Tyrosine-kinase Fes Fps-like isoform X5

Overview
NameTyrosine-kinase Fes Fps-like isoform X5
Smed IDSMED30035381
Length (bp)3201
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-kinase Fes Fps-like isoform X5 (SMED30035381) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-kinase Fes Fps-like isoform X5 (SMED30035381) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-kinase Fes Fps-like isoform X5 (SMED30035381) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-kinase Fes Fps-like isoform X5 (SMED30035381) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035381

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035381h1SMcG0000773 dd_Smed_v4_14652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035381h1SMcG0000773 dd_Smed_v6_14652_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30035381h1SMcG0000773 dd_Smed_v4_14652_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Human
Match: STAC2 (SH3 and cysteine rich domain 2 [Source:HGNC Symbol;Acc:HGNC:23990])

HSP 1 Score: 83.9593 bits (206), Expect = 3.280e-16
Identity = 42/116 (36.21%), Postives = 67/116 (57.76%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTG-SQDGDQILIRTKINTTFWCPIDCVTKV 3134
            YVALY F  ++ ++L L+ G ++  +D S+ DWW GK   + G+FPAN+VQ +  GE+VWR  +  S  +  Q  + L +NQI V  G S+D D  +  +        P+D +T++
Sbjct:  297 YVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFS-GNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPVDALTEI 411          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Human
Match: STAC3 (SH3 and cysteine rich domain 3 [Source:HGNC Symbol;Acc:HGNC:28423])

HSP 1 Score: 78.1814 bits (191), Expect = 7.458e-16
Identity = 40/115 (34.78%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKV 3134
            +VALY F   +KD+L+   G K++ ID S+ +WW GK   K G+FP N++  +  GE V RV R   V +     + L K+QI+VQ G + G  + + T      + P D + ++
Sbjct:   66 FVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFIIRVRAGERVHRVTRSF-VGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLF-PTDFLEEI 178          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Human
Match: STAC3 (SH3 and cysteine rich domain 3 [Source:HGNC Symbol;Acc:HGNC:28423])

HSP 1 Score: 77.7962 bits (190), Expect = 2.047e-14
Identity = 40/115 (34.78%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKV 3134
            +VALY F   +KD+L+   G K++ ID S+ +WW GK   K G+FP N++  +  GE V RV R   V +     + L K+QI+VQ G + G  + + T      + P D + ++
Sbjct:  252 FVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFIIRVRAGERVHRVTRSF-VGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLF-PTDFLEEI 364          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Human
Match: STAC3 (SH3 and cysteine rich domain 3 [Source:HGNC Symbol;Acc:HGNC:28423])

HSP 1 Score: 76.6406 bits (187), Expect = 3.227e-14
Identity = 38/99 (38.38%), Postives = 57/99 (57.58%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRT 3086
            +VALY F   +KD+L+   G K++ ID S+ +WW GK   K G+FP N++  +  GE V RV R   V +     + L K+QI+VQ G + G  + + T
Sbjct:  213 FVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFIIRVRAGERVHRVTRSF-VGNREIGQITLKKDQIVVQKGDEAGGYVKVYT 310          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Human
Match: STAC (SH3 and cysteine rich domain [Source:HGNC Symbol;Acc:HGNC:11353])

HSP 1 Score: 75.8702 bits (185), Expect = 6.281e-14
Identity = 37/98 (37.76%), Postives = 59/98 (60.20%), Query Frame = 3
Query: 2775 LRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQT-GSQDG 3065
            L+ N YVALY F  ++ ++L +R G  ++ ++ S+ DWW GK   + G+FPAN+VQ + Q E ++R +R   +    Q  + L +NQI V +   QDG
Sbjct:  224 LQMNTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLQQNEKIFRCVRTF-IGCKEQGQITLKENQICVSSEEEQDG 320          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Celegans
Match: itsn-1 (ITSN (Intersectin) family [Source:UniProtKB/TrEMBL;Acc:E6N0W1])

HSP 1 Score: 54.6842 bits (130), Expect = 3.822e-7
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = 3
Query: 2787 LYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQ 2942
            LY  +YDF   +  +L L  G  +  ++ +D +WW G+CNG+ G FPANYV+
Sbjct:  628 LYTVIYDFEAVETTDLALHVGDTILVLEKND-EWWKGRCNGREGIFPANYVE 678          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Celegans
Match: itsn-1 (ITSN (Intersectin) family [Source:UniProtKB/TrEMBL;Acc:E6N0W1])

HSP 1 Score: 54.6842 bits (130), Expect = 3.918e-7
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = 3
Query: 2787 LYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQ 2942
            LY  +YDF   +  +L L  G  +  ++ +D +WW G+CNG+ G FPANYV+
Sbjct:  626 LYTVIYDFEAVETTDLALHVGDTILVLEKND-EWWKGRCNGREGIFPANYVE 676          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Celegans
Match: itsn-1 (ITSN (Intersectin) family [Source:UniProtKB/TrEMBL;Acc:E6N0W1])

HSP 1 Score: 54.299 bits (129), Expect = 4.993e-7
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = 3
Query: 2787 LYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQ 2942
            LY  +YDF   +  +L L  G  +  ++ +D +WW G+CNG+ G FPANYV+
Sbjct:  888 LYTVIYDFEAVETTDLALHVGDTILVLEKND-EWWKGRCNGREGIFPANYVE 938          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Celegans
Match: itsn-1 (ITSN (Intersectin) family [Source:UniProtKB/TrEMBL;Acc:E6N0W1])

HSP 1 Score: 54.299 bits (129), Expect = 5.033e-7
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = 3
Query: 2787 LYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQ 2942
            LY  +YDF   +  +L L  G  +  ++ +D +WW G+CNG+ G FPANYV+
Sbjct:  886 LYTVIYDFEAVETTDLALHVGDTILVLEKND-EWWKGRCNGREGIFPANYVE 936          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Celegans
Match: itsn-1 (ITSN (Intersectin) family [Source:UniProtKB/TrEMBL;Acc:E6N0W1])

HSP 1 Score: 53.5286 bits (127), Expect = 8.294e-7
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = 3
Query: 2787 LYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQ 2942
            LY  +YDF   +  +L L  G  +  ++ +D +WW G+CNG+ G FPANYV+
Sbjct:  433 LYTVIYDFEAVETTDLALHVGDTILVLEKND-EWWKGRCNGREGIFPANYVE 483          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Fly
Match: Stacl (gene:FBgn0263980 transcript:FBtr0344200)

HSP 1 Score: 106.301 bits (264), Expect = 2.416e-23
Identity = 113/453 (24.94%), Postives = 189/453 (41.72%), Query Frame = 3
Query:  288 ASYHGAI----HQKMQESMNIIDNVN-QLLKEVSETYETFCDSLSLICTKFSKSL--TSSNYSSDFLDL--------------WNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQYQLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQREIIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINFVRQLNTNQAVSYWRREQFLPPDGDCPEILA---------RDDVISDKLTVEPLQHIRSGLLKEQNELLSFISQNGDVISTLKGLKTNGFSYSRSFEKLYELDDDICRKQNEVRMAQVQVAGVIAQ----------LQHIDNKKFSGFALKDEEDTGMKRIWKKAVFSLK-RDKGSKNQSILKNIKKESFRPASSPLQ 1523
            ASY+G +    H  + E+    +NVN +L+K VS+    F ++LS +  + + +L    SNY     +L              W   LQ   +++Q  ++        V  P+   S H+  Q  K++  R S E ++    + + +   DY   +   R+      +   ++AHN YV QL A+N M + YH+  LP  + ELE I  +++ I   SL   +   A K        + + +   ++SP   ++NFVR L          R  F  P  +  E            R++++ D+ +    +     L +E  EL   I Q  D I  L   +T G    + + K+ EL +D+  K+ ++R  Q+ +A + AQ              + +KFS           MK  W KA  SLK    GS  Q+  +N    +   AS PL+
Sbjct:    2 ASYNGVLKDYSHSSLNEAFKSQNNVNFKLIKTVSD----FSETLSRLYEEHATALQVAVSNYRKKNAELRKERPACHLAIFQAWETFLQEVETDSQACNDVASVLSRQVSRPMLDKSFHRKVQSRKIFTHRESFETIIAKTEEKLSKCRVDYKQCHLAHRQNPSQHSLTEYIDAHNAYVQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQGAEVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQPSQAQKIPRRLFASPQAEVGEEAGDHNEMTPCLRNELVFDRHSTLSQRSALESLKREAIELELQIRQLQDSIEALNRTQTRGIE-GQLYNKVNELQEDLSMKKFDLRAKQIHLAAIRAQKDLFVSKVEPTSPRNERKFSAATA-----PSMKTKWLKAFKSLKPAGSGSAQQADRRNGASST---ASEPLR 441          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Fly
Match: Stacl (gene:FBgn0263980 transcript:FBtr0344202)

HSP 1 Score: 106.686 bits (265), Expect = 5.718e-23
Identity = 113/453 (24.94%), Postives = 189/453 (41.72%), Query Frame = 3
Query:  288 ASYHGAI----HQKMQESMNIIDNVN-QLLKEVSETYETFCDSLSLICTKFSKSL--TSSNYSSDFLDL--------------WNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQYQLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQREIIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINFVRQLNTNQAVSYWRREQFLPPDGDCPEILA---------RDDVISDKLTVEPLQHIRSGLLKEQNELLSFISQNGDVISTLKGLKTNGFSYSRSFEKLYELDDDICRKQNEVRMAQVQVAGVIAQ----------LQHIDNKKFSGFALKDEEDTGMKRIWKKAVFSLK-RDKGSKNQSILKNIKKESFRPASSPLQ 1523
            ASY+G +    H  + E+    +NVN +L+K VS+    F ++LS +  + + +L    SNY     +L              W   LQ   +++Q  ++        V  P+   S H+  Q  K++  R S E ++    + + +   DY   +   R+      +   ++AHN YV QL A+N M + YH+  LP  + ELE I  +++ I   SL   +   A K        + + +   ++SP   ++NFVR L          R  F  P  +  E            R++++ D+ +    +     L +E  EL   I Q  D I  L   +T G    + + K+ EL +D+  K+ ++R  Q+ +A + AQ              + +KFS           MK  W KA  SLK    GS  Q+  +N    +   AS PL+
Sbjct:  262 ASYNGVLKDYSHSSLNEAFKSQNNVNFKLIKTVSD----FSETLSRLYEEHATALQVAVSNYRKKNAELRKERPACHLAIFQAWETFLQEVETDSQACNDVASVLSRQVSRPMLDKSFHRKVQSRKIFTHRESFETIIAKTEEKLSKCRVDYKQCHLAHRQNPSQHSLTEYIDAHNAYVQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQGAEVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQPSQAQKIPRRLFASPQAEVGEEAGDHNEMTPCLRNELVFDRHSTLSQRSALESLKREAIELELQIRQLQDSIEALNRTQTRGIE-GQLYNKVNELQEDLSMKKFDLRAKQIHLAAIRAQKDLFVSKVEPTSPRNERKFSAATAPS-----MKTKWLKAFKSLKPAGSGSAQQADRRNGASST---ASEPLR 701          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Fly
Match: Stacl (gene:FBgn0263980 transcript:FBtr0475071)

HSP 1 Score: 106.301 bits (264), Expect = 6.659e-23
Identity = 113/453 (24.94%), Postives = 189/453 (41.72%), Query Frame = 3
Query:  288 ASYHGAI----HQKMQESMNIIDNVN-QLLKEVSETYETFCDSLSLICTKFSKSL--TSSNYSSDFLDL--------------WNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQYQLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQREIIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINFVRQLNTNQAVSYWRREQFLPPDGDCPEILA---------RDDVISDKLTVEPLQHIRSGLLKEQNELLSFISQNGDVISTLKGLKTNGFSYSRSFEKLYELDDDICRKQNEVRMAQVQVAGVIAQ----------LQHIDNKKFSGFALKDEEDTGMKRIWKKAVFSLK-RDKGSKNQSILKNIKKESFRPASSPLQ 1523
            ASY+G +    H  + E+    +NVN +L+K VS+    F ++LS +  + + +L    SNY     +L              W   LQ   +++Q  ++        V  P+   S H+  Q  K++  R S E ++    + + +   DY   +   R+      +   ++AHN YV QL A+N M + YH+  LP  + ELE I  +++ I   SL   +   A K        + + +   ++SP   ++NFVR L          R  F  P  +  E            R++++ D+ +    +     L +E  EL   I Q  D I  L   +T G    + + K+ EL +D+  K+ ++R  Q+ +A + AQ              + +KFS           MK  W KA  SLK    GS  Q+  +N    +   AS PL+
Sbjct:  474 ASYNGVLKDYSHSSLNEAFKSQNNVNFKLIKTVSD----FSETLSRLYEEHATALQVAVSNYRKKNAELRKERPACHLAIFQAWETFLQEVETDSQACNDVASVLSRQVSRPMLDKSFHRKVQSRKIFTHRESFETIIAKTEEKLSKCRVDYKQCHLAHRQNPSQHSLTEYIDAHNAYVQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQGAEVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQPSQAQKIPRRLFASPQAEVGEEAGDHNEMTPCLRNELVFDRHSTLSQRSALESLKREAIELELQIRQLQDSIEALNRTQTRGIE-GQLYNKVNELQEDLSMKKFDLRAKQIHLAAIRAQKDLFVSKVEPTSPRNERKFSAATAPS-----MKTKWLKAFKSLKPAGSGSAQQADRRNGASST---ASEPLR 913          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Fly
Match: Stacl (gene:FBgn0263980 transcript:FBtr0330007)

HSP 1 Score: 105.916 bits (263), Expect = 7.255e-23
Identity = 113/453 (24.94%), Postives = 189/453 (41.72%), Query Frame = 3
Query:  288 ASYHGAI----HQKMQESMNIIDNVN-QLLKEVSETYETFCDSLSLICTKFSKSL--TSSNYSSDFLDL--------------WNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQYQLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQREIIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINFVRQLNTNQAVSYWRREQFLPPDGDCPEILA---------RDDVISDKLTVEPLQHIRSGLLKEQNELLSFISQNGDVISTLKGLKTNGFSYSRSFEKLYELDDDICRKQNEVRMAQVQVAGVIAQ----------LQHIDNKKFSGFALKDEEDTGMKRIWKKAVFSLK-RDKGSKNQSILKNIKKESFRPASSPLQ 1523
            ASY+G +    H  + E+    +NVN +L+K VS+    F ++LS +  + + +L    SNY     +L              W   LQ   +++Q  ++        V  P+   S H+  Q  K++  R S E ++    + + +   DY   +   R+      +   ++AHN YV QL A+N M + YH+  LP  + ELE I  +++ I   SL   +   A K        + + +   ++SP   ++NFVR L          R  F  P  +  E            R++++ D+ +    +     L +E  EL   I Q  D I  L   +T G    + + K+ EL +D+  K+ ++R  Q+ +A + AQ              + +KFS           MK  W KA  SLK    GS  Q+  +N    +   AS PL+
Sbjct:  262 ASYNGVLKDYSHSSLNEAFKSQNNVNFKLIKTVSD----FSETLSRLYEEHATALQVAVSNYRKKNAELRKERPACHLAIFQAWETFLQEVETDSQACNDVASVLSRQVSRPMLDKSFHRKVQSRKIFTHRESFETIIAKTEEKLSKCRVDYKQCHLAHRQNPSQHSLTEYIDAHNAYVQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQGAEVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQPSQAQKIPRRLFASPQAEVGEEAGDHNEMTPCLRNELVFDRHSTLSQRSALESLKREAIELELQIRQLQDSIEALNRTQTRGIE-GQLYNKVNELQEDLSMKKFDLRAKQIHLAAIRAQKDLFVSKVEPTSPRNERKFSAATAPS-----MKTKWLKAFKSLKPAGSGSAQQADRRNGASST---ASEPLR 701          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Fly
Match: Stacl (gene:FBgn0263980 transcript:FBtr0344206)

HSP 1 Score: 105.916 bits (263), Expect = 7.802e-23
Identity = 113/453 (24.94%), Postives = 189/453 (41.72%), Query Frame = 3
Query:  288 ASYHGAI----HQKMQESMNIIDNVN-QLLKEVSETYETFCDSLSLICTKFSKSL--TSSNYSSDFLDL--------------WNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQYQLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQREIIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINFVRQLNTNQAVSYWRREQFLPPDGDCPEILA---------RDDVISDKLTVEPLQHIRSGLLKEQNELLSFISQNGDVISTLKGLKTNGFSYSRSFEKLYELDDDICRKQNEVRMAQVQVAGVIAQ----------LQHIDNKKFSGFALKDEEDTGMKRIWKKAVFSLK-RDKGSKNQSILKNIKKESFRPASSPLQ 1523
            ASY+G +    H  + E+    +NVN +L+K VS+    F ++LS +  + + +L    SNY     +L              W   LQ   +++Q  ++        V  P+   S H+  Q  K++  R S E ++    + + +   DY   +   R+      +   ++AHN YV QL A+N M + YH+  LP  + ELE I  +++ I   SL   +   A K        + + +   ++SP   ++NFVR L          R  F  P  +  E            R++++ D+ +    +     L +E  EL   I Q  D I  L   +T G    + + K+ EL +D+  K+ ++R  Q+ +A + AQ              + +KFS           MK  W KA  SLK    GS  Q+  +N    +   AS PL+
Sbjct:  262 ASYNGVLKDYSHSSLNEAFKSQNNVNFKLIKTVSD----FSETLSRLYEEHATALQVAVSNYRKKNAELRKERPACHLAIFQAWETFLQEVETDSQACNDVASVLSRQVSRPMLDKSFHRKVQSRKIFTHRESFETIIAKTEEKLSKCRVDYKQCHLAHRQNPSQHSLTEYIDAHNAYVQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQGAEVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQPSQAQKIPRRLFASPQAEVGEEAGDHNEMTPCLRNELVFDRHSTLSQRSALESLKREAIELELQIRQLQDSIEALNRTQTRGIE-GQLYNKVNELQEDLSMKKFDLRAKQIHLAAIRAQKDLFVSKVEPTSPRNERKFSAATAPS-----MKTKWLKAFKSLKPAGSGSAQQADRRNGASST---ASEPLR 701          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Zebrafish
Match: stac3 (SH3 and cysteine rich domain 3 [Source:NCBI gene;Acc:445111])

HSP 1 Score: 68.9366 bits (167), Expect = 7.499e-12
Identity = 36/112 (32.14%), Postives = 60/112 (53.57%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCV 3125
            Y+ALY F   +KD+L+   G +++ +D S+ +WW GK   K GY P  Y+  +  GE V++V R   V +     + L K+QI+V+ G +    + + T     F+ P D +
Sbjct:  222 YMALYRFKAIEKDDLDFHPGDRITVLDDSNEEWWRGKIGEKTGYLPMTYIIRVRAGERVYKVTRSF-VGNREMGQITLKKDQIVVKKGEEVNGYLKVSTGRKLGFF-PADLL 331          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Zebrafish
Match: stac3 (SH3 and cysteine rich domain 3 [Source:NCBI gene;Acc:445111])

HSP 1 Score: 68.9366 bits (167), Expect = 7.499e-12
Identity = 36/112 (32.14%), Postives = 60/112 (53.57%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCV 3125
            Y+ALY F   +KD+L+   G +++ +D S+ +WW GK   K GY P  Y+  +  GE V++V R   V +     + L K+QI+V+ G +    + + T     F+ P D +
Sbjct:  222 YMALYRFKAIEKDDLDFHPGDRITVLDDSNEEWWRGKIGEKTGYLPMTYIIRVRAGERVYKVTRSF-VGNREMGQITLKKDQIVVKKGEEVNGYLKVSTGRKLGFF-PADLL 331          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Zebrafish
Match: stac3 (SH3 and cysteine rich domain 3 [Source:NCBI gene;Acc:445111])

HSP 1 Score: 68.9366 bits (167), Expect = 7.571e-12
Identity = 36/110 (32.73%), Postives = 59/110 (53.64%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPID 3119
            Y+ALY F   +KD+L+   G +++ +D S+ +WW GK   K GY P  Y+  +  GE V++V R   V +     + L K+QI+V+ G +    + + T     F+ P D
Sbjct:  220 YMALYRFKAIEKDDLDFHPGDRITVLDDSNEEWWRGKIGEKTGYLPMTYIIRVRAGERVYKVTRSF-VGNREMGQITLKKDQIVVKKGEEVNGYLKVSTGRKLGFF-PAD 327          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Zebrafish
Match: grap2a (GRB2 related adaptor protein 2a [Source:ZFIN;Acc:ZDB-GENE-050417-275])

HSP 1 Score: 57.7658 bits (138), Expect = 2.056e-8
Identity = 23/51 (45.10%), Postives = 31/51 (60.78%), Query Frame = 3
Query: 2796 ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAI 2948
            A+YDF   + DEL   +G  +  +D SDA WW G+  G+ G FPANY + I
Sbjct:  234 AIYDFTAEEDDELGFNSGDIIEVLDRSDASWWKGRLRGRSGLFPANYTEQI 284          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Zebrafish
Match: stac (SH3 and cysteine rich domain [Source:ZFIN;Acc:ZDB-GENE-131121-459])

HSP 1 Score: 57.3806 bits (137), Expect = 5.254e-8
Identity = 32/105 (30.48%), Postives = 53/105 (50.48%), Query Frame = 3
Query: 2730 EENISKQYTKKLGYRLRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILV 3044
            EE++S++  K+    L  N YVAL+ F  +   +L +R G ++   D S+ DWW G    + G+FPA +   +   + V+R  R   +    Q  + L + QI V
Sbjct:  245 EESLSERELKRDPLLL--NTYVALFGFTAQDNQDLEMRPGDRIVLADDSNDDWWKGVIEDRIGFFPAAFAHQVTSSDRVFRCNRTF-IGCKEQGQITLKEGQICV 346          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Xenopus
Match: stac3 (SH3 and cysteine rich domain 3 [Source:NCBI gene;Acc:493233])

HSP 1 Score: 78.1814 bits (191), Expect = 1.251e-14
Identity = 40/120 (33.33%), Postives = 69/120 (57.50%), Query Frame = 3
Query: 2775 LRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKV 3134
            ++ + +VALY F   +KD+L+ +AG +++ ID S+ +WW GK   K GYFPAN++  +   E V++V R   V +     + L K+QI+VQ G +    I + T      + P+D + ++
Sbjct:  229 MQSHYFVALYRFKALEKDDLDFQAGERITVIDDSNEEWWRGKVGEKAGYFPANFIIRVRAAERVYKVTRSF-VGNREIGQITLKKDQIVVQKGDEVNGYIKVSTGRKVGLF-PLDFLQEI 346          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Xenopus
Match: stac3 (SH3 and cysteine rich domain 3 [Source:NCBI gene;Acc:493233])

HSP 1 Score: 77.411 bits (189), Expect = 2.109e-14
Identity = 40/120 (33.33%), Postives = 69/120 (57.50%), Query Frame = 3
Query: 2775 LRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKV 3134
            ++ + +VALY F   +KD+L+ +AG +++ ID S+ +WW GK   K GYFPAN++  +   E V++V R   V +     + L K+QI+VQ G +    I + T      + P+D + ++
Sbjct:  224 MQSHYFVALYRFKALEKDDLDFQAGERITVIDDSNEEWWRGKVGEKAGYFPANFIIRVRAAERVYKVTRSF-VGNREIGQITLKKDQIVVQKGDEVNGYIKVSTGRKVGLF-PLDFLQEI 341          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Xenopus
Match: STAC2 (SH3 and cysteine rich domain 2 [Source:NCBI gene;Acc:100491407])

HSP 1 Score: 74.3294 bits (181), Expect = 3.844e-13
Identity = 35/115 (30.43%), Postives = 61/115 (53.04%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKV 3134
            YVALY F  ++ ++L L+ G +V  +D S+ DWW GKC  + G+FPAN+VQ +  GE VW+  +    +   Q  + L + Q+ V     + +  +  +        P +C+ ++
Sbjct:  292 YVALYKFLPQEINDLPLQPGDRVMVLDDSNEDWWKGKCGDRTGFFPANFVQRVRLGETVWKSTKAFQGIK-EQGQLCLKEGQVCVGVAKPETESFIKVSSGKKKGLVPQECLMEI 405          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Xenopus
Match: hcls1 (hematopoietic cell-specific Lyn substrate 1 [Source:NCBI gene;Acc:496771])

HSP 1 Score: 56.225 bits (134), Expect = 2.899e-7
Identity = 23/54 (42.59%), Postives = 32/54 (59.26%), Query Frame = 3
Query: 2781 GNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQ 2942
            G   VALYD+     DE++ +    ++ ID+ D  WW G C G+ G FPANYV+
Sbjct:  493 GICAVALYDYEGGGDDEISFQPQELITDIDMLDEGWWCGTCEGRRGLFPANYVE 546          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Xenopus
Match: adamts8 (ADAM metallopeptidase with thrombospondin type 1 motif 8 [Source:Xenbase;Acc:XB-GENE-994782])

HSP 1 Score: 55.4546 bits (132), Expect = 4.194e-7
Identity = 22/50 (44.00%), Postives = 32/50 (64.00%), Query Frame = 3
Query: 2796 ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQA 2945
            A+YDF   + +EL  +AG  V+ +D SD +WW G+ N   G FP+N+V A
Sbjct:  215 AIYDFEAAEDNELTFKAGDIVTVLDDSDPNWWKGETNEGIGLFPSNFVTA 264          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Mouse
Match: Stac3 (SH3 and cysteine rich domain 3 [Source:MGI Symbol;Acc:MGI:3606571])

HSP 1 Score: 77.411 bits (189), Expect = 1.594e-14
Identity = 40/115 (34.78%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKV 3134
            +VALY F   +KD+L+   G K++ ID S+ +WW GK   K G+FP N++  +  GE V RV R   V +     + L K+QI+VQ G + G  + + T      + P D + ++
Sbjct:  248 FVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFIIRVRAGERVHRVTRSF-VGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLF-PTDFLEEI 360          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Mouse
Match: Stac3 (SH3 and cysteine rich domain 3 [Source:MGI Symbol;Acc:MGI:3606571])

HSP 1 Score: 77.411 bits (189), Expect = 1.594e-14
Identity = 40/115 (34.78%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKV 3134
            +VALY F   +KD+L+   G K++ ID S+ +WW GK   K G+FP N++  +  GE V RV R   V +     + L K+QI+VQ G + G  + + T      + P D + ++
Sbjct:  248 FVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFIIRVRAGERVHRVTRSF-VGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLF-PTDFLEEI 360          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Mouse
Match: Stac2 (SH3 and cysteine rich domain 2 [Source:MGI Symbol;Acc:MGI:2144518])

HSP 1 Score: 77.0258 bits (188), Expect = 3.858e-14
Identity = 45/120 (37.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query: 2730 EENISKQYTKKLGYRLR-GNLY--VALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTG-SQDGDQIL 3077
            EE    Q   KL  R   G +Y  VALY F  ++ ++L L+ G ++  +D S+ DWW GK   + G+FPAN+VQ +  GE+VWR  +  S  +  Q  + L +NQI V    S+D D  +
Sbjct:  271 EEKSPGQQPPKLPLRKDVGPMYSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFS-GNKEQGYMSLKENQICVGVSRSKDSDGFI 389          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Mouse
Match: Stac (src homology three (SH3) and cysteine rich domain [Source:MGI Symbol;Acc:MGI:1201400])

HSP 1 Score: 74.7146 bits (182), Expect = 2.182e-13
Identity = 37/99 (37.37%), Postives = 60/99 (60.61%), Query Frame = 3
Query: 2775 LRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIRE-VSVVDSNQTPVRLYKNQILVQT-GSQDG 3065
            L+ N YVALY F  ++ ++L +R G  ++ ++ S+ DWW GK   + G+FPAN+VQ + + E ++R +R  +   D  Q  + L +NQI V +   QDG
Sbjct:  286 LQMNTYVALYRFIPQENEDLEMRPGDMITLLEDSNEDWWKGKIQDRVGFFPANFVQRVEEHEKIYRCVRTFIGCKDQGQ--ITLKENQICVTSEEEQDG 382          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Mouse
Match: Grap2 (GRB2-related adaptor protein 2 [Source:MGI Symbol;Acc:MGI:1333842])

HSP 1 Score: 60.4622 bits (145), Expect = 4.269e-9
Identity = 25/51 (49.02%), Postives = 33/51 (64.71%), Query Frame = 3
Query: 2796 ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAI 2948
            ALYDF   ++DEL  R+G  V  +D S+  WWTG+ + K G FPANYV  +
Sbjct:  270 ALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPM 320          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. UniProt/SwissProt
Match: sp|Q6ZMT1|STAC2_HUMAN (SH3 and cysteine-rich domain-containing protein 2 OS=Homo sapiens OX=9606 GN=STAC2 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.575e-15
Identity = 42/116 (36.21%), Postives = 67/116 (57.76%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTG-SQDGDQILIRTKINTTFWCPIDCVTKV 3134
            YVALY F  ++ ++L L+ G ++  +D S+ DWW GK   + G+FPAN+VQ +  GE+VWR  +  S  +  Q  + L +NQI V  G S+D D  +  +        P+D +T++
Sbjct:  297 YVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFS-GNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPVDALTEI 411          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. UniProt/SwissProt
Match: sp|A0JNJ1|STAC_BOVIN (SH3 and cysteine-rich domain-containing protein OS=Bos taurus OX=9913 GN=STAC PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.761e-14
Identity = 39/98 (39.80%), Postives = 60/98 (61.22%), Query Frame = 3
Query: 2775 LRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQT-GSQDG 3065
            L+ N YVALY F  ++ ++L +R G  ++ ++ S+ DWW GK   + G+FPAN+VQ +HQ E ++R +R  S     Q  + L +NQI V +   QDG
Sbjct:  286 LQMNTYVALYKFVPQENEDLEMRPGDMITLLEDSNEDWWKGKIQDRIGFFPANFVQRVHQNEKIFRCVRTFSGC-KEQGQITLKENQICVASEEEQDG 382          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. UniProt/SwissProt
Match: sp|Q68F99|STAC3_XENTR (SH3 and cysteine-rich domain-containing protein 3 OS=Xenopus tropicalis OX=8364 GN=stac3 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 7.162e-14
Identity = 40/120 (33.33%), Postives = 69/120 (57.50%), Query Frame = 3
Query: 2775 LRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKV 3134
            ++ + +VALY F   +KD+L+ +AG +++ ID S+ +WW GK   K GYFPAN++  +   E V++V R   V +     + L K+QI+VQ G +    I + T      + P+D + ++
Sbjct:  220 MQSHYFVALYRFKALEKDDLDFQAGERITVIDDSNEEWWRGKVGEKAGYFPANFIIRVRAAERVYKVTRSF-VGNREIGQITLKKDQIVVQKGDEVNGYIKVSTGRKVGLF-PLDFLQEI 337          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. UniProt/SwissProt
Match: sp|Q96MF2|STAC3_HUMAN (SH3 and cysteine-rich domain-containing protein 3 OS=Homo sapiens OX=9606 GN=STAC3 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.829e-14
Identity = 40/115 (34.78%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKV 3134
            +VALY F   +KD+L+   G K++ ID S+ +WW GK   K G+FP N++  +  GE V RV R   V +     + L K+QI+VQ G + G  + + T      + P D + ++
Sbjct:  252 FVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFIIRVRAGERVHRVTRSF-VGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLF-PTDFLEEI 364          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. UniProt/SwissProt
Match: sp|Q8BZ71|STAC3_MOUSE (SH3 and cysteine-rich domain-containing protein 3 OS=Mus musculus OX=10090 GN=Stac3 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.115e-13
Identity = 40/115 (34.78%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKV 3134
            +VALY F   +KD+L+   G K++ ID S+ +WW GK   K G+FP N++  +  GE V RV R   V +     + L K+QI+VQ G + G  + + T      + P D + ++
Sbjct:  248 FVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFIIRVRAGERVHRVTRSF-VGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLF-PTDFLEEI 360          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. TrEMBL
Match: A0A4Z2DES4 (Tyrosine-kinase Fes Fps-like isoform X5 OS=Schistosoma japonicum OX=6182 GN=EWB00_001753 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.043e-46
Identity = 116/377 (30.77%), Postives = 199/377 (52.79%), Query Frame = 3
Query:  258 HNMTYRDLAHASYHGAIHQKMQESMNIIDNVNQLLKEVSETYETFCDSLSLICTKFSKSLTSSN----------YSSDFLDLWNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQYQLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQRE----IIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINFVRQLNTNQAVSYWRREQFLPPDGDCPEILARDDVISDKLTVEPLQHIRSGLLKEQNELLSFISQNGDVISTLKGL-KTNGFSYSRSFEKLYELDDDICRKQNEVRMAQVQVAGVIAQL 1343
            H   ++ L+H SY+  + + +   ++++D    +++++++  + +  +L  IC   ++++ ++            +    DLW   ++   +EA+++          V NPL+ I  ++  Q  +L  FR S +  L + S+ + +L  +Y + Y++ RE    K I  LLNAHN+YVLQL  +N MK  YH+  LP ++ E ETI RE     IQIF     ++    A    QLI   + +   +K ++PD  +   V+ LN N+  ++W   ++LPPDGDCPEIL  D VI D L    LQ   + L ++  EL SF+ QN +++ TLK L K   F     +  L  + DDI RK++E+R A++ +AG+  Q+
Sbjct:   44 HITGFQLLSHKSYYPFMIESITHQLDLLDKFVLVIEQITDARQLYSTTLKNICQSLTENVENTESIKNDNNINDNNEVLFDLWRTFVEKAHNEAELHDNTVQQTKEKVVNPLKWIVKNRRQQISRLKAFRTSTDSTLKECSEKVIELQSNYAEMYRIYREVIQTKTIKDLLNAHNSYVLQLHMTNTMKAYYHNLILPQLMQEFETIVRENTTEFIQIFD----YFCSIHANMFDQLICNNNGVQIKMKEITPDAIVSIIVQNLNKNKNPTHWHLMEYLPPDGDCPEILCSDHVIIDNLVKIELQCKFNELKRQFAELSSFMQQNVNIVDTLKSLEKRYNFDTQVGYTHL-NMHDDIYRKEDEIRKARIALAGIEVQI 415          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. TrEMBL
Match: A0A183LF27 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS2402 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.017e-44
Identity = 106/373 (28.42%), Postives = 199/373 (53.35%), Query Frame = 3
Query:  270 YRDLAHASYHGAIHQKMQESMNIIDNVNQLLKEVSETYETFCDSLSLICTKFSKSLTS----------SNYSSDFLDLWNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQYQLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQRE----IIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINFVRQLNTNQAVSYWRREQFLPPDGDCPEILARDDVISDKLTVEPLQHIRSGLLKEQNELLSFISQNGDVISTLKGLKTNGFSYSRSFEKL-YELDDDICRKQNEVRMAQVQVAGVIAQL 1343
            ++ L+H +Y+  +   +   +++I+    +++++++  +++  ++  +C  F +S+            +N +    + W++ ++ F +EA+++     +  + V  PL+ I  H+  Q  +L  FR S +  L + ++ + +L  +Y + Y++ RE    K I  LLNAHN+YVLQL  +N MK  YH+  LP ++ E E I RE     +QIF     ++         QLI   + +   ++ +SPD  +   V  LN NQ  ++W+  ++L PD DCPEIL  + +I D L    L+   + L ++ +EL SF+ QN +++ TLK L+   F +    E   + + DDI RK+NE+R A++ +AG+  Q+
Sbjct:    6 FQFLSHKNYYPLMIDSITHQLDLIEKFVSVIEQMTDARQSYSIAIKNVCQSFKESVEKVESIKKDSDINNNNEILYNFWHVFIEKFQNEAELHENVIQETKAKVVTPLQCIVKHRRQQISRLKAFRTSTDYTLKECAEKVNELQSNYAEMYRIHREILQTKAIKDLLNAHNSYVLQLHMTNAMKAYYHNLVLPQLMQEFEDIVRENMIGFVQIFE----YFCSIHTNMFDQLICNINGVQLKVREISPDSVVSVIVHNLNKNQNPTHWQLIEYLSPDCDCPEILCSNQIIIDNLVKVELRDKFNELKRQFSELSSFMQQNVNIVDTLKTLE-KRFDFDTQTEHTNFNMHDDIYRKENEIRKAKIALAGIEIQV 373          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. TrEMBL
Match: A0A3Q0KT18 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 6.432e-43
Identity = 107/369 (29.00%), Postives = 198/369 (53.66%), Query Frame = 3
Query:  270 YRDLAHASYHGAIHQKMQESMNIIDNVNQLLKEVSETYETFCDSLSLICTKFSKSL----------TSSNYSSDFL-DLWNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQYQLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQREIIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINFVRQLNTNQAVSYWRREQFLPPDGDCPEILARDDVISDKLTVEPLQHIRSGLLKEQNELLSFISQNGDVISTLKGLKTNGFSYSRSFEKL-YELDDDICRKQNEVRMAQVQVAGVIAQ 1340
            ++ L+H +Y+  +   +   +++I+    +++++++  +++  +L  +C  F +S+          + +N +++ L +  ++ ++ F SEA+++     +  + V  PL++I  H+  Q  +L +FR S +  L +  + + +L  +Y + Y++ RE    K I  LLNAHN+YVLQL  +N MK  YH+  LP ++ E E I RE I  F     ++         QLI   + +   +K +SPD  +   V  LN NQ  ++W+  ++L PD DCP+IL  + +I D L    L+   + L ++  EL SF+ QN +++ TLK L+   F +    E     + DDI RK+NE+R A++ +AG+  Q
Sbjct:   70 FQFLSHKNYYPLMIDSITHQLDLIEKFVSVIEQMTDARQSYSMALKNVCQSFKESIEKVESVNKNDSDTNNNNEILHNFCHVFIEKFQSEAELHENVIHETKAKVVTPLQSIVKHRRQQISRLKDFRASTDYTLKECGEKVIELQSNYAEMYRIHRELLKTKAIKDLLNAHNSYVLQLHMTNAMKAYYHNLVLPQLMKEFEDIVRENIIGFVQIFDYFCSIHTSMFDQLICNINGVQLKVKEISPDSVVSVIVHNLNRNQNPTHWQLIEYLSPDCDCPDILCSNQIIVDNLVKVELREKFNELKRQFAELSSFMQQNINIVDTLKTLE-KRFDFDTQTEHTNLNMHDDIYRKENEIRKAKIALAGIEVQ 437          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. TrEMBL
Match: A0A1S3JKS6 (uncharacterized protein LOC106174122 isoform X5 OS=Lingula unguis OX=7574 GN=LOC106174122 PE=4 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 1.321e-42
Identity = 233/989 (23.56%), Postives = 424/989 (42.87%), Query Frame = 3
Query:  267 TYRDLAHASYHGAIHQKMQESMNIIDNVNQLLKEVSETYETFCDSLSLICTKFSKSL-----TSSNYSSDFLDLWNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYID---QYQLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQREIIQIFHSSL-CHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINFVRQLNTNQAVSYWRREQFLPPDGDCPEI--LARDDVISDKLTVEPLQHIRSGLLKEQNELLSFISQNGDVISTL-KGLKTNGFSYSRSFEKLYELDDDICRKQNEVRMAQVQVAGVIAQLQHIDNKKFSGFALKDEED----------TGMKRIWKKAVFSLKRDKGS--KNQSIL-KNIKKESFRPASSPLQNTFQNDDSKVDPVYHLLRCAASKSHLSSFQCDLRDSNSSPTPKYNEMAFQTSNGRLSLIQTAFNMA-NLSRRRLLLCQTKAKSSSVEEGGQVGDDKILNSSNLHSHWLDTINTDSRENSHRGSVSKPNNYIKSSIPINNQKCVKGKLKTMFHSATVSQPPDEQLLDKGISKSPVFHSDIMH--RKLN-ERMKSFSVDNPDKVSNTASSPPSISRDN-RKMSSSYTNTKLYDSNVPISPRRRKTLYGRKKSCSLDQENHA--TSRRVAFADESMTRKADRSYDNSIFLDHNEKSFKTSNEMISKNRRNSSQTRPFYNSWRVKSFSLDMPEKEE-NSESEINHQTFPTNSNXXXXXXXXXXXXXSYSPKHDSKRLDRISESQEKSLSMEIDNQIEVNNKNNLKVLTHQKEHIEENISKQYTKKLGYRLRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKV 3134
            +++DL        I Q M  ++ +   + +  ++++  +  F   +      F K       +S    S     W  L++    ++ ++ +        V  PL  ++A+K    +++  F      +L      +++ +++Y+D   +YQ  ++ Y  KL      AHN Y+LQL + N++  +Y+  ALP +L ELE I+ +     + +L  H     +K + Q   ++  IL   K L P   I++FV+ L     V     ++F PPD +   I  L  D +I ++ T   L   +S L K+   LLS I    + I+TL +  K N  ++   + KLYE+ +++C K+NEVR+A++Q+A +  Q++ +  K+    + K +E+            +K +WKKA  +LKR   +  K Q+   K+++K +            Q +    +P           + L S +  L      P+ +  E   Q +N  +  + +    A NL + +  +C               GD     SS +  H     +  SR NS   ++S       S++ +   +   GK       ++VSQP    L        P  +S+I    RKL  E     S    D V + + S  +   D+ R +S+ Y     Y  +     RR   L  R KS S D++  A    RR      S+TR+     D S+              ++  N   S +  P  N  R+KSFS+D+P+     S+ EI+ ++                   + SP H+ K+        +++ S++    I V+  +              +    +      R +  LY++LY++   ++ +L ++AGW++ AI+ SD +WW G+CNGK GYFPA YV A+   +  + V + + + +  +   +L K+QI+VQ GS     + +R+  +    CP+  +++V
Sbjct:    9 SFQDLRQPGMQDTIRQHMGATLKLAKTMAEFSQKIAAVHTQFASQMQASVEMFKKRSHELRESSVEMPSIMQTTWEDLIREVEVDSYMHTDLASRLTKNVYQPLMDLAAYKRGHVKRMTSFGEHYLSLLQKAEADLDKANKNYVDCFIRYQENKDTY--KLQSAYHVAHNEYLLQLKSFNQLSTEYYDMALPGLLQELEDIELDTGLALNGALESHVMLILSKSNEQYKRYEG-ILHLCKQLDPKVDIVHFVKHLKPQPFVIDSVLQEFRPPDPNSGNIENLLDDQLILNRGTQTVLDSKQSILEKQAANLLSEIQFQQESIATLTEECKKNIANHQ--YGKLYEIQEELCSKRNEVRIAKMQLAAIKPQIELLSPKQNGNMSSKAKEEKEASKPLHSAGSIKSMWKKAFKNLKRSSSTIEKTQTAAEKDVEKST---------EDEQPEKEAGEPE------VGRSTRLGSLRRSLM--RKKPSKEEEEEDEQPANHEIDPVYSLLKCAGNLPKNKGHIC---------------GD-----SSCMMQHSPSGQHIYSRSNS---AMSTGRTSPSSTLAVQQDQAYGGKRSPDHRRSSVSQPISHNL------SFPEIYSEIQRERRKLMIEAHHQHSQSLTDSVGSLSGSEDAYKVDSSRVLSAPYLEQSNYGGS-----RRPPMLNSRMKSQSADEKAVANLAGRRC-----SITRQ-----DASV-KPCGVSEIPAPGPLLGAN--GSRRRIPRLNE-RMKSFSIDVPDAAHVMSDPEISKRS------------------NTLSPYHERKKFT------DRTNSLDDPGYISVSQSS--------------HSPSPHPSPPQSRRKSKLYLSLYNWRGSERGDLEIKAGWRIKAIETSDNNWWKGRCNGKVGYFPAKYVTAVEPDQKAYIVKQGLQLSEEGKD-FKLLKDQIVVQAGSIKDGMVPVRSG-DKQMPCPLKYLSEV 887          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. TrEMBL
Match: A0A430QJV2 (Uncharacterized protein (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0011087 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.460e-40
Identity = 100/368 (27.17%), Postives = 191/368 (51.90%), Query Frame = 3
Query:  270 YRDLAHASYHGAIHQKMQESMNIIDNVNQLLKEVSETYETFCDSLSLICTKFSKSL---------TSSNYSSDFL-DLWNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQYQLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQREIIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINFVRQLNTNQAVSYWRREQFLPPDGDCPEILARDDVISDKLTVEPLQHIRSGLLKEQNELLSFISQNGDVISTLKGLKTNGFSYSRSFEKL-YELDDDICRKQNEVRMAQVQVAGVIAQ 1340
            ++ L+H +Y+  +   +   +++I+    +++++++  +++  ++  +C  F +S+         + +N +++ L + W++ ++ F +EA+++     +  + V  PL+ I  H+  Q  +L  FR S +  L + ++ + +L  +Y + Y++ RE    K I  LLNAHN+YVLQL  +N MK  YH+  LP ++             F   +C+ +G   K               ++ +SPD  +   V  LN NQ  ++W+  ++L PD DCPEIL  + +I D L    L+   + L ++  EL SF+ QN +++ TLK L+   F +    E     + DDI RK+NE+R A++ +AG+  Q
Sbjct:   26 FQFLSHKNYYPLMIDSITHQLDLIEKFVSVIEQMTDARQSYSIAIKNVCQSFKESVEKVESIKKDSDTNNNNEILYNFWHVFIEKFQNEAELHENVIQETKAKVVTPLQCIVKHRRQQISRLKAFRTSTDYTLKECAEKVNELQSNYAEMYRIHREILQTKAIKDLLNAHNSYVLQLHMTNAMKAYYHNLVLPQLMQ------------FDQLICNINGVQLK---------------VREVSPDSVVSVIVHNLNKNQNPTHWQLIEYLSPDCDCPEILCSNQIIVDNLVKVELRDKFNELKRQFAELSSFMQQNVNIVDTLKTLE-KRFDFDTQTEHTNLNMHDDIYRKENEIRKAKIALAGIEVQ 365          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Cavefish
Match: STAC3 (SH3 and cysteine rich domain 3 [Source:NCBI gene;Acc:103033422])

HSP 1 Score: 80.8777 bits (198), Expect = 8.213e-16
Identity = 44/139 (31.65%), Postives = 75/139 (53.96%), Query Frame = 3
Query: 2718 KEHIEENISKQYTKKLGYRLRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKV 3134
            K   E+ + K    KLG   + + Y+ALY F   +KD+L+L  G +++ ID S+ +WW GK   + G+ PANY+  +  GE V++V R   V +     + L K+QI+V+ G +    + + T     F+ P D + ++
Sbjct:  208 KAAAEDKMKKPVLGKLGVFSQSHYYLALYRFKAIEKDDLDLHPGDRITVIDDSNEEWWRGKIGERSGFLPANYIIRVRSGERVYKVTRSF-VGNREMGQITLKKDQIVVKKGDEVNGYLKVSTGRKLGFF-PADILQEI 344          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Cavefish
Match: STAC2 (SH3 and cysteine rich domain 2 [Source:HGNC Symbol;Acc:HGNC:23990])

HSP 1 Score: 73.9442 bits (180), Expect = 2.428e-13
Identity = 36/85 (42.35%), Postives = 51/85 (60.00%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILV 3044
            YVALY F  +++++L L  G +V   D S+ +WW GK   K G+FPAN+VQ +  GE VWRV  E S  D     + + ++QI V
Sbjct:  265 YVALYRFLPQEQNDLELHPGDRVQVTDDSNEEWWKGKSGDKVGFFPANFVQRVRPGERVWRVT-ECSEGDRQLGHMPVKEDQICV 348          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Cavefish
Match: grap2a (GRB2-related adapter protein-like [Source:NCBI gene;Acc:103029038])

HSP 1 Score: 60.8474 bits (146), Expect = 1.667e-9
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = 3
Query: 2778 RGNLYV-ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAI 2948
            R  L V A+YDF   ++DEL   AG  +  ID SDA WW G+  G+ G FPANY   I
Sbjct:  230 RSTLQVKAMYDFIAEEEDELGFNAGDIIEVIDRSDASWWKGRLQGRTGLFPANYTAPI 287          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Cavefish
Match: grap2a (GRB2-related adapter protein-like [Source:NCBI gene;Acc:103029038])

HSP 1 Score: 60.8474 bits (146), Expect = 1.667e-9
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = 3
Query: 2778 RGNLYV-ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAI 2948
            R  L V A+YDF   ++DEL   AG  +  ID SDA WW G+  G+ G FPANY   I
Sbjct:  230 RSTLQVKAMYDFIAEEEDELGFNAGDIIEVIDRSDASWWKGRLQGRTGLFPANYTAPI 287          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Cavefish
Match: grap2a (GRB2-related adapter protein-like [Source:NCBI gene;Acc:103029038])

HSP 1 Score: 59.6918 bits (143), Expect = 2.484e-9
Identity = 25/51 (49.02%), Postives = 31/51 (60.78%), Query Frame = 3
Query: 2796 ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAI 2948
            A+YDF   ++DEL   AG  +  ID SDA WW G+  G+ G FPANY   I
Sbjct:  178 AMYDFIAEEEDELGFNAGDIIEVIDRSDASWWKGRLQGRTGLFPANYTAPI 228          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009546.1 (pep scaffold:Pmarinus_7.0:GL485512:1487:9666:1 gene:ENSPMAG00000008635.1 transcript:ENSPMAT00000009546.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 4.326e-14
Identity = 35/90 (38.89%), Postives = 51/90 (56.67%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQ 3059
            YV LY F  ++KD+L L  G ++  ID S+ +WW GK   K GYFPAN+V  +  GE V R+ R   V +     + L + Q+ V+ G +
Sbjct:   19 YVVLYKFVAQEKDDLQLTPGQRLIVIDDSNEEWWKGKMGDKLGYFPANFVIRVRAGERVLRLSRTF-VGNKQLGQITLKQGQVCVEKGEE 107          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Sea Lamprey
Match: stac3 (SH3 and cysteine rich domain 3 [Source:NCBI gene;Acc:445111])

HSP 1 Score: 69.707 bits (169), Expect = 5.553e-13
Identity = 33/90 (36.67%), Postives = 54/90 (60.00%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQ 3059
            +VAL+ F  R+KD+L L  G ++S +D S+ +WW GK   + GYFPAN+V  +  GE V++ +R   V +     + L + Q+ V+ G +
Sbjct:  197 FVALHRFGTREKDDLALEPGDRLSILDDSNEEWWKGKLGDRVGYFPANFVVRVRPGERVFQALRTF-VGNKQLGQLTLKQEQVCVEKGGE 285          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Sea Lamprey
Match: stac (SH3 and cysteine rich domain [Source:ZFIN;Acc:ZDB-GENE-131121-459])

HSP 1 Score: 65.4698 bits (158), Expect = 2.299e-11
Identity = 36/116 (31.03%), Postives = 62/116 (53.45%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKIN-TTFWCPIDCVTKV 3134
            YVAL  +  +   +L ++ G  +S +D S+ +WW G+ + + G+FPAN+VQ +  GE V+R +R  +    +   + L   QI V+  S    Q L+R +        PIDC+ ++
Sbjct:  262 YVALSQYVPQDSGDLAIQPGDILSIVDDSNEEWWKGRIDDRVGFFPANFVQRVRPGERVFRCVRACAGTREHGQ-LALNLEQICVEKASMPA-QGLVRVQSGRKKGLVPIDCLEEI 375          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Sea Lamprey
Match: stam (signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 [Source:ZFIN;Acc:ZDB-GENE-031118-123])

HSP 1 Score: 56.9954 bits (136), Expect = 1.253e-8
Identity = 23/50 (46.00%), Postives = 32/50 (64.00%), Query Frame = 3
Query: 2796 ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQA 2945
            ALYDF   + +EL  RAG  ++ +D SDA+WW G+     G FP+N+V A
Sbjct:  217 ALYDFEAAEDNELTFRAGEILTVLDDSDANWWKGETESGLGLFPSNFVTA 266          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Sea Lamprey
Match: grb2a (growth factor receptor-bound protein 2a [Source:ZFIN;Acc:ZDB-GENE-041121-1])

HSP 1 Score: 54.299 bits (129), Expect = 2.963e-8
Identity = 22/48 (45.83%), Postives = 31/48 (64.58%), Query Frame = 3
Query: 2796 ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYV 2939
            AL+DF  ++  EL  R G  ++ +D SD +WW G C+G+ G FP NYV
Sbjct:  164 ALFDFEPQEDGELGFRRGDFITVVDSSDPNWWKGSCHGRAGMFPRNYV 211          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Yeast
Match: PIN3 (Negative regulator of actin nucleation-promoting factor activity; interacts with Las17p, a homolog of human Wiskott-Aldrich Syndrome protein (WASP), via an N-terminal SH3 domain, and along with LSB1 cooperatively inhibits the nucleation of actin filaments; short-lived protein whose levels increase in response to thermal stress; induces the formation of the [PIN+] and [RNQ+] prions when overproduced; PIN3 has a paralog, LSB1, that arose from the whole genome duplication [Source:SGD;Acc:S000006358])

HSP 1 Score: 56.9954 bits (136), Expect = 1.760e-9
Identity = 32/89 (35.96%), Postives = 44/89 (49.44%), Query Frame = 3
Query: 2796 ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQD 3062
            ALY F  +Q  +L L+ G KV  ++    +W+ G CNG+ G FPANYV+    G +            SN  P   YK Q L Q  +Q+
Sbjct:   61 ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSN----------GPSNLPPPPQYKAQELQQIPTQN 139          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Yeast
Match: LSB1 (Negative regulator of actin nucleation-promoting factor activity; interacts with Las17p, a homolog of human Wiskott-Aldrich Syndrome protein (WASP), via an N-terminal SH3 domain, and along with PIN3 cooperatively inhibits the nucleation of actin filaments; overexpression blocks receptor-mediated endocytosis; protein increases in abundance and forms nuclear foci in response to DNA replication stress; LSB1 has a paralog, PIN3, that arose from the whole genome duplication [Source:SGD;Acc:S000003368])

HSP 1 Score: 55.0694 bits (131), Expect = 1.267e-8
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 3
Query: 2790 YV-ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQ 2942
            YV ALYDF  +Q  +L+L+ G K+  ++    DW+ GK N K G FPANYV+
Sbjct:   57 YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVK 108          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Yeast
Match: YSC84 (Actin-binding protein; involved in bundling of actin filaments and endocytosis of actin cortical patches; activity stimulated by Las17p; contains SH3 domain similar to Rvs167p; YSC84 has a paralog, LSB3, that arose from the whole genome duplication [Source:SGD;Acc:S000001058])

HSP 1 Score: 54.6842 bits (130), Expect = 5.252e-8
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 3
Query: 2793 VALYDFWCRQKDELNLRAGWKVSAIDISDA--DWWTGKCNGKFGYFPANYVQ 2942
            VALY+F   Q  +L  + G  ++ +  SD+  DWWTG+ NGK G FPANYV+
Sbjct:  415 VALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Yeast
Match: LSB3 (Protein containing a C-terminal SH3 domain; binds Las17p, which is a homolog of human Wiskott-Aldrich Syndrome protein involved in actin patch assembly and actin polymerization; protein abundance increases in response to DNA replication stress; LSB3 has a paralog, YSC84, that arose from the whole genome duplication [Source:SGD;Acc:S000002968])

HSP 1 Score: 54.299 bits (129), Expect = 7.174e-8
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 3
Query: 2793 VALYDFWCRQKDELNLRAGWKVSAIDISDA--DWWTGKCNGKFGYFPANYVQAI 2948
            VALY F   +  +L  R G  ++ +  SD+  DWWTG+ NG+ G FPANYV+ +
Sbjct:  406 VALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV 459          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Yeast
Match: HSE1 (Subunit of the endosomal Vps27p-Hse1p complex; complex is required for sorting of ubiquitinated membrane proteins into intralumenal vesicles prior to vacuolar degradation, as well as for recycling of Golgi proteins and formation of lumenal membranes [Source:SGD;Acc:S000000994])

HSP 1 Score: 51.9878 bits (123), Expect = 3.188e-7
Identity = 21/51 (41.18%), Postives = 27/51 (52.94%), Query Frame = 3
Query: 2796 ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAI 2948
            ALYD    + DEL+ R G  ++ ++    DWW G   G  G FP NYV  I
Sbjct:  224 ALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTPI 274          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Nematostella
Match: EDO36303 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIY7])

HSP 1 Score: 78.5666 bits (192), Expect = 4.684e-15
Identity = 103/465 (22.15%), Postives = 187/465 (40.22%), Query Frame = 3
Query:  249 ACAHNMTYRDLAHASYHGAIHQKMQESMNIIDNVNQLLKEVSETYETFCDSLSLICTKFSKSLTSSNYS----SDFLDLWNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQ----YQLQ------REKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQREIIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSL----SPDDQIINFVRQLNTNQAVSYWRREQFLPPDG--DCPEILARDDVISDKLTVEPLQHI-----RSGLLKEQNELLSFISQNGDVISTLKGLKTNGFSYSRSFEKLYELDDDICRKQNEVRMAQVQVAGVIAQLQHIDNKKFSGFA-------------LKDEE---DTGMKRIWKK-------AVFSLKRDKGSKNQSILKNIKKESF 1499
            A     T R++   S +  +       + I+    + + ++    E   + L  +   F +            S  + LW  LL  + +EAQ   + C      +   L   ++ + +  +K++ FR + E  ++   D   + HRDY +      ++Q      +E      I    NAHN+YVLQL A N M D ++++ LP +LD+L+ IQ E      ++  +     A+  RQ  D + + L S + +    +    I NFV+  N           QF PP    + PE      V   KL+V  L           L K+   L   + +    I ++ GLK + +S + S+ +   +D ++  ++NE+R+ ++         + I N + S F              L+DEE   D  +  I+ K       A+   K  + +K++ +  N +K  F
Sbjct:    2 AAVRGGTLREMVDPSANETLKSNSHSCVKILKTAGEFVSKICAVKEQCANQLLSVVETFKRKSAEMKKERGALSSAMSLWETLLLEYETEAQDMLKLCSKLSKDISKSLSDEASKRKALYKKIFTFREAGEARISKADDARAKCHRDYCEACAKLAKVQNSADQSKEGKQEHYITMCHNAHNSYVLQLSAVNGMTDVFYTKTLPQMLDDLQAIQEETAMAMSATFKN----CAEIERQNHDDRSKRLQSFEGMFELVNSSQDIENFVKTNNPG---------QFTPPKKLFEKPEDGTVVSVPDGKLSVHALTETVLKRKYITLYKKFRNLSDDVEKERHAIISVSGLK-DSYSKNPSYGRADTVDANLLEQKNEMRLKEM--------YKEITNDQLSLFTPDVMTKLSVSDVDLQDEEYDDDESLTNIYDKRQSVITSAMAKPKTTRAAKHEFVEHNFRKPQF 444          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Nematostella
Match: EDO50032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF47])

HSP 1 Score: 52.373 bits (124), Expect = 9.204e-7
Identity = 22/50 (44.00%), Postives = 30/50 (60.00%), Query Frame = 3
Query: 2793 VALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQ 2942
            VALYD+    +DE+       ++ I+  D  WW G CNG+ G FPANYV+
Sbjct:  482 VALYDYQAAGEDEITFDPDDIITDIEKIDDGWWMGTCNGQRGLFPANYVE 531          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Nematostella
Match: EDO46357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQF8])

HSP 1 Score: 51.6026 bits (122), Expect = 1.462e-6
Identity = 21/48 (43.75%), Postives = 29/48 (60.42%), Query Frame = 3
Query: 2796 ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYV 2939
            ALYDF   + +EL  + G  +S +D SDA WW G+     G FP+N+V
Sbjct:  239 ALYDFEAAEDNELTFKTGDIISILDDSDASWWKGETPNGTGLFPSNFV 286          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Nematostella
Match: EDO38076 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE08])

HSP 1 Score: 49.2914 bits (116), Expect = 1.575e-6
Identity = 22/52 (42.31%), Postives = 34/52 (65.38%), Query Frame = 3
Query: 2796 ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKC--NGKFGYFPANYVQA 2945
            AL+DF  +++ E++ + G  +  ID SD +WW GK    G+ G FP+NYV+A
Sbjct:  137 ALFDFEAQEEGEVSFKRGDCIEVIDNSDVNWWRGKVLTTGEIGMFPSNYVKA 188          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Nematostella
Match: EDO29864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2F6])

HSP 1 Score: 47.3654 bits (111), Expect = 1.648e-6
Identity = 22/51 (43.14%), Postives = 30/51 (58.82%), Query Frame = 3
Query: 2793 VALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKC--NGKFGYFPANYV 2939
            VALYDF  ++  ELN + G  +  +D  D +WW G+    G+ G FP NYV
Sbjct:   62 VALYDFVAQEAGELNFKKGNHIEVLDKEDDNWWKGRVAETGEEGLFPRNYV 112          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Medaka
Match: STAC2 (SH3 and cysteine-rich domain-containing protein 2 [Source:NCBI gene;Acc:101169458])

HSP 1 Score: 78.1814 bits (191), Expect = 2.143e-14
Identity = 47/160 (29.38%), Postives = 88/160 (55.00%), Query Frame = 3
Query: 2631 ESQEKSLSMEIDNQIEVNNKNNLKVLTHQKEHIEEN------ISKQYTKKLGYRLRGN---LYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIR 3083
            E Q++  SME   +I +   + L      ++ ++E+      +S+  + K+  R+  +    YVALY F  +++++L L  G +V  ID S+ +WW GK   K G+FP+N+VQ +  GE VWRV++  S  +  +  + + ++QI V  G +D  ++ ++
Sbjct:  346 ERQQRQCSME--EEITLETGDTLVADEEMEKEVDESSEQAQVLSEDSSAKIPKRIEVHSIHTYVALYKFLPQEQNDLELHPGDRVQVIDDSNEEWWKGKSGDKIGFFPSNFVQRVRPGERVWRVVQGTS-GNRERGHMAVRESQICV--GKRDDGEVFVK 500          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Medaka
Match: STAC2 (SH3 and cysteine-rich domain-containing protein 2 [Source:NCBI gene;Acc:101171286])

HSP 1 Score: 73.559 bits (179), Expect = 4.315e-13
Identity = 47/133 (35.34%), Postives = 73/133 (54.89%), Query Frame = 3
Query: 2586 SYSPKHDSKRLDRISESQEKSLSMEIDNQIEVNNKNNLKVLT---HQKEHIEENISKQYTKKLGYRLRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRV 2975
            S SP H+++RL      QEK     ++NQ     +    +LT    +K   E+ +S +  K++      + YVALY F  ++K++L L+ G +V   D S+ DWW GK   K G+FPAN+VQ +  GE V++V
Sbjct:  245 SESPCHETERL------QEK-----LENQPIAEEEQIPGMLTPPESEKADSEDRVSLKTPKRVPVHSL-HTYVALYKFLPQEKNDLELQPGDRVQVTDDSNEDWWKGKSGHKVGFFPANFVQRVRPGERVYKV 365          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Medaka
Match: stac3 (SH3 and cysteine rich domain 3 [Source:NCBI gene;Acc:101165142])

HSP 1 Score: 71.2478 bits (173), Expect = 8.845e-13
Identity = 37/115 (32.17%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKV 3134
            Y+ALY F   +KD+L+   G ++  +D S+ +WW GK   K GYFP NY+  +   E V++V R   V +     + L K+QI+V+ G + G  + + T     ++ P D + ++
Sbjct:  195 YLALYRFKAIEKDDLDFHPGDRIIVLDDSNEEWWRGKMGEKTGYFPTNYIIKVRASERVFKVTRSF-VGNREMGQITLKKDQIVVKKGDEKGGYLKVSTGRKLGYF-PADLLEEI 307          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Medaka
Match: stac3 (SH3 and cysteine rich domain 3 [Source:NCBI gene;Acc:101165142])

HSP 1 Score: 71.2478 bits (173), Expect = 1.377e-12
Identity = 35/103 (33.98%), Postives = 57/103 (55.34%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINT 3098
            Y+ALY F   +KD+L+   G ++  +D S+ +WW GK   K GYFP NY+  +   E V++V R   V +     + L K+QI+V+ G + G  +  +   +T
Sbjct:  218 YLALYRFKAIEKDDLDFHPGDRIIVLDDSNEEWWRGKMGEKTGYFPTNYIIKVRASERVFKVTRSF-VGNREMGQITLKKDQIVVKKGDEKGGYLKFQVGYST 319          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Medaka
Match: stac3 (SH3 and cysteine rich domain 3 [Source:NCBI gene;Acc:101165142])

HSP 1 Score: 70.4774 bits (171), Expect = 2.188e-12
Identity = 35/103 (33.98%), Postives = 57/103 (55.34%), Query Frame = 3
Query: 2790 YVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINT 3098
            Y+ALY F   +KD+L+   G ++  +D S+ +WW GK   K GYFP NY+  +   E V++V R   V +     + L K+QI+V+ G + G  +  +   +T
Sbjct:  212 YLALYRFKAIEKDDLDFHPGDRIIVLDDSNEEWWRGKMGEKTGYFPTNYIIKVRASERVFKVTRSF-VGNREMGQITLKKDQIVVKKGDEKGGYLKFQVGYST 313          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Planmine SMEST
Match: SMESG000047737.1 (SMESG000047737.1)

HSP 1 Score: 1873.6 bits (4852), Expect = 0.000e+0
Identity = 923/968 (95.35%), Postives = 927/968 (95.76%), Query Frame = 3
Query:  243 MAACAHNMTYRDLAHASYHGAIHQKMQESMNIIDNVNQLLKEVSETYETFCDSLSLICTKFSKSLTSSNYSSDFLDLWNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQYQLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQREIIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINFVRQLNTNQAVSYWRREQFLPPDGDCPEILARDDVISDKLTVEPLQHIRSGLLKEQNELLSFISQNGDVISTLKGLKTNGFSYSRSFEKLYELDDDICRKQNEVRMAQVQVAGVIAQLQHIDNKKFSGFALKDEEDTGMKRIWKKAVFSLKRDKGSKNQSILKNIKKESFRPASSPLQNTFQNDDSKVDPVYHLLRCAASKSHLSSFQCDLRDSNSSPTPKYNEMAFQTSNGRLSLIQTAFNMANLSRRRLLLCQTKAKSSSVEEGGQVGDDKILNSSNLHSHWLDTINTDSRENSHRGSVSKPNNYIKSSIPINNQKCVKGKLKTMFHSATVSQPPDEQLLDKGISKSPVFHSDIMHRKLNERMKSFSVDNPDKVSNTASSPPSISRDNRKMSSSYTNTKLYDSNVPISPRRRKTLYGRKKSCSLDQENHATSRRVAFADESMTRKADRSYDNSIFLDHNEKSFKTSNEMISKNRRNSSQTRPFYNSWRVKSFSLDMPEKEENSESEINHQTFPTNSNXXXXXXXXXXXXXSYSPKHDSKRLDRISESQEKSLSMEIDNQIEVNNKNNLKVLTHQKEHIEENISKQYTKKLGYRLRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKVVDNY 3146
            MAACAHNMTYRDLAHASYHGAIHQKMQESMNIIDNVNQLLKEVSETYETFCDSLSLICTKFSKSLTSSNYSSDFLDLWNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQYQLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQREIIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINFVRQLNTNQAVSYWRREQFLPPDGDCPEILARDDVISDKLTVEPLQHIRSGLLKEQNELLSFISQNGDVISTLKGLKTNGFSYSRSFEKLYELDDDICRKQNEVRMAQVQVAGVIAQLQHIDNKKFSGFALKDEEDTGMKRIWKKAVFSLKRDKGSKNQSILKNIKKESFRPASSPLQNTFQNDDSKVDPVYHLLRCAASKSHLSSFQCDLRDSNSSPTPKYNEMAFQTSNGRLSLIQTAFNMANLSRRRLLLCQTKAKSSSVEEGGQVGDDKILNSSNLHSHW                                      K++  FHSATVSQPPDEQLLDKGISKSPVFHSDIMHRKLNERMKSFSVDNPD VSNTASSPPSISRDNRKMSSSYTNTKLYDSNVPISPRRRKTLYGRKKSCSLDQE+HATSRRVAFADESMTRKADRSYDNSIFLDHNEKSFKTSNEMISKNRRNSSQTRPFYNSWRVKSFSLDMPEKEENSESEINHQTFPTNSNLLTPTTVGTTGTLSYSPKHDSKRLDRISESQEKSLSMEIDNQIEVNNKNNLKVLTHQKEHIEEN+SKQYTKKLGYRLRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKVVDNY
Sbjct:    1 MAACAHNMTYRDLAHASYHGAIHQKMQESMNIIDNVNQLLKEVSETYETFCDSLSLICTKFSKSLTSSNYSSDFLDLWNLLLQYFSSEAQIYHEFCDDFDSLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQYQLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELETIQREIIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINFVRQLNTNQAVSYWRREQFLPPDGDCPEILARDDVISDKLTVEPLQHIRSGLLKEQNELLSFISQNGDVISTLKGLKTNGFSYSRSFEKLYELDDDICRKQNEVRMAQVQVAGVIAQLQHIDNKKFSGFALKDEEDTGMKRIWKKAVFSLKRDKGSKNQSILKNIKKESFRPASSPLQNTFQNDDSKVDPVYHLLRCAASKSHLSSFQCDLRDSNSSPTPKYNEMAFQTSNGRLSLIQTAFNMANLSRRRLLLCQTKAKSSSVEEGGQVGDDKILNSSNLHSHW--------------------------------------KIENHFHSATVSQPPDEQLLDKGISKSPVFHSDIMHRKLNERMKSFSVDNPDNVSNTASSPPSISRDNRKMSSSYTNTKLYDSNVPISPRRRKTLYGRKKSCSLDQESHATSRRVAFADESMTRKADRSYDNSIFLDHNEKSFKTSNEMISKNRRNSSQTRPFYNSWRVKSFSLDMPEKEENSESEINHQTFPTNSNLLTPTTVGTTGTLSYSPKHDSKRLDRISESQEKSLSMEIDNQIEVNNKNNLKVLTHQKEHIEENLSKQYTKKLGYRLRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKVVDNY 930          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Planmine SMEST
Match: SMESG000039140.1 (SMESG000039140.1)

HSP 1 Score: 186.808 bits (473), Expect = 7.384e-50
Identity = 131/380 (34.47%), Postives = 208/380 (54.74%), Query Frame = 3
Query: 2055 IMHRKLNERMKSFSVDNPDKVSNTASSP--PSISRDNRKMSSSYTNTKLYDSNVPISPRRRKTLYGRKKSCSLDQENHA----------TSRRVAFADESMTRKADRSYDNSIFLDHNEKSFKTSNEMISKNRRNSSQTRPFYNSWRVKSFSLDMPEKEEN-SESEINHQTFPTNSNXXXXXXXXXXXXXSY-SPKHDSKRLDRISESQEKSLSMEIDNQIEVNNKNNLKVLTHQKEHIEENISKQYTKKL--GYRLRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQAIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKINTTFWCPIDCVTKVVDNY 3146
            +  R+L+ RMKS SVDNP+   +  +     SI   +R+ S+S+TNT   +SN P S  RRK L  + +S S++ E+HA          ++  +  +D    R++ R Y N I    +++S + S   ++K+   +++T     +W++KSFS+D+P+ + + S S   +     NS+  +P    +    S  SP HD++       S +++      N I   +     + +HQ  H       ++        RL  N YV LYDF+ R+ DEL+L+AGWKV+ ++ SD DWWTG+CNG+ GYFPA YVQ IH G  VW+++R++S+ D +    +L K +I+VQ GSQD + I I  K  +  WCPID V K+ D+Y
Sbjct:  195 VPRRRLDARMKSLSVDNPEVEIHEENEDIDDSIYHQSRQFSNSFTNTNAIESN-PYS-MRRKYLKEQHRSISMENEHHAIVTSSCENYRSNSSIKSSDVISPRQSSR-YINVI----SDESKRNSQSSVTKSNLRTTRT-----NWKMKSFSVDVPDGDVDISASSSQYILKGGNSHTSSPIREKSNYYKSSDSPGHDNRSSHSNLYSAKRAPRPNYHNPISPESL----IASHQARHNPCRYDPEFDNNPVDHKRLSTNSYVVLYDFYARRSDELDLKAGWKVNVLNSSDPDWWTGRCNGRIGYFPAAYVQKIHYGNSVWKIVRDISLNDDDGNTFKLRKGEIVVQQGSQDSESIPICIKRVSYLWCPIDYVGKIFDDY 558          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Planmine SMEST
Match: SMESG000038704.1 (SMESG000038704.1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.199e-10
Identity = 39/111 (35.14%), Postives = 64/111 (57.66%), Query Frame = 3
Query: 2631 ESQEKSLSMEIDNQIEVNNKN-NLKVLTHQKEHI------EENISKQYTKKLGYRLRGNLYVALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQ 2942
            E+Q + ++ +++ Q+E+N  N N     H+++HI      E++  K+          G + VAL+DF   ++DE+N  AG K+  I+  DA WW G+ NG+ G FP+NYVQ
Sbjct:  159 EAQVEHVTRDVE-QLEINEPNRNDDSNEHEQQHIPIVEKEEKHHDKEENVVQAVGNEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQ 268          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Planmine SMEST
Match: SMESG000073128.1 (SMESG000073128.1)

HSP 1 Score: 51.9878 bits (123), Expect = 2.666e-6
Identity = 21/53 (39.62%), Postives = 33/53 (62.26%), Query Frame = 3
Query: 2796 ALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCN--GKFGYFPANYVQAI 2948
            A++++ C+  DE++   G  ++ I+  D  WW G CN  GK G FP+NYV+ I
Sbjct:  561 AVFEYECQDSDEIDFEVGEIITDIEEIDEGWWIG-CNKSGKRGMFPSNYVELI 612          
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Planmine SMEST
Match: SMESG000059156.1 (SMESG000059156.1)

HSP 1 Score: 47.7506 bits (112), Expect = 8.449e-6
Identity = 37/113 (32.74%), Postives = 56/113 (49.56%), Query Frame = 3
Query: 1284 RKQNEVRMAQVQVAGVIAQLQHIDNKKFSG-------FALKDEEDTGM-KRIWKKAVFSLKRDKGSKNQSILKNIKKESFRPASSPLQNTFQNDDSKVDPVYHLLRCAASKSH 1598
            R  N  R+  +Q++   + L  ID+K F         ++ + E DT   K  W +A+ SLKR    K ++  K + K    P  S  +     ++S VDPVYHLLRCA+  +H
Sbjct:   42 RYLNSKRLLNMQLSKSESYLNKIDSKYFHSNESTQRKYSHEGEPDTKNDKPFWSQAIVSLKR----KQEAFFKKLPK----PHQS--EEVPVVEESTVDPVYHLLRCASYTAH 144          
The following BLAST results are available for this feature:
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STAC23.280e-1636.21SH3 and cysteine rich domain 2 [Source:HGNC Symbol... [more]
STAC37.458e-1634.78SH3 and cysteine rich domain 3 [Source:HGNC Symbol... [more]
STAC32.047e-1434.78SH3 and cysteine rich domain 3 [Source:HGNC Symbol... [more]
STAC33.227e-1438.38SH3 and cysteine rich domain 3 [Source:HGNC Symbol... [more]
STAC6.281e-1437.76SH3 and cysteine rich domain [Source:HGNC Symbol;A... [more]
back to top
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itsn-13.822e-742.31ITSN (Intersectin) family [Source:UniProtKB/TrEMB... [more]
itsn-13.918e-742.31ITSN (Intersectin) family [Source:UniProtKB/TrEMB... [more]
itsn-14.993e-742.31ITSN (Intersectin) family [Source:UniProtKB/TrEMB... [more]
itsn-15.033e-742.31ITSN (Intersectin) family [Source:UniProtKB/TrEMB... [more]
itsn-18.294e-742.31ITSN (Intersectin) family [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stacl2.416e-2324.94gene:FBgn0263980 transcript:FBtr0344200[more]
Stacl5.718e-2324.94gene:FBgn0263980 transcript:FBtr0344202[more]
Stacl6.659e-2324.94gene:FBgn0263980 transcript:FBtr0475071[more]
Stacl7.255e-2324.94gene:FBgn0263980 transcript:FBtr0330007[more]
Stacl7.802e-2324.94gene:FBgn0263980 transcript:FBtr0344206[more]
back to top
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stac37.499e-1232.14SH3 and cysteine rich domain 3 [Source:NCBI gene;A... [more]
stac37.499e-1232.14SH3 and cysteine rich domain 3 [Source:NCBI gene;A... [more]
stac37.571e-1232.73SH3 and cysteine rich domain 3 [Source:NCBI gene;A... [more]
grap2a2.056e-845.10GRB2 related adaptor protein 2a [Source:ZFIN;Acc:Z... [more]
stac5.254e-830.48SH3 and cysteine rich domain [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stac31.251e-1433.33SH3 and cysteine rich domain 3 [Source:NCBI gene;A... [more]
stac32.109e-1433.33SH3 and cysteine rich domain 3 [Source:NCBI gene;A... [more]
STAC23.844e-1330.43SH3 and cysteine rich domain 2 [Source:NCBI gene;A... [more]
hcls12.899e-742.59hematopoietic cell-specific Lyn substrate 1 [Sourc... [more]
adamts84.194e-744.00ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stac31.594e-1434.78SH3 and cysteine rich domain 3 [Source:MGI Symbol;... [more]
Stac31.594e-1434.78SH3 and cysteine rich domain 3 [Source:MGI Symbol;... [more]
Stac23.858e-1437.50SH3 and cysteine rich domain 2 [Source:MGI Symbol;... [more]
Stac2.182e-1337.37src homology three (SH3) and cysteine rich domain ... [more]
Grap24.269e-949.02GRB2-related adaptor protein 2 [Source:MGI Symbol;... [more]
back to top
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZMT1|STAC2_HUMAN1.575e-1536.21SH3 and cysteine-rich domain-containing protein 2 ... [more]
sp|A0JNJ1|STAC_BOVIN2.761e-1439.80SH3 and cysteine-rich domain-containing protein OS... [more]
sp|Q68F99|STAC3_XENTR7.162e-1433.33SH3 and cysteine-rich domain-containing protein 3 ... [more]
sp|Q96MF2|STAC3_HUMAN9.829e-1434.78SH3 and cysteine-rich domain-containing protein 3 ... [more]
sp|Q8BZ71|STAC3_MOUSE1.115e-1334.78SH3 and cysteine-rich domain-containing protein 3 ... [more]
back to top
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DES41.043e-4630.77Tyrosine-kinase Fes Fps-like isoform X5 OS=Schisto... [more]
A0A183LF271.017e-4428.42Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A3Q0KT186.432e-4329.00Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A1S3JKS61.321e-4223.56uncharacterized protein LOC106174122 isoform X5 OS... [more]
A0A430QJV21.460e-4027.17Uncharacterized protein (Fragment) OS=Schistosoma ... [more]
back to top
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STAC38.213e-1631.65SH3 and cysteine rich domain 3 [Source:NCBI gene;A... [more]
STAC22.428e-1342.35SH3 and cysteine rich domain 2 [Source:HGNC Symbol... [more]
grap2a1.667e-948.28GRB2-related adapter protein-like [Source:NCBI gen... [more]
grap2a1.667e-948.28GRB2-related adapter protein-like [Source:NCBI gen... [more]
grap2a2.484e-949.02GRB2-related adapter protein-like [Source:NCBI gen... [more]
back to top
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009546.14.326e-1438.89pep scaffold:Pmarinus_7.0:GL485512:1487:9666:1 gen... [more]
stac35.553e-1336.67SH3 and cysteine rich domain 3 [Source:NCBI gene;A... [more]
stac2.299e-1131.03SH3 and cysteine rich domain [Source:ZFIN;Acc:ZDB-... [more]
stam1.253e-846.00signal transducing adaptor molecule (SH3 domain an... [more]
grb2a2.963e-845.83growth factor receptor-bound protein 2a [Source:ZF... [more]
back to top
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PIN31.760e-935.96Negative regulator of actin nucleation-promoting f... [more]
LSB11.267e-848.08Negative regulator of actin nucleation-promoting f... [more]
YSC845.252e-848.08Actin-binding protein; involved in bundling of act... [more]
LSB37.174e-844.44Protein containing a C-terminal SH3 domain; binds ... [more]
HSE13.188e-741.18Subunit of the endosomal Vps27p-Hse1p complex; com... [more]
back to top
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO363034.684e-1522.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500329.204e-744.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463571.462e-643.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380761.575e-642.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298641.648e-643.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STAC22.143e-1429.38SH3 and cysteine-rich domain-containing protein 2 ... [more]
STAC24.315e-1335.34SH3 and cysteine-rich domain-containing protein 2 ... [more]
stac38.845e-1332.17SH3 and cysteine rich domain 3 [Source:NCBI gene;A... [more]
stac31.377e-1233.98SH3 and cysteine rich domain 3 [Source:NCBI gene;A... [more]
stac32.188e-1233.98SH3 and cysteine rich domain 3 [Source:NCBI gene;A... [more]
back to top
BLAST of Tyrosine-kinase Fes Fps-like isoform X5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047737.10.000e+095.35SMESG000047737.1[more]
SMESG000039140.17.384e-5034.47SMESG000039140.1[more]
SMESG000038704.12.199e-1035.14SMESG000038704.1[more]
SMESG000073128.12.666e-639.62SMESG000073128.1[more]
SMESG000059156.18.449e-632.74SMESG000059156.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035381 ID=SMED30035381|Name=Tyrosine-kinase Fes Fps-like isoform X5|organism=Schmidtea mediterranea sexual|type=transcript|length=3201bp
CTGCCAACATCAAAAATTCACATCAACATTTTTTAGTTGTTTAATTGTAA
AAAAAATATAAGCTAACGTCGAATCAAGCCAAAAATAAATTGTCTGTCAA
TGTCAACTGTTTTCGATGAGTTCCTGTGTTGACCAATCAACTTGATCATT
TGATATAGATTTCAATTCCATTCCGTAAAATCGAATCAATTACATTCCAA
TCATTTATCGAAGAGAACTCAATTCCTATTTTTAACAAACAAATGGCAGC
CTGTGCTCACAACATGACCTATAGAGATCTGGCACATGCATCGTATCACG
GTGCTATACATCAAAAAATGCAGGAATCCATGAATATCATTGACAATGTT
AATCAATTATTAAAAGAAGTCAGTGAAACCTATGAAACATTTTGCGATAG
TTTGTCGTTAATATGTACAAAGTTCTCAAAGTCTTTAACAAGCTCAAATT
ATTCATCAGATTTTCTTGATTTGTGGAATTTATTATTACAATATTTTTCA
TCAGAAGCACAGATTTACCATGAATTCTGTGATGATTTTGACAGTCTCGT
GTGCAATCCTTTGCGAGCTATTTCAGCACATAAAAATAGTCAAAGAGAAA
AGCTTTATGAATTCAGATGCTCAGTGGAGAAAATGCTCAATGATCAATCA
GACACGATGGAACAATTGCATAGAGATTACATTGACCAGTACCAATTACA
GCGAGAAAAATATGATCCGAAACTCATTCCGGGATTATTAAATGCTCATA
ATAATTATGTATTGCAATTGGTTGCCAGTAATAAAATGAAGGATCAGTAT
CACAGTCAAGCTTTGCCAAGTGTCCTAGACGAACTAGAAACTATCCAAAG
AGAAATTATTCAAATATTCCATTCAAGTTTATGTCATTATTCAGGGGCGA
CAGCAAAAAAACACCGACAATTAATTGACTTTCAAGATCAGATACTCTCA
TCTATTAAAAGCCTTTCCCCAGATGACCAAATTATAAATTTTGTTCGTCA
ACTAAATACAAATCAAGCAGTATCATATTGGAGACGTGAGCAATTTTTGC
CTCCAGATGGTGACTGTCCAGAAATTCTTGCTAGAGATGATGTGATATCG
GACAAACTCACAGTGGAACCTCTTCAACATATTCGATCAGGTTTGTTAAA
AGAACAAAATGAACTTTTATCTTTCATTTCACAAAATGGTGATGTTATCA
GTACCCTAAAAGGTTTAAAAACGAACGGATTCTCCTACAGTCGGTCCTTT
GAAAAGTTATACGAATTGGATGATGATATCTGTAGGAAACAAAATGAAGT
TAGAATGGCTCAAGTGCAAGTTGCTGGTGTAATAGCTCAATTACAGCATA
TTGATAACAAGAAATTTTCGGGATTTGCTTTAAAAGACGAGGAAGACACG
GGCATGAAAAGAATATGGAAGAAAGCTGTGTTTTCCTTGAAGAGAGATAA
AGGCAGTAAAAATCAGAGTATTTTAAAGAATATCAAGAAAGAATCTTTTC
GTCCGGCCAGCAGTCCGTTACAAAACACTTTTCAAAATGATGATTCAAAA
GTCGACCCAGTTTATCATCTTCTTCGATGTGCAGCATCAAAAAGTCATTT
GTCAAGCTTTCAATGTGATTTGCGAGACTCGAATTCCAGTCCAACTCCCA
AATACAATGAAATGGCATTCCAAACTAGTAATGGACGTTTATCATTGATA
CAAACGGCATTTAACATGGCAAACCTAAGTAGGAGACGACTACTGCTTTG
CCAAACGAAGGCCAAGTCCTCTTCCGTTGAAGAAGGTGGTCAAGTTGGAG
ACGATAAAATCCTGAATTCGTCAAATTTGCATAGTCATTGGTTAGATACA
ATTAATACGGATTCCAGAGAGAACTCTCACAGGGGTTCCGTTTCGAAGCC
TAATAACTATATAAAATCTTCAATACCTATCAATAATCAAAAATGTGTTA
AAGGAAAATTGAAAACCATGTTTCATTCAGCTACTGTTTCACAACCTCCC
GATGAACAGTTGCTTGACAAAGGCATTTCTAAAAGTCCAGTATTCCATTC
TGATATTATGCACCGAAAACTTAATGAAAGAATGAAAAGTTTCTCGGTAG
ATAACCCTGACAAAGTCAGCAACACAGCAAGTTCGCCTCCTTCGATTTCT
CGGGACAATCGCAAGATGAGCAGTTCTTATACAAATACCAAATTATATGA
TTCCAATGTACCAATAAGTCCAAGGCGCAGAAAAACACTTTATGGAAGAA
AAAAAAGCTGTTCACTGGACCAAGAAAATCATGCGACAAGTCGCAGGGTC
GCATTTGCTGACGAAAGTATGACGCGGAAAGCTGATAGATCCTATGACAA
TTCTATATTTTTGGATCACAATGAAAAATCTTTTAAAACAAGCAATGAAA
TGATTTCTAAAAATCGAAGAAATTCAAGTCAGACGCGGCCGTTTTATAAT
TCATGGAGAGTTAAAAGTTTTTCACTTGACATGCCAGAGAAAGAAGAAAA
TAGTGAAAGCGAAATAAATCATCAAACATTTCCTACTAATTCTAATCTTT
TGACACCTACAACAGTCGGCACCACTGGTACTTTATCATATTCTCCAAAG
CATGATTCGAAAAGATTAGATCGTATATCTGAATCTCAAGAAAAAAGCCT
TTCAATGGAAATTGACAATCAAATCGAAGTCAACAATAAGAATAACCTGA
AAGTCCTAACCCATCAGAAAGAGCATATAGAAGAAAATATATCCAAACAA
TACACTAAAAAACTTGGCTATCGGTTGAGAGGAAATTTATACGTGGCATT
GTACGATTTCTGGTGTAGACAGAAAGATGAATTAAATTTGAGAGCCGGCT
GGAAAGTAAGTGCCATTGACATATCTGACGCAGACTGGTGGACAGGAAAG
TGTAACGGAAAATTCGGATATTTTCCTGCAAATTACGTTCAAGCCATTCA
CCAAGGAGAACATGTTTGGCGAGTCATTCGCGAAGTGTCTGTTGTCGATT
CGAATCAAACTCCAGTTAGGTTATATAAAAATCAAATCCTTGTACAAACT
GGTTCACAAGATGGCGATCAGATTCTTATTCGTACAAAGATAAACACAAC
ATTTTGGTGTCCTATTGATTGTGTTACAAAAGTGGTTGATAATTATTAAA
ATTTTGTTTTTATTTTTTTATTGAAAAATGTGCAGATGTTTGTAAAATTT
T
back to top

protein sequence of SMED30035381-orf-1

>SMED30035381-orf-1 ID=SMED30035381-orf-1|Name=SMED30035381-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=969bp
MAACAHNMTYRDLAHASYHGAIHQKMQESMNIIDNVNQLLKEVSETYETF
CDSLSLICTKFSKSLTSSNYSSDFLDLWNLLLQYFSSEAQIYHEFCDDFD
SLVCNPLRAISAHKNSQREKLYEFRCSVEKMLNDQSDTMEQLHRDYIDQY
QLQREKYDPKLIPGLLNAHNNYVLQLVASNKMKDQYHSQALPSVLDELET
IQREIIQIFHSSLCHYSGATAKKHRQLIDFQDQILSSIKSLSPDDQIINF
VRQLNTNQAVSYWRREQFLPPDGDCPEILARDDVISDKLTVEPLQHIRSG
LLKEQNELLSFISQNGDVISTLKGLKTNGFSYSRSFEKLYELDDDICRKQ
NEVRMAQVQVAGVIAQLQHIDNKKFSGFALKDEEDTGMKRIWKKAVFSLK
RDKGSKNQSILKNIKKESFRPASSPLQNTFQNDDSKVDPVYHLLRCAASK
SHLSSFQCDLRDSNSSPTPKYNEMAFQTSNGRLSLIQTAFNMANLSRRRL
LLCQTKAKSSSVEEGGQVGDDKILNSSNLHSHWLDTINTDSRENSHRGSV
SKPNNYIKSSIPINNQKCVKGKLKTMFHSATVSQPPDEQLLDKGISKSPV
FHSDIMHRKLNERMKSFSVDNPDKVSNTASSPPSISRDNRKMSSSYTNTK
LYDSNVPISPRRRKTLYGRKKSCSLDQENHATSRRVAFADESMTRKADRS
YDNSIFLDHNEKSFKTSNEMISKNRRNSSQTRPFYNSWRVKSFSLDMPEK
EENSESEINHQTFPTNSNLLTPTTVGTTGTLSYSPKHDSKRLDRISESQE
KSLSMEIDNQIEVNNKNNLKVLTHQKEHIEENISKQYTKKLGYRLRGNLY
VALYDFWCRQKDELNLRAGWKVSAIDISDADWWTGKCNGKFGYFPANYVQ
AIHQGEHVWRVIREVSVVDSNQTPVRLYKNQILVQTGSQDGDQILIRTKI
NTTFWCPIDCVTKVVDNY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
GO:0035556intracellular signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001452SH3_domain
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular