIQLVFKNLQEIWRSYWHYLLS---YILTVGFMSFAVCYKYGPLE-NERSINLLTWTLQLLGLGLMYSSIQIPHVAFALIVIALCTKNLEYPIHWLCSTYRRMCKASGKPVPPRLLTEEEYRIQGEVETQKALQELREFCNSPECSAWKTISRIQSPKRFADFVEGSFHLTPNEVSVHEQE 356          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Mouse
Match: Nemp1 (nuclear envelope integral membrane protein 1 [Source:MGI Symbol;Acc:MGI:2446113])

HSP 1 Score: 87.8113 bits (216), Expect = 2.121e-18
Identity = 64/264 (24.24%), Postives = 143/264 (54.17%), Query Frame = 2
Query:  443 EKPYRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV---IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSM-FILLLGILIVFPLFHP--YLLSPFLALYKRYF-PIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSE 1213
            +  Y + +  +F+  LF++ ++ + +FF    LS+S +F++S G+ + + ASLL+ +F++S+ +P R   Y I + G S    +   +F    ++W  +   L++   Y+L V  ++ ++ Y Y P + N ++ N++ ++++++ + +M+ S+ +  + F L++  L    L +P  +L S +  + K    P+    +  EEY    +  T   L+E R++  SPEC+ WK + + ++  +  +FV+   H++  E+  ++ E
Sbjct:  146 DTTYSVTVTRRFDPKLFLVFLLGLTLFFCGDLLSRSQIFYYSTGMSVGIVASLLIVIFMISKFMPKRSPIYVILVGGWSFSLYLIQLVFKNLQEIWRSYWHYLLS---YILTVGFMSFAVCYKYGPLE-NERSINLLTWTLQLLGLGLMYSSIQIPHVAFALIVIALCTKNLEYPIHWLCSTYRRMCKASGKPVPPRLLTEEEYRIQGEVETQKALQELREFCNSPECSAWKTISRIQSPKRFADFVEGSFHLTPNEVSVHEQE 405          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Mouse
Match: Nemp2 (nuclear envelope integral membrane protein 2 [Source:MGI Symbol;Acc:MGI:2444113])

HSP 1 Score: 68.1662 bits (165), Expect = 5.583e-12
Identity = 65/293 (22.18%), Postives = 125/293 (42.66%), Query Frame = 2
Query:  359 LIFGPNSKSLNFEFNPFNRLSIGIKPLLEKPYRIKIYTKF-NFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLALYKRYFP-------IKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSE 1213
            ++F P  +++ F   P  RL          PY + +     +F LF++ V  I +F  +K LS+S +F++S G ++ +  +L+  + +  + +P    F A+ I         L  L + L  L+  N + +  YV+ V    CS    Y    +  + S  +      +  + + ++      F   + I+++F     YLL  F  L  +  P       + R Y+  +EY +  +  T   L E R+    P+   W A+ + +   K  EFV    H+S +E+  ++ +
Sbjct:  118 IVFSPYGETVCFSVKPVGRL---------LPYIVSVSRNIVDFKLFLVFVTGIFLFLYAKTLSQSPVFYYSSGTVLGILMTLVFVLLMAKKHIPKYSTFGALMIGCWFASVYVLCQLMEDLKWLWYGNRMYILGYVVVVG--LCSFAACYSHGPLADEGSRDLLMWTLRLFSLALVYTGVAAPQFAYAVLIVLLFSWSLHYLLRAFSYLRWKMRPWFTAEPQVAR-YLTDDEYREQAEAATARALEELRQACCRPDFPSWLAVSRLQAPKKFAEFVLGASHLSPEEVSTHEKQ 398          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Mouse
Match: Nemp1 (nuclear envelope integral membrane protein 1 [Source:MGI Symbol;Acc:MGI:2446113])

HSP 1 Score: 53.1434 bits (126), Expect = 2.858e-7
Identity = 33/126 (26.19%), Postives = 70/126 (55.56%), Query Frame = 2
Query:  443 EKPYRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV---IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYP 811
            +  Y + +  +F+  LF++ ++ + +FF    LS+S +F++S G+ + + ASLL+ +F++S+ +P R   Y I + G S    +   +F    ++W  +   L++   Y+L V  ++ ++ Y Y P
Sbjct:  146 DTTYSVTVTRRFDPKLFLVFLLGLTLFFCGDLLSRSQIFYYSTGMSVGIVASLLIVIFMISKFMPKRSPIYVILVGGWSFSLYLIQLVFKNLQEIWRSYWHYLLS---YILTVGFMSFAVCYKYGP 268          
BLAST of Nuclear envelope integral membrane protein 1 vs. UniProt/SwissProt
Match: sp|Q6ZQE4|NEMP1_MOUSE (Nuclear envelope integral membrane protein 1 OS=Mus musculus OX=10090 GN=Nemp1 PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 1.483e-17
Identity = 64/264 (24.24%), Postives = 143/264 (54.17%), Query Frame = 2
Query:  443 EKPYRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV---IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSM-FILLLGILIVFPLFHP--YLLSPFLALYKRYF-PIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSE 1213
            +  Y + +  +F+  LF++ ++ + +FF    LS+S +F++S G+ + + ASLL+ +F++S+ +P R   Y I + G S    +   +F    ++W  +   L++   Y+L V  ++ ++ Y Y P + N ++ N++ ++++++ + +M+ S+ +  + F L++  L    L +P  +L S +  + K    P+    +  EEY    +  T   L+E R++  SPEC+ WK + + ++  +  +FV+   H++  E+  ++ E
Sbjct:  146 DTTYSVTVTRRFDPKLFLVFLLGLTLFFCGDLLSRSQIFYYSTGMSVGIVASLLIVIFMISKFMPKRSPIYVILVGGWSFSLYLIQLVFKNLQEIWRSYWHYLLS---YILTVGFMSFAVCYKYGPLE-NERSINLLTWTLQLLGLGLMYSSIQIPHVAFALIVIALCTKNLEYPIHWLCSTYRRMCKASGKPVPPRLLTEEEYRIQGEVETQKALQELREFCNSPECSAWKTISRIQSPKRFADFVEGSFHLTPNEVSVHEQE 405          
BLAST of Nuclear envelope integral membrane protein 1 vs. UniProt/SwissProt
Match: sp|Q28EH9|NEMP1_XENTR (Nuclear envelope integral membrane protein 1 OS=Xenopus tropicalis OX=8364 GN=nemp1 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 8.694e-17
Identity = 75/292 (25.68%), Postives = 144/292 (49.32%), Query Frame = 2
Query:  452 YRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV-------IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGIL-----IVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDS---------EDNVVDESSVTDSSIEMN 1264
            Y + +   F+  LF + +  +++FF    LS+S +F++S G+ + + AS+L+ +F+LS+++P +  F A+ + G SV       +F  L  +  + W      L  V F V F  C      Y Y P + N ++ NI+N+++++I +++M+ SV ++ + + ++ I      I +P+   Y+L   + L KR  P     +  EEY K     T   L E R Y  SP+   WK + + ++  +  +FV+   H++  E+  ++          ED +  E S  +  +E+ 
Sbjct:  141 YSVALSRGFDPRLFFVFLCGLLLFFYGDTLSRSQIFYYSTGITVGMLASMLILVFMLSKLMPKKSPFVALLLGGWSVSIYVIQLVFKNLQAICTEYWQYLLGYLGIVGF-VSFAFC------YKYGPLE-NERSINILNWTLQLIGLLLMYISVQIRHIAVTMVVIAFCTKQIEYPVRWIYILYRKIKL-KRGKPSPPRLLTEEEYRKQGDVETRKALEELRGYCSSPDFAAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEHEYGFGGSFLEDELFGEDSDVEEEMEIE 423          
BLAST of Nuclear envelope integral membrane protein 1 vs. UniProt/SwissProt
Match: sp|A1L3G9|NMP1B_XENLA (Nuclear envelope integral membrane protein 1b OS=Xenopus laevis OX=8355 GN=nemp1b PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 7.375e-16
Identity = 74/292 (25.34%), Postives = 144/292 (49.32%), Query Frame = 2
Query:  452 YRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV-------IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGIL-----IVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDS---------EDNVVDESSVTDSSIEMN 1264
            Y + +   F+  LF + +  +++FF    LS+S +F +S G+ + + AS+L+ +F+LS+++P +  F+A+ + G SV       +F  L  +  + W      L  V F V F  C      Y Y P + N ++ NI+N+++++I +++M+ SV ++ + + ++ I      I +P+   Y+L   + L KR  P     +  EEY K     T   L E R+   SP+   WK + + ++  +  +FV+   H++  E+  ++          ED +  E S  +  +E+ 
Sbjct:  141 YSVALSRGFDPRLFFVFLCGLLLFFYGDTLSRSQLFFYSTGITVGMLASMLILVFMLSKLMPKKSPFFALLLGGWSVSIYVIQLVFRNLQAICSEYWQYLIVYLGIVGF-VSFAFC------YIYGPLE-NERSINILNWTLQLIGLLLMYVSVQIQHIAVTIVVIAFCTKQIEYPVQWIYILYRKIKL-KRAKPGPPRLLTEEEYRKQADVETRKALEELRECCSSPDFAAWKTISRIQSPKRFADFVEGSSHLTPNEVSVHEHEYGLGGSFLEDELFGEDSDVEEEMEIE 423          
BLAST of Nuclear envelope integral membrane protein 1 vs. UniProt/SwissProt
Match: sp|O14524|NEMP1_HUMAN (Nuclear envelope integral membrane protein 1 OS=Homo sapiens OX=9606 GN=NEMP1 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 2.364e-15
Identity = 65/278 (23.38%), Postives = 134/278 (48.20%), Query Frame = 2
Query:  443 EKPYRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV---IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEY---------PKILQE---------NTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSE 1213
            +  Y + +  +F+  LF++ ++ +M+FF    LS+S +F++S G+ + + ASLL+ +FILS+ +P +   Y I + G S    +   +F    ++W  + + L++   YVL V  ++ ++ Y Y P + N ++ N            ++ +++ L  +  +  GI I  P     ++   L       PI+ +YI   +          P++L E          T   L E R++  SP+C+ WK + + ++  +  +FV+   H++  E+  ++ E
Sbjct:  148 DTKYSVIVIRRFDPKLFLVFLLGLMLFFCGDLLSRSQIFYYSTGMTVGIVASLLIIIFILSKFMPKKSPIYVILVGGWSFSLYLIQLVFKNLQEIWRCYWQYLLS---YVLTVGFMSFAVCYKYGPLE-NERSIN------------LLTWTLQLMGLCFMYSGIQI--PHIALAIIIIALCTKNLEHPIQWLYITCRKVCKGAEKPVPPRLLTEEEYRIQGEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQE 407          
BLAST of Nuclear envelope integral membrane protein 1 vs. UniProt/SwissProt
Match: sp|A7MBC7|NEMP1_BOVIN (Nuclear envelope integral membrane protein 1 OS=Bos taurus OX=9913 GN=NEMP1 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.979e-15
Identity = 61/270 (22.59%), Postives = 140/270 (51.85%), Query Frame = 2
Query:  443 EKPYRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV---IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIV-----FPLFHPYLLSPFLALYKRYFPIKRIYIPI-----EEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSE 1213
            +  Y + +  +F+  LF+I ++ + +FF    LS+S +F++S G+ + + ASLL+ +FI+S+ +P +   Y I + G S    +   +F    ++W  + + L++   YVL V  ++ ++ Y Y P + N ++ N++ ++++++ +  M+ S+ +  + + ++ I +      +P+   Y+       Y++        +P      EEY    +  T   L + R+Y  SP+C+ WK + + ++  +  +FV+   H++  E+  ++ E
Sbjct:  148 DTKYSVIVTRRFDPKLFLIFLLGLTLFFCGDLLSRSQIFYYSTGMSVGIVASLLIIIFIVSKFMPKKSPIYIILVGGWSFSLYLIQLVFKNLQEIWRCYWQYLLS---YVLAVGFMSFAVCYKYGPLE-NERSINLLTWTLQLLGLCFMYSSIQIPHIALAIVVIALCTKNLDYPIHWLYI------TYRKMCKATEKTVPPRLLTEEEYRLQGEVETRKALEQLREYCNSPDCSAWKTVSRIQSPKRFADFVEGSFHLTPNEVSVHEQE 407          
BLAST of Nuclear envelope integral membrane protein 1 vs. TrEMBL
Match: A0A0P5ZCL7 (Transmembrane protein 194A OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 9.135e-28
Identity = 91/375 (24.27%), Postives = 192/375 (51.20%), Query Frame = 2
Query:  143 NSNLSLLHIFDFQGIDQSLHKSWHFA--FLSIQNLKMGEFKMYYGENDTSVHDLCESTNSNYVFMDTLIYKLKLLIFGPNSKSLNFEFNPFNRLSIGIKPLLEKPYRIKI-YTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSEDNVVDESSVTDSSIE 1258
            N +  LL IF + G  +++   W  A  +L+I++    +F +Y GEN + V  L +S   ++     L +K K           +   +PFN   +G+    + PY +++   + NF   ++    I+IF ++ +L K ++FH++ G ++ +  S+L+ +++ SR++P + G YA+ I GSS++F  +  L + L+ +  +    V  Y+   + ++ +  Y + P   N +T +++ + +++  + +++ S   K   + ++ + +V   F     +    L+ + FP K   +  +EY +  +  T+  L+E R++  SP CN WK + + K+  +  EFV+   H+S++E+ DY++     +E+   D S E
Sbjct:   62 NRSEPLLTIFCWTGDPKTVFGLWKTATVYLTIED---EDFYIYKGENASHVVHLHQSLQQSW--FSFLPWKEK-----------SISVSPFNMSCVGV--FSQSPYSLRLDLRQINFNRLVMFATGILIFMVAPSLCKKVVFHYTTGTLVGVLGSILIIVYLTSRLIPKKSGAYAVLIGGSSIVFYLIRSLWENLYSVLREYHYYVIAYLAASSAISFAFCYRFGP-VTNTRTIHLLQWGLQLCGLYLVFESSEHKEGAMAIILVTVVSHNFPGSWWARCRTLWYQRFPPKVRMLTEDEYVEQTRIETERGLKELREFSKSPNCNAWKTISRLKDPLRFAEFVEGKSHLSDREVLDYETTAYRENETWTDDESDE 417          
BLAST of Nuclear envelope integral membrane protein 1 vs. TrEMBL
Match: E9H727 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_308237 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.338e-25
Identity = 90/370 (24.32%), Postives = 184/370 (49.73%), Query Frame = 2
Query:  158 LLHIFDFQGIDQSLHKSWHFAFLSIQNLKMGEFKMYYGENDTSV---HDLCESTNSNYVFMDTLIYKLKLLIFGPNSKSLNFEFNPFNRLSIGIKPLLEKPYRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSEDNVVDESSVTDSSIE 1258
            LL IF + G  +++   W  A + +  +K   F +Y G+N + V   H+L + +     +   L +K K           +   +PFN    G+    E   R+ +  + NF   ++ +  I++F ++  L K ++FH++ G ++ +  S+L+ +++ SRI+P + G YA+ I GSS++F  +  L + ++ +  +    V  Y+   + ++ +  Y + P   N +T N++ +S+++  + +++ S   K   + ++ + IV   F     +    L+ + FP     +  +EY    +  T+  L+E R++  SP+CN WK M + K+  +  EFV+   H+S++E+ DY++      E+   D S E
Sbjct:   61 LLTIFCWPGDPKTVFGLWKTATVYL-TIKDDNFNIYKGDNASHVVHLHELLQQS-----WFSFLPWKEK-----------SISVSPFNMSCTGVFSKTEFLLRLDV-RQINFNRLLMFIAGILLFSVAPTLCKKVIFHYTTGTLVGVLGSILIIVYLTSRIIPKKSGAYAVLIGGSSIVFYLIRSLWENMYSVLREYHYYVIAYLAASSVISFAFCYRFGP-VTNTRTINLLQWSLQLCGLYLVFESSEHKEGAMAIILVTIVSHNFPGAWWARCQTLWFKRFPPTVRLLTEDEYVDQTRIETERGLKELREFSKSPQCNAWKTMNRLKDPLRFAEFVEGKSHLSDREVLDYETTAYRESETWTDDESDE 411          
BLAST of Nuclear envelope integral membrane protein 1 vs. TrEMBL
Match: R7UPC7 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_178472 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 5.105e-25
Identity = 100/376 (26.60%), Postives = 181/376 (48.14%), Query Frame = 2
Query:  104 VHHNFSHGFDKIINSNLSLLHIFDFQGIDQ-SLHKSWHFAFLSIQNLKMGEFKMYYGENDTSVHDLCESTNSNYVFMDTLIYKLKLLIFGPNSKSLNFEFNPFNRLSIGIKPLLEKPYRIKIYTKFNFTLFIITVISIMIFFM-SKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPY------LLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYD 1207
            V H +++G D           IF  +G+    L   W    L I  +   ++ +Y G N+T V    + T  N++          L+ +    KS     +PFN+  IGI    +  Y +++  K     F++ +I  +I FM +K LS +I+F +  G+   L ASLL+ +FI+SR +P + G Y I +AG S+    L H+ + +  + E   V V+ Y      ++ ++ YY  P   N +  N+I + I+ I +++++    +  + + ++ I+++  L          ++S   + ++R FP K   +  +EY +  Q  T   L E R+Y  SPECN WK + +  +  +   FV+   H+S++E+ DYD
Sbjct:   53 VPHKYTNGLD-----------IFCLKGLRHPDLKALWTSVTLRI-FIANDKYSIYKGPNETCVFSDYKETLGNWL--------QHLMPW----KSEYVSLSPFNQTCIGIS--TQHKYSVRLQKKVLDPWFLVFLIGGIILFMTAKKLSSNILFFYGTGISFGLLASLLILVFIISRFIPQKTGAYTILLAGWSIAIYLLHHILENVQTVLENYYVYVASYFCVAGLVSWAVCYYKGPPS-NPRALNLIQWLIQAIGLVLIYSGTQIPEVSVTIIIIVVLNNLLSGRFSVSENMISRIKSFWRRKFPPKVKLLTADEYERQAQVETQKALDELRQYCRSPECNAWKTISRMHSPSRFANFVEGESHLSDEEVYDYD 401          
BLAST of Nuclear envelope integral membrane protein 1 vs. TrEMBL
Match: A0A1D1UNK0 (Uncharacterized protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_03578-1 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 8.196e-25
Identity = 90/366 (24.59%), Postives = 184/366 (50.27%), Query Frame = 2
Query:  134 KIINSNLSLLHIFDFQGIDQSLHKSWHFAFLSIQNLKMGEFKMYYGENDTSVHDLCESTNSNYVFMDTLIYKLKLLIFGPNSKSLNFEFNPFNRLSIGIKPLLEKPYRIKIYTK-FNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVT----VSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLF-HPYLLSPFLALYKRYFPIK--RIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYD 1207
            ++  S    L  F + G  + + ++W+ AF  + N+    F +Y G     V    +S++  +     L ++ K++           + N F+   +G+     K Y + +  K  ++      V+ +++   ++ +S+   FH+  GV I+L  SLL+ +F++SR++P R    +  + G +V+  Y F     LW  F + L+     V  YV  V+ LTC ++Y +   Q N +T +I+ + ++I+   +++FS +++++ I+L+ ++I   +F H        AL  + FP K  R+  P +E+ ++ +  T+  L++ R+Y  SPEC  WK +++     + + FV+ G H++  E+E Y+
Sbjct:   62 QVEASRSKALKTFCWPGFRKDIRRTWYTAFF-LLNITDDSFHLYKGTTTEEVQYQFKSSSRFFA----LPWREKVI-----------KLNGFSPTCLGV--YTNKAYSVTLQLKHLDYVRLAAFVVGVLLILFARRMSRDTYFHYGSGVGIALVGSLLVLIFLISRMIPRRAAGVSFLVGGWAVVL-YFFQT---LWKNFRETLLQHRQYVLVYVATVSVLTCLLVYRFGGVQ-NRRTMDILQWGLQILGAALIYFSCTIEAVGIILVVLIIALDMFLHSGYNFRRYALLNKLFPPKPPRLLTP-QEFEEVGRRETEKALQQLRQYCNSPECKQWKLVKKLNTPSRFSSFVEDGFHLTSDEVEAYE 403          
BLAST of Nuclear envelope integral membrane protein 1 vs. TrEMBL
Match: A0A0K8UH58 (Transmembrane protein 194A OS=Bactrocera latifrons OX=174628 GN=tmem194a PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 9.047e-25
Identity = 100/354 (28.25%), Postives = 168/354 (47.46%), Query Frame = 2
Query:  200 HKSWHFAFLSIQ---NLKMGEFKMYYGENDTSVHDLCESTNSNYVFMDTLIYKLKLLIFGPNSKSLNFEFNPFNRLSIGIKPLLEKPYRIKIYT-KFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSEDNVVDESSVTDS 1249
             K W   F +I+    ++  EFK Y G   + V    E   S + F           +F      LN    PF +  IGI   L  PYR++++  + ++  FI   ++I +F  + +LS + +  +  GV I + +S +L +++ S+++P R   Y I I G S+ F  +  L D L ++F+     V  Y+ F T +      Y      N ++ NII ++++I+A IM +FS+  +   +L+L  +I        LL   L +Y+  FP KR ++  EE+ +     T   L E R Y  SP+C  WK + +  +  +   FV+   H+ E+EI  Y++   V  E S TDS
Sbjct:   65 RKDWTHIFENIELQLEIEKDEFKQYEGATPSEVRQNFEDRQSLFSFN----------LFSNKRTRLNL--YPFKQQCIGIDTTL--PYRVRLHQLRIDYFRFIQFSVAICLFIFAGSLSNNSILFYLTGVTIGIGSSFMLIIWLTSKLMPRRPMVYTILIGGWSIGFYIIQRLWDNLHLIFQMYRAYVLCYI-FTTGIISFFFCYRIGPPTNQRSKNIIKWALQIMATIMAYFSIQYEEASVLILAAIIFLNYLPSSLLYKPLKIYRWLFPPKRRFLTNEEFYEEGIRETSKALSELRAYASSPDCKQWKIISKLSDPLRFAAFVEGQSHLREEEILRYENH-TVAIEHSETDS 402          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Cavefish
Match: nemp1 (nuclear envelope integral membrane protein 1-like [Source:NCBI gene;Acc:103029128])

HSP 1 Score: 79.337 bits (194), Expect = 1.093e-15
Identity = 65/259 (25.10%), Postives = 121/259 (46.72%), Query Frame = 2
Query:  452 YRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLK-DQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYP----DQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSE 1213
            Y +K   K++  LF++ +  +++FF +  LS+S +F++S G+   L ASL++ +F+L R +P +  FY + + G S    YL  L    L V+ +++      YV  V  ++ ++ Y + P      IN  +  +  F + +I   +    V+L  M        + +P+     L   L    R  P  R  +  +EY +  +E T   L E RKY  +P+ N  K +   ++  +  +FV+   H+   E+  +  E
Sbjct:  145 YTVKPSRKYDIFLFLVFIAGVLLFFFADTLSRSQLFYYSAGMSTGLIASLIILIFVLGRFLPKKSSFYVLIVGGWSFAL-YLIQLVFKNLQVILKEHWHLAIAYVAVVGFVSFAVCYRHGPLVEERSINILSWTLQLFGMLLIYAGIQVQQVALAIMVAAFCSKNLEYPVTMAITLYQKLKPKPRCRPAPRRQLTKKEYYQQAEEETAKALEELRKYCSNPDFNTLKTVCGLQSPKRFADFVEGSSHLISNEVSLHAQE 402          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Cavefish
Match: nemp2 (nuclear envelope integral membrane protein 2-like [Source:NCBI gene;Acc:111194874])

HSP 1 Score: 68.5514 bits (166), Expect = 3.746e-12
Identity = 69/302 (22.85%), Postives = 140/302 (46.36%), Query Frame = 2
Query:  434 PLLEKPYRIKIYT-KFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIF---SYLFHLKDQLWVLFEKNLVT---VSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILI---VFPLFHP----------YLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDY-------DSEDNVVDESSVTDSSIE 1258
            P     Y + +Y  +FN+  F++ V  +M+F+ +  + +S +F +  G+ + +A+ L+  + +L   VP R  F  +  AGS + +     L +  +++  L+ K L+    +S ++ FV C       Y      N +T N++ + ++ +A ++    V+   +  +LL  L+   V PL             +LLS    L  R  P  R+ +  EEY +  + +T   L E RKY  +P    W  + + +   +  EF+ +G H++  E + +       D E++V  +++ + ++ E
Sbjct:  131 PRASAEYNLYVYNQRFNWMRFLLFVSGLMLFYFAGAICRSSLFFYISGISLGMASILVFLLLVLKNFVPKRGLFLVLFGAGSGLSYLGIQKLMNNGEEIMKLYWKELLGYLLLSGFISFVFC-------YKLGPITNKRTLNLMTWLLQAVAGVVACHGVTYGPISWMLLATLLSFKVLPLVLAILVGIWRQTCWLLSALGLLRSRKRPKTRL-LTEEEYREQGERHTKASLEELRKYCNNPGFPAWDTVLKLRYPQRFAEFLRNGSHVTASETQSHAQYGLRADYEEDVFLDTTKSSATSE 424          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Cavefish
Match: nemp1 (nuclear envelope integral membrane protein 1-like [Source:NCBI gene;Acc:103029128])

HSP 1 Score: 56.9954 bits (136), Expect = 1.781e-8
Identity = 35/121 (28.93%), Postives = 67/121 (55.37%), Query Frame = 2
Query:  452 YRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLK-DQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYP 811
            Y +K   K++  LF++ +  +++FF +  LS+S +F++S G+   L ASL++ +F+L R +P +  FY + + G S    YL  L    L V+ +++      YV  V  ++ ++ Y + P
Sbjct:  145 YTVKPSRKYDIFLFLVFIAGVLLFFFADTLSRSQLFYYSAGMSTGLIASLIILIFVLGRFLPKKSSFYVLIVGGWSFAL-YLIQLVFKNLQVILKEHWHLAIAYVAVVGFVSFAVCYRHGP 264          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Sea Lamprey
Match: nemp1 (nuclear envelope integral membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-090313-182])

HSP 1 Score: 78.9518 bits (193), Expect = 1.490e-16
Identity = 66/262 (25.19%), Postives = 134/262 (51.15%), Query Frame = 2
Query:  452 YRIK-IYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLAL-----YKRYF--PIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSE 1213
            Y +K I T F++ L  I +  +++FF ++NLS+S  F +S GV++ + ASLL+ +F++ R +P R   YAI + G S     +      L  L   + + V+ Y+  V  ++ ++ Y   P   N ++ +I+ ++++++A++ ++    + ++   ++ + I   L H Y +S    +     YK  F  P +   +  EEY +  +  T   L   R+   SP+ + WKA+ Q  +  +  +FV+   H+S +E+  +  +
Sbjct:   32 YEVKVIRTAFSWRLIGILLFGMILFFYAENLSRSATFFYSSGVLLGIVASLLIIIFVVGRFLPKRSSVYAIMVGGWSAALFAMQWTYRHLGELLADHKMYVAGYLATVGFVSFAVCYRLGP-VTNERSLHIMTWTLQLLALLFIYNGTQISTISFAMVLVAIAMRLLH-YPVSAVTWVCRKVGYKTPFKHPPEVRLLTEEEYQQQGEVETRRALENLRELCHSPDFHAWKAVMQLNSPRRFADFVEGSPHLSPQEMSLHSQQ 291          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Nematostella
Match: EDO48896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHQ7])

HSP 1 Score: 63.929 bits (154), Expect = 3.530e-11
Identity = 84/381 (22.05%), Postives = 188/381 (49.34%), Query Frame = 2
Query:  176 FQGIDQ-SLHKSWHFAFLSIQNLKMGEFKMYYGENDTSVHD-----LCESTNSNYVFMDTLI-YKLKLLIFGPNSKSLNF-EFNPFNRLSIGIKPLLEKPYRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSV-IFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGI-LIVFPLFHPYLLSPFLA-LYKRYFPIKRIYIPIEEYPKILQEN---------TDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDS-------EDNVVDESS 1237
            F G +Q SL+  W    ++++  ++   +++Y ++  ++++     L     S +  +D L   ++ L  FG +  +L+F E      L + +KP+             ++   ++ ++ +++F+ + +LS+S+ F++  G+++ +  SLLL +F+L R++P + G Y +   G S+ +F   +   + + ++ ++N+  ++++   +  L    + YY     N +  ++I ++I+ IA+ +M+  +  +S+ + +L I L+ F L +  L+   +  L K   P +  Y+      ++L E+         T   L+E R+Y  SP+C  WK + +  +  +L +FV  G HIS+ E   Y+        ED   D+ +
Sbjct:   61 FLGFEQVSLYHIWSSVSITLREEEIEGSQIHYSDSCEALYEAKDPALARRMLSWFADLDALTTQQINLSPFGNSCFALHFPERQLLLHLKVQLKPI-------------HWHYPLVFIVGLILFWEADSLSRSVTFYYGSGIVLGVVVSLLLAVFLLHRLIPSKSGAYMLLAGGWSISLFVLQWTWNNLVDLVLDRNVFVITYFT--IAGLVSFGLCYYNGPVSNQRGLDLIRWTIQFIAVYLMYKGIQPESLSLAVLIIALLTFFLRNVNLMQKAINILPKDCVPWRVRYMLFPPDLRLLSEHEFELQGEMETRRALQELREYCNSPDCQAWKVLSRVHDPRRLAKFVTDGDHISDDEYRAYEDGAYTYPVEDPFTDDEA 426          
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Medaka
Match: nemp1 (nuclear envelope integral membrane protein 1 [Source:NCBI gene;Acc:101173940])

HSP 1 Score: 65.4698 bits (158), Expect = 3.604e-11
Identity = 70/284 (24.65%), Postives = 142/284 (50.00%), Query Frame = 2
Query:  410 NRLSIGIKPLLEKPYRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTV-------SFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSL-KSMFILLLGILIVFPLFHPYLLSPFLALYKR--------YFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSE 1213
             ++   + P    PY +K   +F+  LF++ +  +++F  + +LS+S +F +S G+   + ASL++  FIL+R +P +  FY + + G S  FS L+ ++     L  +NL T+           + V    C  + Y Y   ++ K+ NI+++++++I +++++  + L +  F +++  L+   L +P  L+     + R        + P  R  +  EEY +  +E T   L E RKY  SPE + WK + + ++  +  +FV+   H+   E+  +  E
Sbjct:  129 KKICFKVDPSENTPYTVKPTRRFDIYLFLVFLCGVLLFVFADSLSRSQVFFYSAGMSTGMFASLIVLFFILARFLPKKSPFYILIVGGWS--FS-LYAIQ-----LVCRNLSTILREHWHLVLGYVVVVGFICFAVCYRYGPLVDDKSINILSWTLQLIGLLLIYLGIQLYQVAFAIIVAALLAKNLEYPVSLAVAAWSFVRRKIKGRFYWKPQPRRLLTEEEYQREGEEETRLALEELRKYCNSPEFSPWKTVSRLQSPKRFADFVEGSPHLMSNEVSVHAQE 404          
BLAST of Nuclear envelope integral membrane protein 1 vs. Planmine SMEST
Match: SMESG000002297.1 (SMESG000002297.1)

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 403/410 (98.29%), Postives = 406/410 (99.02%), Query Frame = 2
Query:   35 MLYTRLLIVVMAHISAVSSNCEFVHHNFSHGFDKIINSNLSLLHIFDFQGIDQSLHKSWHFAFLSIQNLKMGEFKMYYGENDTSVHDLCESTNSNYVFMDTLIYKLKLLIFGPNSKSLNFEFNPFNRLSIGIKPLLEKPYRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLTCSMMYYYYPDQINYKTSNXXXXXXXXXXXXMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSEDNVVDESSVTDSSIEMN 1264
            MLYTRLLIVV+  ISAVSSNCEFVHHNFSHGFDKIINSNLSLLHIFDFQGIDQSLHKSWHFAFLSIQNLKMGEFKMYYGENDTSVHDLCESTNSNYVFMDTLIYKLKLLIFGPNSKSLNFEFNPFNRLSIGIKPLLEKPYRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRK FYAIGIAGSSVIFSYLFHLKDQLWVLFE NL+T+SFYVLFVTCLTCSMMYYYYPDQINYKTSNIINFSIKIIAIIMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSEDNVVDESSVTDSSIEMN
Sbjct:    1 MLYTRLLIVVLTLISAVSSNCEFVHHNFSHGFDKIINSNLSLLHIFDFQGIDQSLHKSWHFAFLSIQNLKMGEFKMYYGENDTSVHDLCESTNSNYVFMDTLIYKLKLLIFGPNSKSLNFEFNPFNRLSIGIKPLLEKPYRIKIYTKFNFTLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIVPFRKSFYAIGIAGSSVIFSYLFHLKDQLWVLFETNLITISFYVLFVTCLTCSMMYYYYPDQINYKTSNIINFSIKIIAIIMMWFSVSLKSMFILLLGILIVFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRKYLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSEDNVVDESSVTDSSIEMN 410          
The following BLAST results are available for this feature:
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NEMP14.924e-1623.38nuclear envelope integral membrane protein 1 [Sour... [more]
NEMP21.676e-1021.35nuclear envelope integral membrane protein 2 [Sour... [more]
NEMP12.011e-1022.61nuclear envelope integral membrane protein 1 [Sour... [more]
back to top
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nemp-13.124e-1924.36Nuclear Envelope integral Membrane Protein homolog... [more]
nemp-13.124e-1924.36Nuclear Envelope integral Membrane Protein homolog... [more]
back to top
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG97235.899e-2325.87gene:FBgn0030768 transcript:FBtr0074376[more]
back to top
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nemp12.704e-1523.64nuclear envelope integral membrane protein 1 [Sour... [more]
nemp29.669e-1321.86nuclear envelope integral membrane protein 2 [Sour... [more]
back to top
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nemp11.771e-1725.68nuclear envelope integral membrane protein 1 [Sour... [more]
nemp11.918e-1725.68nuclear envelope integral membrane protein 1 [Sour... [more]
nemp12.029e-1725.68nuclear envelope integral membrane protein 1 [Sour... [more]
nemp11.014e-1326.67nuclear envelope integral membrane protein 1 [Sour... [more]
back to top
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nemp11.359e-1824.24nuclear envelope integral membrane protein 1 [Sour... [more]
Nemp12.121e-1824.24nuclear envelope integral membrane protein 1 [Sour... [more]
Nemp25.583e-1222.18nuclear envelope integral membrane protein 2 [Sour... [more]
Nemp12.858e-726.19nuclear envelope integral membrane protein 1 [Sour... [more]
back to top
BLAST of Nuclear envelope integral membrane protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZQE4|NEMP1_MOUSE1.483e-1724.24Nuclear envelope integral membrane protein 1 OS=Mu... [more]
sp|Q28EH9|NEMP1_XENTR8.694e-1725.68Nuclear envelope integral membrane protein 1 OS=Xe... [more]
sp|A1L3G9|NMP1B_XENLA7.375e-1625.34Nuclear envelope integral membrane protein 1b OS=X... [more]
sp|O14524|NEMP1_HUMAN2.364e-1523.38Nuclear envelope integral membrane protein 1 OS=Ho... [more]
sp|A7MBC7|NEMP1_BOVIN2.979e-1522.59Nuclear envelope integral membrane protein 1 OS=Bo... [more]
back to top
BLAST of Nuclear envelope integral membrane protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0P5ZCL79.135e-2824.27Transmembrane protein 194A OS=Daphnia magna OX=355... [more]
E9H7272.338e-2524.32Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
R7UPC75.105e-2526.60Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1D1UNK08.196e-2524.59Uncharacterized protein OS=Ramazzottius varieornat... [more]
A0A0K8UH589.047e-2528.25Transmembrane protein 194A OS=Bactrocera latifrons... [more]
back to top
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nemp11.093e-1525.10nuclear envelope integral membrane protein 1-like ... [more]
nemp23.746e-1222.85nuclear envelope integral membrane protein 2-like ... [more]
nemp11.781e-828.93nuclear envelope integral membrane protein 1-like ... [more]
back to top
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nemp11.490e-1625.19nuclear envelope integral membrane protein 1 [Sour... [more]
back to top
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO488963.530e-1122.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear envelope integral membrane protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nemp13.604e-1124.65nuclear envelope integral membrane protein 1 [Sour... [more]
back to top
BLAST of Nuclear envelope integral membrane protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000002297.10.000e+098.29SMESG000002297.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035387 ID=SMED30035387|Name=Nuclear envelope integral membrane protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1291bp
AAATTTAAATATTGTATGAATTTATATTTTTACTATGCTTTATACTAGAC
TTTTAATTGTGGTTATGGCACATATTTCAGCCGTAAGTAGTAATTGTGAA
TTTGTACATCATAATTTCAGTCATGGATTTGATAAAATAATCAATTCTAA
TCTCAGCTTGCTGCATATTTTTGATTTCCAAGGAATAGATCAATCGCTTC
ATAAGTCTTGGCATTTTGCTTTTTTGAGTATTCAGAATTTGAAGATGGGT
GAATTCAAAATGTATTATGGTGAAAATGATACAAGTGTTCATGATTTATG
TGAGTCAACTAATTCAAACTATGTATTTATGGATACTTTAATTTATAAGT
TAAAATTGCTAATTTTTGGGCCGAATTCAAAAAGTTTGAATTTTGAATTT
AATCCGTTTAATAGACTTTCAATCGGAATAAAACCATTATTGGAAAAGCC
CTACCGGATAAAAATTTATACTAAGTTCAATTTTACTCTTTTTATTATTA
CTGTTATCTCGATCATGATATTTTTTATGTCTAAAAATTTATCAAAAAGT
ATAATGTTTCATTTTTCATGCGGTGTGATTATTAGTTTAGCTGCTTCATT
GCTTCTATTTATGTTCATCCTATCAAGAATTGTACCTTTTAGAAAAGGTT
TTTATGCTATTGGCATTGCCGGTAGTTCGGTAATTTTTTCATATTTGTTT
CACCTTAAAGATCAACTTTGGGTGCTTTTTGAAAAAAATTTAGTTACAGT
TTCTTTCTATGTATTATTTGTTACATGCTTAACTTGTTCGATGATGTATT
ATTATTATCCTGATCAAATTAATTATAAAACTTCAAATATCATTAATTTT
TCTATTAAAATTATAGCAATTATCATGATGTGGTTTTCTGTTTCACTGAA
AAGCATGTTTATTTTGTTATTGGGAATTTTAATCGTTTTCCCATTATTCC
ATCCTTATTTACTATCGCCTTTTTTGGCATTATATAAAAGATATTTCCCA
ATCAAGCGAATTTATATTCCGATTGAAGAATATCCAAAAATTTTGCAAGA
AAACACTGATAATGAATTGAGGGAATTTAGAAAGTACTTACTTAGTCCTG
AATGTAATGTTTGGAAAGCAATGAGGCAATGTAAGAACATTGATAAGTTA
ACTGAATTTGTTGATTCAGGGAGACACATTTCTGAGAAAGAAATTGAAGA
TTATGATTCAGAGGATAATGTGGTGGACGAATCAAGTGTTACAGATTCAA
GTATAGAAATGAATTGATAAGTGTATTAAATAAAATTTTGT
back to top

protein sequence of SMED30035387-orf-1

>SMED30035387-orf-1 ID=SMED30035387-orf-1|Name=SMED30035387-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=411bp
MLYTRLLIVVMAHISAVSSNCEFVHHNFSHGFDKIINSNLSLLHIFDFQG
IDQSLHKSWHFAFLSIQNLKMGEFKMYYGENDTSVHDLCESTNSNYVFMD
TLIYKLKLLIFGPNSKSLNFEFNPFNRLSIGIKPLLEKPYRIKIYTKFNF
TLFIITVISIMIFFMSKNLSKSIMFHFSCGVIISLAASLLLFMFILSRIV
PFRKGFYAIGIAGSSVIFSYLFHLKDQLWVLFEKNLVTVSFYVLFVTCLT
CSMMYYYYPDQINYKTSNIINFSIKIIAIIMMWFSVSLKSMFILLLGILI
VFPLFHPYLLSPFLALYKRYFPIKRIYIPIEEYPKILQENTDNELREFRK
YLLSPECNVWKAMRQCKNIDKLTEFVDSGRHISEKEIEDYDSEDNVVDES
SVTDSSIEMN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR019358NEMP_fam
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019358NEMP familyPFAMPF10225NEMPcoord: 143..383
e-value: 7.8E-30
score: 104.3
IPR019358NEMP familyPANTHERPTHR13598UNCHARACTERIZEDcoord: 5..406
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 389..410
NoneNo IPR availablePANTHERPTHR13598:SF1AT07567Pcoord: 5..406
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.802
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
NoneNo IPR availableTMHMMTMhelixcoord: 205..224
NoneNo IPR availableTMHMMTMhelixcoord: 144..166
NoneNo IPR availableTMHMMTMhelixcoord: 268..287
NoneNo IPR availableTMHMMTMhelixcoord: 173..195
NoneNo IPR availableTMHMMTMhelixcoord: 294..316