histone deacetylase 1

Overview
Namehistone deacetylase 1 (AGY34711.1)
Smed IDSMED30035373
Length (bp)1510
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of histone deacetylase 1 (SMED30035373) t-SNE clustered cells

Violin plots show distribution of expression levels for histone deacetylase 1 (SMED30035373) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of histone deacetylase 1 (SMED30035373) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for histone deacetylase 1 (SMED30035373) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035373

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30035373SMESG000060876.1 HDAC1smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30035373SMESG000060876.1 HDAC1smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30035373SMESG000060876.1 SmedASXL_004281SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035373SMESG000060876.1 SmedASXL_004281SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30035373SMESG000060876.1 dd_Smed_v4_695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30035373SMESG000060876.1 dd_Smed_v4_695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035373SMESG000060876.1 dd_Smed_v4_695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035373SMESG000060876.1 dd_Smed_v4_695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035373SMESG000060876.1 dd_Smed_v4_695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035373SMESG000060876.1 dd_Smed_v4_695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035373SMESG000060876.1 dd_Smed_v4_695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035373SMESG000060876.1 dd_Smed_v4_695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035373SMESG000060876.1 dd_Smed_v4_695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035373SMESG000060876.1 dd_Smed_v4_695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035373SMESG000060876.1 dd_Smed_v4_695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035373SMESG000060876.1 dd_Smed_v4_695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30035373SMESG000060876.1 isotig10381be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30035373SMESG000060876.1 dd_Smed_v6_695_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 1 cellSMED30035373SMESG000060876.1 H.9.4hsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 1 cellSMED30035373SMESG000060876.1 H.9.4hsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of histone deacetylase 1 vs. Ensembl Human
Match: HDAC2 (histone deacetylase 2 [Source:HGNC Symbol;Acc:HGNC:4853])

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 346/463 (74.73%), Postives = 399/463 (86.18%), Query Frame = -3
Query:   75 RKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK--SKRPRLDGPNSGTGD-SLDKANEDLASTN 1451
            +KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KATA++MT +H+DEYI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLN+ + D+A+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVNFP+RDGIDDESY  IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVE ++   +PLLMLGGGGYTIRNVARCWTYETA+AL   IPNELPYNDY+EYF PDFKLHISPSNM NQNTPEY+E++KQ+LFENLR +PHAP VQMQ IPEDA+  D G++ D  DPDKRISI ASDK    + + SDSEDEG+  R+NV   K  +K+ R++     T D   D   ED +  N
Sbjct:    9 KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDE-DGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDN 470          
BLAST of histone deacetylase 1 vs. Ensembl Human
Match: HDAC1 (histone deacetylase 1 [Source:HGNC Symbol;Acc:HGNC:4852])

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 326/407 (80.10%), Postives = 371/407 (91.15%), Query Frame = -3
Query:  234 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDK 1454
             R+KVCYYYDGD+GNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA A++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVASAVKLNK + DIA+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKPV+ KV+E F+P+A+VLQCG+DSLSGDRLGCFNL++KGH KCVE+++   +P+LMLGGGGYTIRNVARCWTYETA+AL T IPNELPYNDY+EYF PDFKLHISPSNM NQNT EYLE++KQ+LFENLR +PHAP VQMQ IPEDA+  +     D  DPDKRISI +SDK
Sbjct:    7 TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEES-GDEDEDDPDKRISICSSDK 412          
BLAST of histone deacetylase 1 vs. Ensembl Human
Match: HDAC2 (histone deacetylase 2 [Source:HGNC Symbol;Acc:HGNC:4853])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 325/441 (73.70%), Postives = 377/441 (85.49%), Query Frame = -3
Query:   75 MKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK--SKRPRLDGPNSGTGD-SLDKANEDLASTN 1385
            MKPHRIRMTHNLLLNYGLYRKME+Y+P KATA++MT +H+DEYI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLN+ + D+A+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVNFP+RDGIDDESY  IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVE ++   +PLLMLGGGGYTIRNVARCWTYETA+AL   IPNELPYNDY+EYF PDFKLHISPSNM NQNTPEY+E++KQ+LFENLR +PHAP VQMQ IPEDA+  D G++ D  DPDKRISI ASDK    + + SDSEDEG+  R+NV   K  +K+ R++     T D   D   ED +  N
Sbjct:    1 MKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDE-DGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDN 440          
BLAST of histone deacetylase 1 vs. Ensembl Human
Match: HDAC2 (histone deacetylase 2 [Source:HGNC Symbol;Acc:HGNC:4853])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 325/441 (73.70%), Postives = 377/441 (85.49%), Query Frame = -3
Query:   75 MKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK--SKRPRLDGPNSGTGD-SLDKANEDLASTN 1385
            MKPHRIRMTHNLLLNYGLYRKME+Y+P KATA++MT +H+DEYI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLN+ + D+A+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVNFP+RDGIDDESY  IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVE ++   +PLLMLGGGGYTIRNVARCWTYETA+AL   IPNELPYNDY+EYF PDFKLHISPSNM NQNTPEY+E++KQ+LFENLR +PHAP VQMQ IPEDA+  D G++ D  DPDKRISI ASDK    + + SDSEDEG+  R+NV   K  +K+ R++     T D   D   ED +  N
Sbjct:    1 MKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDE-DGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDN 440          
BLAST of histone deacetylase 1 vs. Ensembl Human
Match: HDAC3 (histone deacetylase 3 [Source:HGNC Symbol;Acc:HGNC:4854])

HSP 1 Score: 494.582 bits (1272), Expect = 9.436e-173
Identity = 236/380 (62.11%), Postives = 301/380 (79.21%), Query Frame = -3
Query:  258 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEY-FPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSN-MANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKR 1391
            HPMKPHR+ +TH+L+L+YGLY+KM V+KP +A+  DM  FH+++YI FLQR+ P NM  + K +  FNVG+DCPVF GLFEFC    G S+  A +LN    DIAINW+GGLHHAKK EASGFCYVNDIV+GILELLKYH RVLY+DIDIHHGDGV+EAFY TDRVMTVSFHKYG Y FPGTGD+ ++GA  G+ Y +N PLRDGIDD+SY+ +F+PV+ +V++ ++P  IVLQCGADSL  DRLGCFNLS++GHG+CVEY++   IPLL+LGGGGYT+RNVARCWTYET+L +   I  ELPY++Y+EYF PDF LH   S  + NQN+ +YL++++Q +FENL+ + HAPSVQ+ D+P D +  D   + D AD ++R
Sbjct:   22 HPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYD---RTDEADAEER 398          
BLAST of histone deacetylase 1 vs. Ensembl Celegans
Match: hda-1 (Histone deacetylase 1 [Source:UniProtKB/Swiss-Prot;Acc:O17695])

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 268/408 (65.69%), Postives = 333/408 (81.62%), Query Frame = -3
Query:  174 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDI--DDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKN 1391
            H MKPHRIRMTH+L+LNYGLYR +E+++P  A+ +DMT FH+DEY+ FL+  +PDN+  +NK+M +FNVGEDCP+FDGL+EFCQLS+GGS+A+A KLNK K DIAINW GGLHHAKKSEASGFCY NDIV+GILELLKYH+RVLYVDID+HHGDGVEEAFYTTDRVMTVSFHKYG++FPGTGD+KDIGAGKGK Y+VN PLRDGI D SY+SIFKP++ KV+E F P A+VLQCGADSL+GDRLG FNL+LKGHG+C  + R   +PL+M+GGGGYT RNVARCWTYET++A+   +PNELPYNDY+EYF P+++LHI  SN AN+N+ + L +++  +  NL  +   PSVQM+ IPEDA+    DD    D A+PDKR+    +D   + + D  D E EGD+R+N
Sbjct:   32 HVMKPHRIRMTHHLVLNYGLYRNLEIFRPFPASFEDMTRFHSDEYMTFLKSANPDNLKSFNKQMLKFNVGEDCPLFDGLYEFCQLSSGGSLAAATKLNKQKVDIAINWMGGLHHAKKSEASGFCYTNDIVLGILELLKYHKRVLYVDIDVHHGDGVEEAFYTTDRVMTVSFHKYGDFFPGTGDLKDIGAGKGKLYSVNVPLRDGITDVSYQSIFKPIMTKVMERFDPCAVVLQCGADSLNGDRLGPFNLTLKGHGECARFFRSYNVPLMMVGGGGYTPRNVARCWTYETSIAVDKEVPNELPYNDYFEYFGPNYRLHIESSNAANENSSDMLAKLQTDVIANLEQLTFVPSVQMRPIPEDALSALNDDSLIADQANPDKRLPPQITDGMIQDDGDFYDGEREGDDRRN 439          
BLAST of histone deacetylase 1 vs. Ensembl Celegans
Match: hda-3 (Histone deacetylase [Source:UniProtKB/TrEMBL;Acc:G5ECH0])

HSP 1 Score: 512.301 bits (1318), Expect = 1.489e-179
Identity = 249/436 (57.11%), Postives = 330/436 (75.69%), Query Frame = -3
Query:  135 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISP-SNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDI----DDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKS------------KRPRLDG 1391
            HPMKPHR+RMTH+L++NYGLYRK+ V +P++A+  ++T +H+D+YI FL+ +  DNM  +  +M RF+VGEDCPVFDG++EFCQLS GGS+A+A +LN+ +++IAINW GGLHHAKKSEASGFCY NDIV+ ILELLK+H+RVLY+DID+HHGDGVEEAFYTTDRVMTVSFHK+GEYFPGTGD+KD+GAG GK YA+N PLRDG+DD +YE IF+ ++ +V+  F+P A+VLQCGADSL+GDRLG FNL+  GHGKCVEYM+   +PLL++GGGGYTIRNV+RCW YETA+AL   + ++LP +DY++YF PD+KLHI P + ++N NTPE++++    L ENL+ +PH PSVQMQ I      I    D+    D+ + D R++    D   E  A+  D ++     KN+   K             K+ R+DG
Sbjct:   27 HPMKPHRVRMTHSLIVNYGLYRKLNVMRPARASFSEITRYHSDDYINFLRNVKSDNMSTFTDQMARFSVGEDCPVFDGMYEFCQLSCGGSLAAAARLNRQESEIAINWMGGLHHAKKSEASGFCYSNDIVLAILELLKHHKRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKHGEYFPGTGDLKDVGAGSGKYYALNVPLRDGVDDVTYERIFRTIMGEVMARFQPEAVVLQCGADSLAGDRLGVFNLTTYGHGKCVEYMKSFNVPLLLVGGGGYTIRNVSRCWLYETAIALNQEVSDDLPLHDYFDYFIPDYKLHIKPLAALSNFNTPEFIDQTIVALLENLKQLPHVPSVQMQSISTSCDSIVKTFDEKLIRDHQNDDVRVTQFEEDVQVEDSAEFYDGQEP--ETKNIQSMKRHASPICAAQEEMKKNRIDG 460          
BLAST of histone deacetylase 1 vs. Ensembl Celegans
Match: hda-3 (Histone deacetylase [Source:UniProtKB/TrEMBL;Acc:G5ECH0])

HSP 1 Score: 512.301 bits (1318), Expect = 1.489e-179
Identity = 249/436 (57.11%), Postives = 330/436 (75.69%), Query Frame = -3
Query:  135 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISP-SNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDI----DDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKS------------KRPRLDG 1391
            HPMKPHR+RMTH+L++NYGLYRK+ V +P++A+  ++T +H+D+YI FL+ +  DNM  +  +M RF+VGEDCPVFDG++EFCQLS GGS+A+A +LN+ +++IAINW GGLHHAKKSEASGFCY NDIV+ ILELLK+H+RVLY+DID+HHGDGVEEAFYTTDRVMTVSFHK+GEYFPGTGD+KD+GAG GK YA+N PLRDG+DD +YE IF+ ++ +V+  F+P A+VLQCGADSL+GDRLG FNL+  GHGKCVEYM+   +PLL++GGGGYTIRNV+RCW YETA+AL   + ++LP +DY++YF PD+KLHI P + ++N NTPE++++    L ENL+ +PH PSVQMQ I      I    D+    D+ + D R++    D   E  A+  D ++     KN+   K             K+ R+DG
Sbjct:   27 HPMKPHRVRMTHSLIVNYGLYRKLNVMRPARASFSEITRYHSDDYINFLRNVKSDNMSTFTDQMARFSVGEDCPVFDGMYEFCQLSCGGSLAAAARLNRQESEIAINWMGGLHHAKKSEASGFCYSNDIVLAILELLKHHKRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKHGEYFPGTGDLKDVGAGSGKYYALNVPLRDGVDDVTYERIFRTIMGEVMARFQPEAVVLQCGADSLAGDRLGVFNLTTYGHGKCVEYMKSFNVPLLLVGGGGYTIRNVSRCWLYETAIALNQEVSDDLPLHDYFDYFIPDYKLHIKPLAALSNFNTPEFIDQTIVALLENLKQLPHVPSVQMQSISTSCDSIVKTFDEKLIRDHQNDDVRVTQFEEDVQVEDSAEFYDGQEP--ETKNIQSMKRHASPICAAQEEMKKNRIDG 460          
BLAST of histone deacetylase 1 vs. Ensembl Celegans
Match: hda-2 (Putative histone deacetylase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q09440])

HSP 1 Score: 376.711 bits (966), Expect = 9.456e-126
Identity = 193/373 (51.74%), Postives = 260/373 (69.71%), Query Frame = -3
Query:  279 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPD-NMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYE-YFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMD 1391
            HPMKP R+ + ++L+++Y + + M V +  K  A D+++FHT++Y+ FLQ + P   +   +  +++FN+GEDCP+F GL+++C L AGGSV  A +LN    DI INW GGLHHAKKSEASGFCYVNDIV+GILELLKYH+RVLY+DIDIHHGDGV+EAF  +DRVMTVSFH++G+YFPG+G I D G G GK +A+N PL   I DE Y  +F+ V+  V E+F P AIVLQCG+DSL  DRLG F LS   H + V+Y++    PL++LGGGGYT+RNVARCW  ET + LG  + +E+P    Y  YFTP          M + N+  YL  ++++    LR I  APSVQMQ+I    + +D+ EQ++
Sbjct:   48 HPMKPQRLVVCNDLVVSYEMPKYMTVVESPKLDAADISVFHTEDYVNFLQTVTPKLGLTMPDDVLRQFNIGEDCPIFAGLWDYCTLYAGGSVEGARRLNHKMNDIVINWPGGLHHAKKSEASGFCYVNDIVLGILELLKYHKRVLYIDIDIHHGDGVQEAFNNSDRVMTVSFHRFGQYFPGSGSIMDKGVGPGKYFAINVPLMAAIRDEPYLKLFESVISGVEENFNPEAIVLQCGSDSLCEDRLGQFALSFNAHARAVKYVKSLGKPLMVLGGGGYTLRNVARCWALETGVILGLRMDDEIPGTSLYSHYFTPRLLRPNLVPKMNDANSAAYLASIEKETLACLRMIRGAPSVQMQNIV--GIRLDEIEQIE 418          
BLAST of histone deacetylase 1 vs. Ensembl Celegans
Match: hda-10 (Histone deacetylase [Source:UniProtKB/TrEMBL;Acc:Q9U266])

HSP 1 Score: 85.5001 bits (210), Expect = 1.483e-17
Identity = 67/277 (24.19%), Postives = 118/277 (42.60%), Query Frame = -3
Query:  498 KATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSV--ASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDR--VMTVSFHKY--GEYFPXXXXXXXXXXXXXKNY--AVNFPLRD-GIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIP 1301
            +A   ++   HT  Y+  ++      + +      ++   ED  V    +   +L+AG S+   ++V   K      I   G  HHA   E  GFC  N++ +     ++  ++VL VD D+H G+G +E         V  +S H+Y  G ++P              NY   +N PL   G+ D  Y ++F  ++   I +F+P+ +++  G D+  GD  G   ++  G    +  +    IP+  L  GGY +  +A    +     LG  IP
Sbjct:   58 EAEESEILAVHTKRYVDDVKSTETMTVEQQESFCTKY---EDIYVNSATWHRAKLAAGASIDLMTSVMAAKRPGIAFIRPPG--HHAMPDEGCGFCIFNNVAIAAKAAIQNGQKVLIVDYDVHAGNGTQECVEQMGEGNVQLISIHRYENGHFWPNMPQTGIYH-----NYKNTINLPLNTIGLTDADYHALFTHIILPTIHAFQPDLLLVSSGFDASIGDPEGSMQVTPAGFATMIRMLIDTGIPVAALLEGGYFLDALAADSEWVLRALLGEEIP 324          
BLAST of histone deacetylase 1 vs. Ensembl Fly
Match: HDAC1 (gene:FBgn0015805 transcript:FBtr0073317)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 331/461 (71.80%), Postives = 394/461 (85.47%), Query Frame = -3
Query:   93 METPVRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFKS--KRPRLDGPNSGTGDSLDKANE 1466
            M++  +K+VCYYYD DIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KATAD+MT FH+DEY++FL+ I PDNM EYNK+MQRFNVGEDCPVFDGL+EFCQLSAGGSVA+AVKLNK  ++I INW GGLHHAKKSEASGFCYVNDIV+GILELLKYH+RVLY+DID+HHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN PLRDG+DD++YESIF P++ KV+E+F+P A+VLQCGADSL+GDRLGCFNL++KGHGKCVE++++  +P LM+GGGGYTIRNV+RCWTYET++AL   I NELPYNDY+EYF PDFKLHISPSNM NQNT EYLE++K +LFENLR +PHAP VQ+Q IPEDA++ D+ +  D  D D R+     DK    E + SDSEDEG+  R++   +K   KRPRLD   +    S + ++E
Sbjct:    1 MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQAIPEDAIN-DESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRSYKGQRKRPRLDKDTNSNKASSETSSE 460          
BLAST of histone deacetylase 1 vs. Ensembl Fly
Match: HDAC3 (gene:FBgn0025825 transcript:FBtr0078767)

HSP 1 Score: 476.478 bits (1225), Expect = 9.648e-166
Identity = 231/410 (56.34%), Postives = 312/410 (76.10%), Query Frame = -3
Query:  186 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMH----EYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEY-FPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHIS-PSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDD--GEQMDNADPDKRISILASDKYREHEADLSDSEDEGD 1391
            HPMKP R+ +TH+L++NYGL++KM++Y+P KA+A DM  FH+DEYI +LQ++ P N+      Y K +  F+VGEDCPVFDGLF+FC +  G S+  A KLN N +DI INWSGGLHHAKK EASGFCYVNDIV+GILELLKYH RVLY+DID+HHGDGV+EAFY TDRVMT SFHKYG Y FPGTGD+ +IGA  G+ Y+VN PL++GIDD+SY  +FKP++  +++ ++P AIVLQCGADSL+GDRLGCF+LS KGHG+CV+++++  +P L++GGGGYT+RNVARCWT+ET+L +   I N+LP  +YY++F PDF LH    S   N N+ +YLE + + ++ENL+   H+PSVQM   P D +D+++    + + +DPD RIS+   DK  + + +  D + + D
Sbjct:   23 HPMKPQRLAVTHSLVMNYGLHKKMKIYRPYKASAQDMLRFHSDEYIAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGAQKLNHNHSDICINWSGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDVHHGDGVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDQSYFQVFKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTKGHGECVKFVKELNVPTLVVGGGGYTLRNVARCWTHETSLLVDQDIENDLPATEYYDFFAPDFTLHPEINSRQDNANSKQYLELIVKHVYENLKMCQHSPSVQMVQTPPD-VDLEELRSNREEASDPDVRISVADEDKLVDAKNEFYDGDQDQD 431          
BLAST of histone deacetylase 1 vs. Ensembl Fly
Match: HDAC6 (gene:FBgn0026428 transcript:FBtr0301774)

HSP 1 Score: 114.39 bits (285), Expect = 1.908e-26
Identity = 95/359 (26.46%), Postives = 161/359 (44.85%), Query Frame = -3
Query:  354 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCP-VFDGLFEFCQLSAGGSVASAVK--LNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYH--ERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXXXXX--XXXXXXXKNYAVNFPL-RDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIP-LLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHI--SPSNMANQNTPEYLERMKQKLFENLRSI 1391
            HP +P RI+  H +  +YGL ++M+   P  AT D++ + HT  ++  ++R+      E +     +N     P  FD     C   A G V  AV   L         N     HHA++    GFC  N++ +     ++    ERVL VD D+HHG+G +  F +  +V+ +S H+Y  G +FP   D     +G G G+ + VN P  + G+ D  Y   F+ ++  +   F P  +++  G D+  GD LG   ++ +G+G    ++       +++   GGY + +++   T  T   LG  +P            TP         P  +A Q+  E L++  Q    + RS+
Sbjct:  478 HPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFD-----CATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVP------------TPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSL 819          

HSP 2 Score: 87.8113 bits (216), Expect = 6.375e-18
Identity = 81/289 (28.03%), Postives = 134/289 (46.37%), Query Frame = -3
Query:  498 PSK-ATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQ-RFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKAD--IAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYH--ERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXXXX--XXXXXXXXKNYAVNFPLR-DGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGG--------GGYTIRNVARCWTYETALALGTTIP 1307
            PS+ AT D++   HT+E+ + L+        E  +E+  R+   +   +    FE   L++G ++     L   KA   +AI    G HHA K+E +G+C+ N++ +     L  H  +R+L +D D+HHG G +  FY   RV+  S H++  G ++P   +     IG+G G  Y  N PL   G+ +  Y +IF+ ++  V   F+P  I++  G D+     LGC    ++    C  ++     PLL L          GGY + ++A          LG   P
Sbjct:   77 PSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRY---DSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPG-HHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDA----ALGCPEGEMEVTPACYPHLLN---PLLRLADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCP 354          
BLAST of histone deacetylase 1 vs. Ensembl Fly
Match: HDAC6 (gene:FBgn0026428 transcript:FBtr0307384)

HSP 1 Score: 114.39 bits (285), Expect = 2.003e-26
Identity = 85/310 (27.42%), Postives = 145/310 (46.77%), Query Frame = -3
Query:  495 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCP-VFDGLFEFCQLSAGGSVASAVK--LNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYH--ERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXXXXX--XXXXXXXKNYAVNFPL-RDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIP-LLMLGGGGYTIRNVARCWTYETALALGTTIPN 1391
            HP +P RI+  H +  +YGL ++M+   P  AT D++ + HT  ++  ++R+      E +     +N     P  FD     C   A G V  AV   L         N     HHA++    GFC  N++ +     ++    ERVL VD D+HHG+G +  F +  +V+ +S H+Y  G +FP   D     +G G G+ + VN P  + G+ D  Y   F+ ++  +   F P  +++  G D+  GD LG   ++ +G+G    ++       +++   GGY + +++   T  T   LG  +P 
Sbjct:  560 HPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFD-----CATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPT 864          

HSP 2 Score: 88.1965 bits (217), Expect = 5.002e-18
Identity = 81/289 (28.03%), Postives = 134/289 (46.37%), Query Frame = -3
Query:  498 PSK-ATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQ-RFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKAD--IAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYH--ERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXXXX--XXXXXXXXKNYAVNFPLR-DGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGG--------GGYTIRNVARCWTYETALALGTTIP 1307
            PS+ AT D++   HT+E+ + L+        E  +E+  R+   +   +    FE   L++G ++     L   KA   +AI    G HHA K+E +G+C+ N++ +     L  H  +R+L +D D+HHG G +  FY   RV+  S H++  G ++P   +     IG+G G  Y  N PL   G+ +  Y +IF+ ++  V   F+P  I++  G D+     LGC    ++    C  ++     PLL L          GGY + ++A          LG   P
Sbjct:  159 PSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRY---DSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPG-HHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAA----LGCPEGEMEVTPACYPHLLN---PLLRLADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCP 436          
BLAST of histone deacetylase 1 vs. Ensembl Fly
Match: HDAC6 (gene:FBgn0026428 transcript:FBtr0307383)

HSP 1 Score: 114.005 bits (284), Expect = 2.484e-26
Identity = 95/359 (26.46%), Postives = 161/359 (44.85%), Query Frame = -3
Query:  354 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCP-VFDGLFEFCQLSAGGSVASAVK--LNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYH--ERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXXXXX--XXXXXXXKNYAVNFPL-RDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIP-LLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHI--SPSNMANQNTPEYLERMKQKLFENLRSI 1391
            HP +P RI+  H +  +YGL ++M+   P  AT D++ + HT  ++  ++R+      E +     +N     P  FD     C   A G V  AV   L         N     HHA++    GFC  N++ +     ++    ERVL VD D+HHG+G +  F +  +V+ +S H+Y  G +FP   D     +G G G+ + VN P  + G+ D  Y   F+ ++  +   F P  +++  G D+  GD LG   ++ +G+G    ++       +++   GGY + +++   T  T   LG  +P            TP         P  +A Q+  E L++  Q    + RS+
Sbjct:  533 HPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFD-----CATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVP------------TPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSL 874          

HSP 2 Score: 87.4261 bits (215), Expect = 9.268e-18
Identity = 81/289 (28.03%), Postives = 134/289 (46.37%), Query Frame = -3
Query:  498 PSK-ATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQ-RFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKAD--IAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYH--ERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXXXX--XXXXXXXXKNYAVNFPLR-DGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGG--------GGYTIRNVARCWTYETALALGTTIP 1307
            PS+ AT D++   HT+E+ + L+        E  +E+  R+   +   +    FE   L++G ++     L   KA   +AI    G HHA K+E +G+C+ N++ +     L  H  +R+L +D D+HHG G +  FY   RV+  S H++  G ++P   +     IG+G G  Y  N PL   G+ +  Y +IF+ ++  V   F+P  I++  G D+     LGC    ++    C  ++     PLL L          GGY + ++A          LG   P
Sbjct:  132 PSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRY---DSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPG-HHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAA----LGCPEGEMEVTPACYPHLLN---PLLRLADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCP 409          
BLAST of histone deacetylase 1 vs. Ensembl Zebrafish
Match: hdac1 (histone deacetylase 1 [Source:ZFIN;Acc:ZDB-GENE-020419-32])

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 338/436 (77.52%), Postives = 388/436 (88.99%), Query Frame = -3
Query:  150 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFKSKR 1454
             +KKVCYYYDGD+GNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA A++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLNK + DIAINW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVEYM+   +PLLMLGGGGYTIRNVARCWT+ETA+AL +TIPNELPYNDY+EYF PDFKLHISPSNM NQNT +YLE++KQ+LFENLR +PHAP VQMQ IPEDA+  D G++ D  DPDKRISI A DK    + + SDSEDEG   R+N   +K  +
Sbjct:    8 TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPIMSKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYMKSFNLPLLMLGGGGYTIRNVARCWTFETAVALDSTIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDEED--DPDKRISIRAHDKRIACDEEFSDSEDEGQGGRRNAANYKKPK 441          
BLAST of histone deacetylase 1 vs. Ensembl Zebrafish
Match: hdac1 (histone deacetylase 1 [Source:ZFIN;Acc:ZDB-GENE-020419-32])

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 338/436 (77.52%), Postives = 388/436 (88.99%), Query Frame = -3
Query:  150 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFKSKR 1454
             +KKVCYYYDGD+GNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA A++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLNK + DIAINW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVEYM+   +PLLMLGGGGYTIRNVARCWT+ETA+AL +TIPNELPYNDY+EYF PDFKLHISPSNM NQNT +YLE++KQ+LFENLR +PHAP VQMQ IPEDA+  D G++ D  DPDKRISI A DK    + + SDSEDEG   R+N   +K  +
Sbjct:    8 TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPIMSKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYMKSFNLPLLMLGGGGYTIRNVARCWTFETAVALDSTIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDEED--DPDKRISIRAHDKRIACDEEFSDSEDEGQGGRRNAANYKKPK 441          
BLAST of histone deacetylase 1 vs. Ensembl Zebrafish
Match: hdac1 (histone deacetylase 1 [Source:ZFIN;Acc:ZDB-GENE-020419-32])

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 338/436 (77.52%), Postives = 388/436 (88.99%), Query Frame = -3
Query:  150 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFKSKR 1454
             +KKVCYYYDGD+GNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA A++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLNK + DIAINW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVEYM+   +PLLMLGGGGYTIRNVARCWT+ETA+AL +TIPNELPYNDY+EYF PDFKLHISPSNM NQNT +YLE++KQ+LFENLR +PHAP VQMQ IPEDA+  D G++ D  DPDKRISI A DK    + + SDSEDEG   R+N   +K  +
Sbjct:    8 TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPIMSKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYMKSFNLPLLMLGGGGYTIRNVARCWTFETAVALDSTIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDEED--DPDKRISIRAHDKRIACDEEFSDSEDEGQGGRRNAANYKKPK 441          
BLAST of histone deacetylase 1 vs. Ensembl Zebrafish
Match: hdac3 (histone deacetylase 3 [Source:NCBI gene;Acc:393965])

HSP 1 Score: 495.738 bits (1275), Expect = 2.481e-173
Identity = 236/382 (61.78%), Postives = 305/382 (79.84%), Query Frame = -3
Query:  252 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEY-FPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSN-MANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRIS 1391
            HPMKPHR+ +TH+L+L+YGLY+KM V+KP KA+  DM  FH+++YI FLQ++ P+NM  + K +  FNVG+DCPVF GLFEFC    G S+  A +LN    DIAINW+GGLHHAKK EASGFCYVNDIV+ ILELLKYH RVLY+DIDIHHGDGV+EAFY TDRVMTVSFHKYG Y FPGTGD+ ++GA  G+ Y +N PLRDGIDD+SY  +F+PV+++V++ ++P  IVLQCGADSL  DRLGCFNLS++GHG+CVE+++   IPLL+LGGGGYT+RNVARCWT+ET+L +  +I +ELPY++Y+EYF PDF LH   S  + NQN+ +YLE+++Q +FENL+ + HAPSVQ+ D+P D +     E+ D ADP++R S
Sbjct:   22 HPMKPHRLSLTHSLVLHYGLYKKMMVFKPYKASQHDMCRFHSEDYIDFLQKVSPNNMQGFTKSLNTFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNHKICDIAINWAGGLHHAKKFEASGFCYVNDIVISILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYRQLFQPVIKQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEFVKGFKIPLLVLGGGGYTVRNVARCWTFETSLLVEESISDELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLEQIRQTVFENLKMLNHAPSVQIHDVPSDLLSY---ERPDEADPEERGS 400          
BLAST of histone deacetylase 1 vs. Ensembl Zebrafish
Match: hdac3 (histone deacetylase 3 [Source:NCBI gene;Acc:393965])

HSP 1 Score: 495.738 bits (1275), Expect = 2.481e-173
Identity = 236/382 (61.78%), Postives = 305/382 (79.84%), Query Frame = -3
Query:  252 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEY-FPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSN-MANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRIS 1391
            HPMKPHR+ +TH+L+L+YGLY+KM V+KP KA+  DM  FH+++YI FLQ++ P+NM  + K +  FNVG+DCPVF GLFEFC    G S+  A +LN    DIAINW+GGLHHAKK EASGFCYVNDIV+ ILELLKYH RVLY+DIDIHHGDGV+EAFY TDRVMTVSFHKYG Y FPGTGD+ ++GA  G+ Y +N PLRDGIDD+SY  +F+PV+++V++ ++P  IVLQCGADSL  DRLGCFNLS++GHG+CVE+++   IPLL+LGGGGYT+RNVARCWT+ET+L +  +I +ELPY++Y+EYF PDF LH   S  + NQN+ +YLE+++Q +FENL+ + HAPSVQ+ D+P D +     E+ D ADP++R S
Sbjct:   22 HPMKPHRLSLTHSLVLHYGLYKKMMVFKPYKASQHDMCRFHSEDYIDFLQKVSPNNMQGFTKSLNTFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNHKICDIAINWAGGLHHAKKFEASGFCYVNDIVISILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYRQLFQPVIKQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEFVKGFKIPLLVLGGGGYTVRNVARCWTFETSLLVEESISDELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLEQIRQTVFENLKMLNHAPSVQIHDVPSDLLSY---ERPDEADPEERGS 400          
BLAST of histone deacetylase 1 vs. Ensembl Xenopus
Match: glrx2 (glutaredoxin 2 [Source:Xenbase;Acc:XB-GENE-963812])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 344/463 (74.30%), Postives = 398/463 (85.96%), Query Frame = -3
Query:   75 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK--SKRPRLDGPNSGTGDSLDKANEDLASTN 1454
             +KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KATA++MT +H+DEYI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLN+ + D+A+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVNFP+RDGIDDESY  IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVE ++   +PLLMLGGGGYTIRNVARCWTYETA+AL   IPNELPYNDY+EYF PDFKLHISPSNM NQNTPEY+E++KQ+LFENLR +PHAP VQMQ IPEDA+  D G++ +  DPDKRISI ASDK    + + SDSEDEG+  R+NV   K  +K+ RL+     T D      E+  S +
Sbjct:    8 AKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDE-EGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARLEEEKKETDDKKSDVKEEDKSKD 469          
BLAST of histone deacetylase 1 vs. Ensembl Xenopus
Match: glrx2 (glutaredoxin 2 [Source:Xenbase;Acc:XB-GENE-963812])

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 323/429 (75.29%), Postives = 374/429 (87.18%), Query Frame = -3
Query:  114 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK--SKRPRLDGPNSGTGD 1391
            HPMKPHRIRMTHNLLLNYGLYRKME+Y+P KATA++MT +H+DEYI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLN+ + D+A+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVNFP+RDGIDDESY  IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVE ++   +PLLMLGGGGYTIRNVARCWTYETA+AL   IPNELPYNDY+EYF PDFKLHISPSNM NQNTPEY+E++KQ+LFENLR +PHAP VQMQ IPEDA+  D G++ +  DPDKRISI ASDK    + + SDSEDEG+  R+NV   K  +K+ RL+     T D
Sbjct:   16 HPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDE-EGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARLEEEKKETDD 443          
BLAST of histone deacetylase 1 vs. Ensembl Xenopus
Match: hdac1 (histone deacetylase 1 [Source:NCBI gene;Acc:594953])

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 337/433 (77.83%), Postives = 389/433 (89.84%), Query Frame = -3
Query:  159 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK 1454
             +KKVCYYYDGD+GNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA+A++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVAS+VKLNK + DI++NWSGGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKPV+ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVE+++   +PLLMLGGGGYTIRNVARCWTYETA+AL + IPNELPYNDY+EYF PDFKLHISPSNM NQNT EYLE++KQ+LFENLR +PHAP VQMQ IPED++  D   + D  DPDKRISI +SDK    + + SDSEDEG+  R+NV  FK
Sbjct:    7 TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASSVKLNKQQTDISVNWSGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEFIKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDSEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDSVHDDS-GEEDEEDPDKRISIRSSDKRIACDEEFSDSEDEGEGGRRNVASFK 438          
BLAST of histone deacetylase 1 vs. Ensembl Xenopus
Match: hdac1 (histone deacetylase 1 [Source:NCBI gene;Acc:594953])

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 319/412 (77.43%), Postives = 369/412 (89.56%), Query Frame = -3
Query:  159 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK 1391
            HPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA+A++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVAS+VKLNK + DI++NWSGGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKPV+ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVE+++   +PLLMLGGGGYTIRNVARCWTYETA+AL + IPNELPYNDY+EYF PDFKLHISPSNM NQNT EYLE++KQ+LFENLR +PHAP VQMQ IPED++  D   + D  DPDKRISI +SDK    + + SDSEDEG+  R+NV  FK
Sbjct:   25 HPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASSVKLNKQQTDISVNWSGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEFIKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDSEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDSVHDDS-GEEDEEDPDKRISIRSSDKRIACDEEFSDSEDEGEGGRRNVASFK 435          
BLAST of histone deacetylase 1 vs. Ensembl Xenopus
Match: hdac1 (histone deacetylase 1 [Source:NCBI gene;Acc:594953])

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 319/412 (77.43%), Postives = 369/412 (89.56%), Query Frame = -3
Query:  159 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK 1391
            HPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA+A++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVAS+VKLNK + DI++NWSGGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKPV+ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVE+++   +PLLMLGGGGYTIRNVARCWTYETA+AL + IPNELPYNDY+EYF PDFKLHISPSNM NQNT EYLE++KQ+LFENLR +PHAP VQMQ IPED++  D   + D  DPDKRISI +SDK    + + SDSEDEG+  R+NV  FK
Sbjct:   26 HPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASSVKLNKQQTDISVNWSGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEFIKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDSEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDSVHDDS-GEEDEEDPDKRISIRSSDKRIACDEEFSDSEDEGEGGRRNVASFK 436          
BLAST of histone deacetylase 1 vs. Ensembl Mouse
Match: Hdac2 (histone deacetylase 2 [Source:MGI Symbol;Acc:MGI:1097691])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 346/463 (74.73%), Postives = 399/463 (86.18%), Query Frame = -3
Query:   75 RKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK--SKRPRLDGPNSGTGD-SLDKANEDLASTN 1451
            +KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KATA++MT +H+DEYI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLN+ + D+A+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVNFP+RDGIDDESY  IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVE ++   +PLLMLGGGGYTIRNVARCWTYETA+AL   IPNELPYNDY+EYF PDFKLHISPSNM NQNTPEY+E++KQ+LFENLR +PHAP VQMQ IPEDA+  D G++ D  DPDKRISI ASDK    + + SDSEDEG+  R+NV   K  +K+ R++     T D   D   ED +  N
Sbjct:    9 KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDE-DGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDN 470          
BLAST of histone deacetylase 1 vs. Ensembl Mouse
Match: Hdac1 (histone deacetylase 1 [Source:MGI Symbol;Acc:MGI:108086])

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 336/436 (77.06%), Postives = 387/436 (88.76%), Query Frame = -3
Query:  150 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFKSKR 1454
             ++KVCYYYDGD+GNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA A++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVASAVKLNK + DIA+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKPV+ KV+E F+P+A+VLQCG+DSLSGDRLGCFNL++KGH KCVE+++   +P+LMLGGGGYTIRNVARCWTYETA+AL T IPNELPYNDY+EYF PDFKLHISPSNM NQNT EYLE++KQ+LFENLR +PHAP VQMQ IPEDA+  +     D  DPDKRISI +SDK    E + SDS++EG+  RKN   FK  +
Sbjct:    7 TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEES-GDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAK 441          
BLAST of histone deacetylase 1 vs. Ensembl Mouse
Match: Hdac3 (histone deacetylase 3 [Source:MGI Symbol;Acc:MGI:1343091])

HSP 1 Score: 494.967 bits (1273), Expect = 4.722e-173
Identity = 236/380 (62.11%), Postives = 301/380 (79.21%), Query Frame = -3
Query:  258 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEY-FPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSN-MANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKR 1391
            HPMKPHR+ +TH+L+L+YGLY+KM V+KP +A+  DM  FH+++YI FLQR+ P NM  + K +  FNVG+DCPVF GLFEFC    G S+  A +LN    DIAINW+GGLHHAKK EASGFCYVNDIV+GILELLKYH RVLY+DIDIHHGDGV+EAFY TDRVMTVSFHKYG Y FPGTGD+ ++GA  G+ Y +N PLRDGIDD+SY+ +F+PV+ +V++ ++P  IVLQCGADSL  DRLGCFNLS++GHG+CVEY++   IPLL+LGGGGYT+RNVARCWTYET+L +   I  ELPY++Y+EYF PDF LH   S  + NQN+ +YL++++Q +FENL+ + HAPSVQ+ D+P D +  D   + D AD ++R
Sbjct:   22 HPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVISQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYD---RTDEADAEER 398          
BLAST of histone deacetylase 1 vs. Ensembl Mouse
Match: Hdac2 (histone deacetylase 2 [Source:MGI Symbol;Acc:MGI:1097691])

HSP 1 Score: 434.491 bits (1116), Expect = 4.042e-151
Identity = 227/273 (83.15%), Postives = 258/273 (94.51%), Query Frame = -3
Query:  633 RKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKG 1451
            +KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KATA++MT +H+DEYI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLN+ + D+A+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVNFP+RDGIDDESY  IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KG
Sbjct:    9 KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKG 281          
BLAST of histone deacetylase 1 vs. Ensembl Mouse
Match: Hdac8 (histone deacetylase 8 [Source:MGI Symbol;Acc:MGI:1917565])

HSP 1 Score: 312.768 bits (800), Expect = 2.133e-102
Identity = 156/350 (44.57%), Postives = 236/350 (67.43%), Query Frame = -3
Query:  354 PHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRI-------HPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGE-YFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSI 1379
            P R  M H+L+  Y L+++M + KP  A+ ++M  FHTD Y+Q LQ++       HPD++         + +G DCP  +G+F++     GG++ +A  L   K  +AINWSGG HHAKK EASGFCY+ND V+GIL L +  +R+LYVD+D+HHGDGVE+AF  T +VMTVS HK+   +FPGTGD+ D+G GKG+ Y+VN P++DGI DE Y  I + V+++V ++F P A+VLQ GAD+++GD +  FN++  G GKC++Y+ Q  +  L+LGGGGY + N ARCWTY T + LG T+ +E+P ++++  + PD+ L I+PS   ++N P  ++++   +  NL+ +
Sbjct:   35 PKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDEDHPDSI--------EYGLGYDCPATEGIFDYAAAIGGGTITAAQCLIDGKCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDMSDVGLGKGRYYSVNVPIQDGIQDEKYYHICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYVLQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHV 376          
BLAST of histone deacetylase 1 vs. UniProt/SwissProt
Match: sp|P56517|HDAC1_CHICK (Histone deacetylase 1 OS=Gallus gallus OX=9031 GN=HDAC1 PE=2 SV=1)

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 338/436 (77.52%), Postives = 389/436 (89.22%), Query Frame = -3
Query:  150 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFKSKR 1454
             ++KVCYYYDGD+GNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA A++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNK + DIA+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKPV+ KV+E+F+P+A+VLQCG+DSLSGDRLGCFNL++KGH KCVE+++   +P+LMLGGGGYTIRNVARCWTYETA+AL T IPNELPYNDY+EYF PDFKLHISPSNM NQNT EYLE++KQ+LFENLR +PHAP VQMQ IPEDA+  D     +  DP+KRISI  SDK    + + SDSEDEG+  RKNV  FK  +
Sbjct:    7 TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPEDAVQEDS-GDEEEEDPEKRISIRNSDKRISCDEEFSDSEDEGEGGRKNVANFKKAK 441          
BLAST of histone deacetylase 1 vs. UniProt/SwissProt
Match: sp|O42227|HDA1B_XENLA (Probable histone deacetylase 1-B OS=Xenopus laevis OX=8355 GN=hdac1-b PE=1 SV=1)

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 337/433 (77.83%), Postives = 389/433 (89.84%), Query Frame = -3
Query:  159 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK 1454
             +KKVCYYYDGD+GNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA+A++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVASAVKLNK + DI++NWSGGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RV+Y+DIDIHHGDGVEEAFYTTDRVM+VSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKPV+ KV+E F+P+A+VLQCGADSLSGDRLGCFNL++KGH KCVE+++   +P+LMLGGGGYTIRNVARCWTYETA+AL + IPNELPYNDY+EYF PDFKLHISPSNM NQNT EYLE++KQ+LFENLR +PHAP VQMQ IPED++  D   + D  DPDKRISI +SDK    + + SDSEDEG+  RKNV  FK
Sbjct:    7 TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDISVNWSGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVVYIDIDIHHGDGVEEAFYTTDRVMSVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMTKVMEMFQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEFIKTFNLPMLMLGGGGYTIRNVARCWTYETAVALDSEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDSVHDDS-GEEDEEDPDKRISIRSSDKRIACDEEFSDSEDEGEGGRKNVANFK 438          
BLAST of histone deacetylase 1 vs. UniProt/SwissProt
Match: sp|Q94517|HDAC1_DROME (Histone deacetylase HDAC1 OS=Drosophila melanogaster OX=7227 GN=HDAC1 PE=1 SV=2)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 331/461 (71.80%), Postives = 394/461 (85.47%), Query Frame = -3
Query:   93 METPVRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFKS--KRPRLDGPNSGTGDSLDKANE 1466
            M++  +K+VCYYYD DIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KATAD+MT FH+DEY++FL+ I PDNM EYNK+MQRFNVGEDCPVFDGL+EFCQLSAGGSVA+AVKLNK  ++I INW GGLHHAKKSEASGFCYVNDIV+GILELLKYH+RVLY+DID+HHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN PLRDG+DD++YESIF P++ KV+E+F+P A+VLQCGADSL+GDRLGCFNL++KGHGKCVE++++  +P LM+GGGGYTIRNV+RCWTYET++AL   I NELPYNDY+EYF PDFKLHISPSNM NQNT EYLE++K +LFENLR +PHAP VQ+Q IPEDA++ D+ +  D  D D R+     DK    E + SDSEDEG+  R++   +K   KRPRLD   +    S + ++E
Sbjct:    1 MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQAIPEDAIN-DESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRSYKGQRKRPRLDKDTNSNKASSETSSE 460          
BLAST of histone deacetylase 1 vs. UniProt/SwissProt
Match: sp|Q92769|HDAC2_HUMAN (Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2 PE=1 SV=2)

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 346/463 (74.73%), Postives = 399/463 (86.18%), Query Frame = -3
Query:   75 RKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK--SKRPRLDGPNSGTGD-SLDKANEDLASTN 1451
            +KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KATA++MT +H+DEYI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLN+ + D+A+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVNFP+RDGIDDESY  IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVE ++   +PLLMLGGGGYTIRNVARCWTYETA+AL   IPNELPYNDY+EYF PDFKLHISPSNM NQNTPEY+E++KQ+LFENLR +PHAP VQMQ IPEDA+  D G++ D  DPDKRISI ASDK    + + SDSEDEG+  R+NV   K  +K+ R++     T D   D   ED +  N
Sbjct:    9 KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDE-DGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDN 470          
BLAST of histone deacetylase 1 vs. UniProt/SwissProt
Match: sp|P70288|HDAC2_MOUSE (Histone deacetylase 2 OS=Mus musculus OX=10090 GN=Hdac2 PE=1 SV=1)

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 346/463 (74.73%), Postives = 398/463 (85.96%), Query Frame = -3
Query:   75 RKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK--SKRPRLDGPNSGTGD-SLDKANEDLASTN 1451
            +KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KATA++MT +H+DEYI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLN+ + D+A+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVNFP+RDGIDDESY  IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVE  +   +PLLMLGGGGYTIRNVARCWTYETA+AL   IPNELPYNDY+EYF PDFKLHISPSNM NQNTPEY+E++KQ+LFENLR +PHAP VQMQ IPEDA+  D G++ D  DPDKRISI ASDK    + + SDSEDEG+  R+NV   K  +K+ R++     T D   D   ED +  N
Sbjct:    9 KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVAKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDE-DGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDN 470          
BLAST of histone deacetylase 1 vs. TrEMBL
Match: U5NTV4 (Histone deacetylase OS=Schmidtea mediterranea OX=79327 GN=HDAC-1 PE=2 SV=1)

HSP 1 Score: 897.886 bits (2319), Expect = 0.000e+0
Identity = 463/464 (99.78%), Postives = 464/464 (100.00%), Query Frame = -3
Query:   75 METPVRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKSKRPRLDGPNSGTGDSLDKANEDLASTN 1466
            METPVRKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTH+LLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDIKDIGAGKGKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKSKRPRLDGPNSGTGDSLDKANEDLASTN
Sbjct:    1 METPVRKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHSLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDIKDIGAGKGKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKSKRPRLDGPNSGTGDSLDKANEDLASTN 464          
BLAST of histone deacetylase 1 vs. TrEMBL
Match: K9MWI5 (Histone deacetylase OS=Schmidtea mediterranea OX=79327 GN=HDAC1 PE=2 SV=1)

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 437/437 (100.00%), Postives = 437/437 (100.00%), Query Frame = -3
Query:   75 MKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKSKRPRLDGPNSGTGDSLDKANEDLASTN 1385
            MKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDIKDIGAGKGKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKSKRPRLDGPNSGTGDSLDKANEDLASTN
Sbjct:    1 MKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDIKDIGAGKGKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKSKRPRLDGPNSGTGDSLDKANEDLASTN 437          
BLAST of histone deacetylase 1 vs. TrEMBL
Match: A0A5K3F8R8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 355/465 (76.34%), Postives = 399/465 (85.81%), Query Frame = -3
Query:  111 METPVRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQ--MDNADPDKRISILASDKYREHEADLSDSEDE-----------GDNRKNVDCFKSKRPRLDGPNSGTGDS 1466
            ME+   KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVY+PSKA  DDMT FH+DEYI+FLQ I PDNM +Y K+MQRFNVGEDCPVFDGLFEFCQLSAGGSVA AVKLNK + DIAINW GGLHHAKKSEASGFCYVNDIVMGILELLKYH+RVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD+KDIGAG+GK+YAVN PLRDG+DDE YE IFKPVV KV+E+F+P A+VLQCGADSLSGDRLGCFNLSL+GHGKCVE++R  PIPLLMLGGGGYTIRNVARCWTYET++AL T +PN+LPYNDYYEYF PDFKLHISPSNM N NTPEY+ER+K KLFENLR +PHAPSVQM D+P DAM++D+ E+  ++N DPDKRISI+ASDK    + +  DS +E             + K+V  F+++  R     +G GD+
Sbjct:    1 MESAAHKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPSKAGYDDMTKFHSDEYIKFLQSIRPDNMLDYTKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNKQQTDIAINWGGGLHHAKKSEASGFCYVNDIVMGILELLKYHQRVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLKDIGAGRGKHYAVNCPLRDGMDDECYEKIFKPVVSKVMETFRPGAVVLQCGADSLSGDRLGCFNLSLRGHGKCVEFLRSFPIPLLMLGGGGYTIRNVARCWTYETSIALNTEVPNDLPYNDYYEYFGPDFKLHISPSNMTNLNTPEYIERIKNKLFENLRMLPHAPSVQMIDVPSDAMELDEQEKEAIENEDPDKRISIMASDKAIHRDNEFYDSAEEDGVGLHAQPRGTKSSKDVHSFRNQPKRARTEEAGKGDA 465          
BLAST of histone deacetylase 1 vs. TrEMBL
Match: W6V5A5 (Histone deacetylase OS=Echinococcus granulosus OX=6210 GN=EGR_03724 PE=3 SV=1)

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 355/477 (74.42%), Postives = 401/477 (84.07%), Query Frame = -3
Query:   75 METPVRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQ--MDNADPDKRISILASDKYREHEADLSDSEDEG-----------DNRKNVDCFKSKRPRLDGPNSGTGDSLDKANEDLASTN 1466
            M+  V K+VCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVY+PSKA+A+DMT FH+DEYI+FLQ I PDNM +Y K+MQRFNVGEDCPVFDGLFEFCQLSAGGSVA AVKLNK + DIAINW GGLHHAKKSEASGFCYVNDIVMGILELLKYH+RVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD+KDIGAG+GK+YAVN PLRDG+DDE YE IFKPVV KV+E+F+P A VLQCGADSLSGDRLGCFNLSLKGHGKCVE++R  PIPLLMLGGGGYTIRNVARCWTYET++AL T +PN+LPYNDYYEYF PDFKLHISPSNM N NTP+Y+ER+K KLFENLR +PHAPSVQM D+P D +D+++ E+  ++N DPDKRISI+ASDK    + +  DS +E               K+V  F+++  R     SG GD      E+ A  +
Sbjct:   19 MDPAVDKRVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPSKASAEDMTKFHSDEYIRFLQSIRPDNMLDYTKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNKQQTDIAINWGGGLHHAKKSEASGFCYVNDIVMGILELLKYHQRVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLKDIGAGRGKHYAVNCPLRDGMDDECYEKIFKPVVSKVMETFRPGAAVLQCGADSLSGDRLGCFNLSLKGHGKCVEFLRSFPIPLLMLGGGGYTIRNVARCWTYETSIALNTEVPNDLPYNDYYEYFGPDFKLHISPSNMTNLNTPDYIERIKNKLFENLRMLPHAPSVQMVDVPPDTIDVEEQEKEAIENEDPDKRISIMASDKAVHRDNEFYDSGEEDGVGVQVAPKGIKTAKDVHSFRNQAKRARIEESGKGDVASMDTEESAEAD 495          
BLAST of histone deacetylase 1 vs. TrEMBL
Match: X5CY48 (Histone deacetylase OS=Echinococcus multilocularis OX=6211 GN=hdac1 PE=2 SV=1)

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 356/477 (74.63%), Postives = 401/477 (84.07%), Query Frame = -3
Query:   75 METPVRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQ--MDNADPDKRISILASDKYREHEADLSDSEDEG-----------DNRKNVDCFKSKRPRLDGPNSGTGDSLDKANEDLASTN 1466
            M+  V KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVY+PSKA+A+DMT FH+DEYI+FLQ I PDNM +Y K+MQRFNVGEDCPVFDGLFEFCQLSAGGSVA AVKLNK + DIAINW GGLHHAKKSEASGFCYVNDIVMGILELLKYH+RVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD+KDIGAG+GK+YAVN PLRDG+DDE YE IFKPVV KV+E+F+P A VLQCGADSLSGDRLGCFNLSLKGHGKCVE++R  PIPLLMLGGGGYTIRNVARCWTYET++AL T +PN+LPYNDYYEYF PDFKLHISPSNM N NTP+Y+ER+K KLFENLR +PHAPSVQM D+P D +D+++ E+  ++N DPDKRISI+ASDK    + +  DS +E               K+V  F+++  R     SG GD      E+ A  +
Sbjct:    1 MDPAVDKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPSKASAEDMTKFHSDEYIRFLQSIRPDNMLDYTKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNKQQTDIAINWGGGLHHAKKSEASGFCYVNDIVMGILELLKYHQRVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLKDIGAGRGKHYAVNCPLRDGMDDECYEKIFKPVVSKVMETFRPGAAVLQCGADSLSGDRLGCFNLSLKGHGKCVEFLRSFPIPLLMLGGGGYTIRNVARCWTYETSIALNTEVPNDLPYNDYYEYFGPDFKLHISPSNMTNLNTPDYIERIKNKLFENLRMLPHAPSVQMVDVPPDTIDVEEQEKEAIENEDPDKRISIMASDKAVHRDNEFYDSGEEDGVGVQVAPKGIKTAKDVHSFRNQAKRARIEESGKGDVASMDTEESAEAD 477          
BLAST of histone deacetylase 1 vs. Ensembl Cavefish
Match: hdac1 (probable histone deacetylase 1-B [Source:NCBI gene;Acc:103046670])

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 339/446 (76.01%), Postives = 390/446 (87.44%), Query Frame = -3
Query:  123 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDN--RKNVDCFKSKRPRLDGPNSG 1454
             +KKVCYYYDGD+GNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA  ++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLNK + DIAINW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVEYM+   +PLLMLGGGGYTIRNVARCWTYETA+AL +TIPNELPYNDY+EYF PDFKLHISPSNM NQNT +YLE++KQ+LFENLR +PHAP VQMQ IPEDA+  D G++ D  DPDKRI I A DK    + + SDSEDEG    R  ++  K+KR + +    G
Sbjct:    8 TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANGEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPIMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYMKSFNLPLLMLGGGGYTIRNVARCWTYETAVALDSTIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYLEKIKQRLFENLRMLPHAPGVQMQVIPEDAVQEDSGDEED--DPDKRIPIRAHDKRIACDEEFSDSEDEGQGGRRNTINFKKAKRVKTEEDKDG 451          
BLAST of histone deacetylase 1 vs. Ensembl Cavefish
Match: hdac1 (probable histone deacetylase 1-B [Source:NCBI gene;Acc:103046670])

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 321/425 (75.53%), Postives = 370/425 (87.06%), Query Frame = -3
Query:  123 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDN--RKNVDCFKSKRPRLDGPNSG 1391
            HPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA  ++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLNK + DIAINW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVEYM+   +PLLMLGGGGYTIRNVARCWTYETA+AL +TIPNELPYNDY+EYF PDFKLHISPSNM NQNT +YLE++KQ+LFENLR +PHAP VQMQ IPEDA+  D G++ D  DPDKRI I A DK    + + SDSEDEG    R  ++  K+KR + +    G
Sbjct:   34 HPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANGEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPIMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYMKSFNLPLLMLGGGGYTIRNVARCWTYETAVALDSTIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYLEKIKQRLFENLRMLPHAPGVQMQVIPEDAVQEDSGDEED--DPDKRIPIRAHDKRIACDEEFSDSEDEGQGGRRNTINFKKAKRVKTEEDKDG 456          
BLAST of histone deacetylase 1 vs. Ensembl Cavefish
Match: HDAC2 (histone deacetylase 2 [Source:NCBI gene;Acc:103028934])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 339/441 (76.87%), Postives = 389/441 (88.21%), Query Frame = -3
Query:  141 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK--SKRPRL 1454
             +KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KATAD+MT +H+D+YI+FL+ I PDNM E++K+MQRFNVGEDCPVFDGLFEFCQLS GGS A AVKLN+ + DIA+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVNFPLRDGIDDESYE IFKPV+ KV+E ++P+A+VLQCGADSLSGDRLGCFNL+++GH KCVEYM+   +PLLMLGGGGYTIRNVARCWTYETA+AL T IP+ELPYNDY+EYF PDFKLHISPSNM NQNT EY++++KQ+LFENLR +PHAP VQMQ IPED++  D     D  DPDKR+SI ASDK    + + SDSEDEG+  R+NV   K  +KR R+
Sbjct:    8 TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKYHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSAAGAVKLNRQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPLRDGIDDESYEQIFKPVMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIRGHAKCVEYMKSFNLPLLMLGGGGYTIRNVARCWTYETAVALDTDIPDELPYNDYFEYFGPDFKLHISPSNMTNQNTQEYMDKIKQRLFENLRMLPHAPGVQMQAIPEDSLPDDT-VDEDTEDPDKRMSIRASDKRIACDEEFSDSEDEGEGGRRNVTNHKKGAKRARV 447          
BLAST of histone deacetylase 1 vs. Ensembl Cavefish
Match: HDAC3 (histone deacetylase 3 [Source:HGNC Symbol;Acc:HGNC:4854])

HSP 1 Score: 372.859 bits (956), Expect = 1.851e-126
Identity = 197/347 (56.77%), Postives = 248/347 (71.47%), Query Frame = -3
Query:  168 PVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEY-FPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNE----------LPYNDYYEYFTPDFKLHISPSN-MANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVD 1172
            PVF GLFEFC    G S+  A +LN    DIAINW+GGLHHAKK EASGFCYVNDIV+ ILELLKYH RVLY+DIDIHHGDGV+EAFY TDRVMTVSFHKYG Y FPGTGD+ ++GA  G+ Y +N PLRDGIDD+SY  +F+PV+++V++ ++P  IVLQCGADSL  DRLGCFNLS++GHG+CVE+++   IPLL+LGGGGYT+RNVARC     AL     + N+           P  +Y+EYF PDF LH   S  + NQN+ +YLE+++Q +FENL+ + HAPSVQ+ D+P D +     E+ D+ADPD+R S    + Y   EA     + + DN K  D
Sbjct:    2 PVFPGLFEFCSRYTGASLQGATQLNHKICDIAINWAGGLHHAKKFEASGFCYVNDIVISILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYRQLFQPVIKQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEFVKSFKIPLLVLGGGGYTVRNVARC----CALIFSRAVYNDFFPRCILCLLFPNTEYFEYFAPDFTLHPDVSTRIENQNSRQYLEQIRQTVFENLKMLNHAPSVQIHDVPSDLLSY---ERSDDADPDERGS---EENYSRPEAANEFYDGDHDNDKESD 338          
BLAST of histone deacetylase 1 vs. Ensembl Cavefish
Match: hdac8 (histone deacetylase 8 [Source:NCBI gene;Acc:406740])

HSP 1 Score: 290.426 bits (742), Expect = 5.099e-93
Identity = 156/339 (46.02%), Postives = 229/339 (67.55%), Query Frame = -3
Query:  366 PHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGE-YFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFEN 1379
            P+R  M H+L+  YGL + M V KP  A+ ++M +FHT  Y++ L +I  +  ++ + +   F +G DCP+ +G+F++     G ++ +A  L   K ++AINW+GG HHAKK EASGFCYVND V+GIL+L + +ERVLYVD+D+HHGDGVE+AF  T +VMTVS HK+   +FPGTGD+ D G GKG+ YAVN PL DGI D+ Y  IF  V+++V   F P A+V+Q GAD+++GD +  FN++  G  KC+ ++ +  +P L+LGGGGY + N ARCWTY T   LG T+ +E+P ++++  + PD+ L ISPS   ++N  + LER+   +  N
Sbjct:   36 PNRASMVHSLIEAYGLLQYMRVVKPHMASLEEMAVFHTHSYLEHLHQISQNGDND-DPQSGDFGLGYDCPIVEGIFDYAAAVGGATLTAAQCLLDGKCEVAINWAGGWHHAKKDEASGFCYVNDAVLGILKLREKYERVLYVDVDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDTGLGKGRWYAVNVPLEDGIRDDRYLQIFTSVMQEVKALFNPEAVVMQLGADTMAGDPMCSFNMTPVGVSKCLNHVLEWELPTLLLGGGGYNLANTARCWTYLTGTLLGQTLSSEIPDHEFFTEYGPDYSLEISPSCRPDRNESQQLERVISTIKGN 373          
BLAST of histone deacetylase 1 vs. Ensembl Sea Lamprey
Match: hdac1 (histone deacetylase 1 [Source:ZFIN;Acc:ZDB-GENE-020419-32])

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 301/447 (67.34%), Postives = 361/447 (80.76%), Query Frame = -3
Query:  138 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGD--GVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRIS----ILASDKYREHEADLSDSEDEGD-NRKNVDCFKS-KRPRLD 1454
             ++KVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KAT+++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGL+EFCQLS GGSVA AVKLNK + DIA+NW GGLHHAKKSEASGFCYVNDIV+ ILELLK   +    +    +G+  G+  A    + V  +S        P T   +DIGAGKGK YAVNFPLRDGIDDESYE+IFKPV+ KV+E ++P+A+VLQCGADSL+GDRLGCFNL++KGH KCV +M+   +PLLMLGGGGYTIRNVARCWT+ETA+AL + I NELPYNDY+EYF PDFKLHISPSNM NQNTPEYLE++KQ+LFENLR +PHAP VQMQ IPEDA+  D GE+ +  DP+KRIS    + ASDK    + + SDSEDEG+  R+N   +K  KRP+++
Sbjct:    8 AKRKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATSEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLYEFCQLSTGGSVAGAVKLNKQQTDIAVNWGGGLHHAKKSEASGFCYVNDIVLAILELLK---KFFSRNFCSRNGEVLGLCSATAVLNNVCQLSLTLRAPVTPTTTPQQDIGAGKGKYYAVNFPLRDGIDDESYEAIFKPVISKVMEMYQPSAVVLQCGADSLTGDRLGCFNLTIKGHAKCVNFMKSFNLPLLMLGGGGYTIRNVARCWTFETAVALDSDIANELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAVPEDSGEEEE--DPNKRISRTTQVRASDKRIACDEEFSDSEDEGEGGRRNATNYKKIKRPKVE 449          
BLAST of histone deacetylase 1 vs. Ensembl Sea Lamprey
Match: hdac3 (histone deacetylase 3 [Source:NCBI gene;Acc:393965])

HSP 1 Score: 490.73 bits (1262), Expect = 2.423e-172
Identity = 235/380 (61.84%), Postives = 300/380 (78.95%), Query Frame = -3
Query:  258 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEY-FPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSN-MANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKR 1391
            HPMKPHR+ +TH+L+L+YGL++KM VYKP +A+  DM  FH++EYI FLQR+ P N+  + K +  FNVG+DCPVF GLFEFC    G S+  A +LN    DIAINWSGGLHHAKK EASGFCYVNDIV+ ILELLKYH RVLY+DIDIHHGDGV+EAFY TDRVMTVSFHKYG Y FPGTGD+ ++GA  G+ Y+VN PLRDGIDD+ Y  +F+P++++V++ ++P  IVLQCGADSL  DRLGCFNLS+KGHG+CV++++   IPLL+LGGGGYT+RNVARCWTYET+L +   I +ELPYN+Y EYF+PDF LH   S  + NQN+ +YLE+++Q +FENL+ + HAPSVQ+ ++P D +     E+ D  +PD R
Sbjct:    4 HPMKPHRLALTHSLVLHYGLHKKMMVYKPYRASQHDMCRFHSEEYIDFLQRVTPHNIQGFTKSLNTFNVGDDCPVFPGLFEFCARYTGASLQGATQLNNKMCDIAINWSGGLHHAKKFEASGFCYVNDIVIAILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYSVNVPLRDGIDDQCYRLLFQPIIKQVMDFYQPTCIVLQCGADSLGCDRLGCFNLSIKGHGECVDFVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLMNDPISDELPYNEYLEYFSPDFSLHPDISTRIENQNSKQYLEQIRQSIFENLKMLNHAPSVQIHEVPSDLLSY---ERKDEPNPDAR 380          
BLAST of histone deacetylase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009119.1 (pep scaffold:Pmarinus_7.0:GL478799:3992:27187:1 gene:ENSPMAG00000008243.1 transcript:ENSPMAT00000009119.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.198 bits (352), Expect = 3.838e-40
Identity = 63/130 (48.46%), Postives = 91/130 (70.00%), Query Frame = -3
Query:  927 VYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDG 1316
            V +PS  +  ++  FH+D+Y++ L+++  D   ++  E Q + +G DCP  +G+FE     AGG++A+A  L     D+A+NW GG HHAKK EASGFCYVNDIV+GIL+L +  ERVLY+D+D+HHGDG
Sbjct:    1 VVEPSAPSRRELAAFHSDDYLEHLEQVSRDGDDDH-PESQLYGLGYDCPTTEGVFECAASVAGGTLAAAGSLMDGSCDVALNWPGGWHHAKKDEASGFCYVNDIVLGILKLREKFERVLYIDLDLHHGDG 129          
BLAST of histone deacetylase 1 vs. Ensembl Sea Lamprey
Match: hdac4 (histone deacetylase 4 [Source:ZFIN;Acc:ZDB-GENE-061013-95])

HSP 1 Score: 97.8265 bits (242), Expect = 9.817e-22
Identity = 82/277 (29.60%), Postives = 131/277 (47.29%), Query Frame = -3
Query:  642 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKE------------MQRFNVGEDCPVF--DGLFEFCQLSAGGSVASA---VKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLK--YHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXXXXXXXXXXXXKNYAVNFPLRDGID----DESYESIFKPVVEKVIESFKPNAIVLQCGADSLSG--DRLGCFNLS 1391
            HP    RI      L   GL  K EV    KA+  D+   H++ ++      +P N  + + +            ++   VG D   +  D         A GSV +    V   + K   AI    G HHA++S   GFC  N + +    LL+  +  R+L VD+D+HHG+G ++AFY   RV+ +S H+Y  G +FPG+G   ++G G G+ + VN     G+D    D  Y + F+ VV  +   F+P+ +++  G D+L G   +LG + L+
Sbjct:  628 HPEHAGRIMAIWARLQQTGLLSKCEVIAGRKASLKDIQTVHSELHV-LRYGTNPLNRQKLDTQGLLDAQPTQLMLLRCGGVGVDSDTYWSDAHSGSAARMAAGSVTTLAFHVASGQLKNGFAIVRPPG-HHAEESAVMGFCVFNSVAIAAKLLLQELHVRRILIVDLDVHHGNGTQQAFYNDPRVLYLSLHRYDNGNFFPGSGASSEVGVGPGEGFTVNVSWTGGLDPPMGDADYLAAFRTVVMPIAMEFEPDVVLVSAGFDALDGHPPQLGGYKLT 902          
BLAST of histone deacetylase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005422.1 (pep scaffold:Pmarinus_7.0:GL501185:343872:431549:1 gene:ENSPMAG00000004812.1 transcript:ENSPMAT00000005422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 1.150e-21
Identity = 86/303 (28.38%), Postives = 149/303 (49.17%), Query Frame = -3
Query:  570 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEM------QRF-------NVGEDC-PVFDGLFEF--CQLSAG--GSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYH---ERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXXXXXXXXXXXXKNYAVNFPLRDGID----DESYESIFKPVVEKVIESFKPNAIVLQCGADSLSG--DRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGG 1391
            HP    RI+   + L   GL RK E  +  KAT +++ M H++++   L   +P N  + + +       Q+         +G D   V++ L      +++AG    +A  V   + K   A+    G HHA++S A GFC+ N + +   +LL+      ++L +D D+HHG+G ++AFY    ++ +S H+Y  G +FPG+G  +++G G G  + VN     G+D    D  Y + F+ VV  +   F P+ +++  G D+  G    LG + +S     KC  ++ +Q   L+ L GG
Sbjct:  630 HPEHAGRIQSIWSRLQERGLLRKCERVRGRKATLEEIEMVHSEQHA-LLYSTNPLNRQKLDSKKLLGSLSQKMFGLLPCGGLGVDSDTVWNELHSASAARMAAGCVSELACKVASGELKNGFAVVRPPG-HHAEESAAMGFCFFNSVAIAA-KLLQQKFNVRKILIIDWDVHHGNGTQQAFYGDASILYLSLHRYDGGNFFPGSGASEEVGTGAGIGFNVNIAWTGGLDPPMGDAEYLAAFRTVVLPIANEFSPDVVLVSSGFDAAEGHPPPLGGYKVS----AKCFGHLTRQ---LMGLAGG 922          
BLAST of histone deacetylase 1 vs. Ensembl Yeast
Match: RPD3 (Histone deacetylase, component of both the Rpd3S and Rpd3L complexes; regulates transcription, silencing, autophagy and other processes by influencing chromatin remodeling; forms at least two different complexes which have distinct functions and members; Rpd3(L) recruitment to the subtelomeric region is regulated by interaction with the arginine methyltransferase, Hmt1p [Source:SGD;Acc:S000005274])

HSP 1 Score: 513.842 bits (1322), Expect = 0.000e+0
Identity = 241/396 (60.86%), Postives = 315/396 (79.55%), Query Frame = -3
Query:  210 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPD--KRISILASDKYREHEADL 1391
            HPMKPHRIRM H+L++NYGLY+KME+Y+   AT  +M  FHTDEYI FL R+ PDN+  + +E  +FNVG+DCPVFDGL+E+C +S GGS+  A +LN+ K D+A+N++GGLHHAKKSEASGFCY+NDIV+GI+ELL+YH RVLY+DID+HHGDGVEEAFYTTDRVMT SFHKYGE+FPGTG+++DIG G GKNYAVN PLRDGIDD +Y S+F+PV++K++E ++P+A+VLQCG DSLSGDRLGCFNLS++GH  CV Y++   IP++++GGGGYT+RNVAR W +ET L     +  +LPYN+YYEY+ PD+KL + PSNM N NTPEYL+++   +F NL +  +APSVQ+   P DA D+ D E+ D+A+    K  S  A D + EH+ + 
Sbjct:   38 HPMKPHRIRMAHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGAGKNYAVNVPLRDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKSFGIPMMVVGGGGYTMRNVARTWCFETGLLNNVVLDKDLPYNEYYEYYGPDYKLSVRPSNMFNVNTPEYLDKVMTNIFANLENTKYAPSVQLNHTPRDAEDLGDVEE-DSAEAKDTKGGSQYARDLHVEHDNEF 432          
BLAST of histone deacetylase 1 vs. Ensembl Yeast
Match: HOS2 (Histone deacetylase and subunit of Set3 and Rpd3L complexes; required for gene activation via specific deacetylation of lysines in H3 and H4 histone tails; subunit of the Set3 complex, a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; co-localizes with Cmr1p in nuclear foci in response to DNA damage by MMS [Source:SGD;Acc:S000003162])

HSP 1 Score: 380.563 bits (976), Expect = 8.039e-129
Identity = 196/395 (49.62%), Postives = 290/395 (73.42%), Query Frame = -3
Query:  330 NRVLFKFSKMETPVRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNK-EMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY-GEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETAL----ALGTTIPNELPYNDYYEYFTPDFKLHISPSNM-ANQNTPEYLERMKQKLFENLRSIPHAPSVQM 1493
            N  LF+F+   +P   +V Y+++  + +Y+YG  HPMKP R+ +T +L+ +YGL++ M++Y+   AT D++  FH+++Y+ FL ++ P+N ++  +  ++ FN+G+DCP+F  L+++  L  G S+ +  KL  N++DIAINWSGGLHHAKK+  SGFCYVNDIV+ IL LL+YH R+LY+DID+HHGDGV+EAFYTTDRV T+SFHKY GE+FPGTGD+ +IG  KGK++A+N PL DGIDD+SY ++FK +V+ +I +FKP  IV QCGADSL  DRLGCFNL++K HG+CV++++   +P+L++GGGGYT RNV+R WTYET +     L   IP ++P+ D    F PD+ L+    ++  N+N+ + LE ++ +  EN+R +  APSV+M
Sbjct:   14 NEPLFEFNSAYSP---RVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHKIMDLYETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTLYTGASLDATRKLINNQSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHPRILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYNGEFFPGTGDLTEIGCDKGKHFALNVPLEDGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAHGECVKFVKSFGLPMLVVGGGGYTPRNVSRLWTYETGILNDVLLPEDIPEDIPFRD---SFGPDYSLYPMLDDLYENKNSKKLLEDIRIRCLENIRYLQGAPSVRM 402          
BLAST of histone deacetylase 1 vs. Ensembl Yeast
Match: HOS1 (Class I histone deacetylase (HDAC) family member; deacetylates Smc3p on lysine residues at anaphase onset; has sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p; interacts with the Tup1p-Ssn6p corepressor complex [Source:SGD;Acc:S000006272])

HSP 1 Score: 166.777 bits (421), Expect = 1.674e-46
Identity = 94/240 (39.17%), Postives = 140/240 (58.33%), Query Frame = -3
Query:  525 PDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYH-ERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGE-YFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGK-CVEYMRQQPIP-LLMLGGGGYTIRNVARCWTYET 1232
            P + +  N E +++N+  DCP+F  L  +CQ+  G ++     L+  +  I INW GG HHA K  ASGFCY+ND+V+ I  L K    ++ YVD D+HHGDGVE+AF  + ++ T+S H Y   +FPGTG + D    K     VN PL+ G DD   E I   +V  +IE  +P A++++CG D L GDR   + L+++G  +  +  M+  P   + +LGGGGY    ++R +TY T
Sbjct:  151 PTDTYILNSETKQYNLEGDCPIFSYLPMYCQVITGATLNLLDHLSPTERLIGINWDGGRHHAFKQRASGFCYINDVVLLIQRLRKAKLNKITYVDFDLHHGDGVEKAFQYSKQIQTISVHLYEPGFFPGTGSLSDSRKDKN---VVNIPLKHGCDDNYLELIASKIVNPLIERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYNDLLMSRFYTYLT 387          
BLAST of histone deacetylase 1 vs. Ensembl Yeast
Match: HDA1 (Putative catalytic subunit of a class II histone deacetylase complex; role in azole resistance via Hsp90p, and in the heat shock response; Hda1p interacts with the Hda2p-Hda3p subcomplex to form an active tetramer; deletion increases histone H2B, H3 and H4 acetylation; other members of the HDA1 histone deacetylase complex are Hda2p and Hda3p [Source:SGD;Acc:S000004966])

HSP 1 Score: 106.686 bits (265), Expect = 7.549e-25
Identity = 87/327 (26.61%), Postives = 158/327 (48.32%), Query Frame = -3
Query:  486 HPMKPHRIRMTHNLLLNYGLYRK------------MEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVAS--AVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYH----ERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXXXXXXXXXXXXK----NYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIP-LLMLGGGGYTIRNVARCWTYETALALGTTIPNELP 1391
            HP  P RI   + +L   GL               M       AT++++   HT E+++F++     +  E  KE ++   G+     +  +   +L  GG++ +  AV   + K  +A+    G HHA+   A GFC  +++ +    +LK +     R++ +D DIHHG+G +++FY  D+V+ VS H++  G+Y+PGT   +    G+GK    N  + +P+  G+ D  Y   F+ VV  +   FKP+ +++  G D+  GD +G  +++   +G     ++      L ++  GGY +  +AR       + +G   P+ELP
Sbjct:   83 HPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKETEK---GDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEP-PDELP 403          
BLAST of histone deacetylase 1 vs. Ensembl Nematostella
Match: EDO49920 (Histone deacetylase [Source:UniProtKB/TrEMBL;Acc:A7RFA3])

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 330/435 (75.86%), Postives = 383/435 (88.05%), Query Frame = -3
Query:  147 RKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKSKRP 1451
            +KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA  +++T +H+D+YI+FL+ I PDNM +Y K+MQRFNVGEDCPVFDGL+EFCQLS GGS+A AVKLNK   DIAINWSGGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAG+GK YAVNFPLRDGI+DESY+ IF+P++ KVIE ++PNA+VLQCGADSL+GDRLGCFNLSLKGH KCVE+++   +PLL+LGGGGYTIRNVARCWTYET++AL + I NELPYNDY+EYF PDFKLHISPSNM NQNTP+YL+++KQ+LFENLR IPHAP VQMQ IPEDA   +   + D  DP++RISI ASDK    E + SDSEDEG+ R++V   +  RP
Sbjct:    9 KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAAMEEITRYHSDDYIKFLKSIRPDNMSDYTKQMQRFNVGEDCPVFDGLYEFCQLSTGGSIAGAVKLNKQHTDIAINWSGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGRGKYYAVNFPLRDGIEDESYQQIFQPIITKVIEIYQPNAVVLQCGADSLAGDRLGCFNLSLKGHAKCVEFVKSFNLPLLILGGGGYTIRNVARCWTYETSVALDSDIANELPYNDYFEYFGPDFKLHISPSNMTNQNTPDYLDKIKQRLFENLRMIPHAPGVQMQPIPEDAFPAESDNE-DEEDPNQRISIRASDKRIACEEEFSDSEDEGEGRRDV---RENRP 439          
BLAST of histone deacetylase 1 vs. Ensembl Nematostella
Match: EDO39062 (Histone deacetylase [Source:UniProtKB/TrEMBL;Acc:A7SB64])

HSP 1 Score: 490.73 bits (1262), Expect = 7.877e-172
Identity = 242/404 (59.90%), Postives = 305/404 (75.50%), Query Frame = -3
Query:  198 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYG-EYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHIS-PSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADP----DKRISILASDKYREHEADLSDSE 1391
            HPMKPHR+ +THNL+ NYGL++KMEVYKP +AT  DM+ FH+ +YI FL R+   N    +K M  FNVGEDCPVF GLF+FC +  G S+  AV+LN+   DIAINW+GGLHHAKK EASGFCYVNDIV+ ILELLKYH RVLYVDIDIHHGDGV+EAFY TDRVMTVSFHKYG  +FPGTGD+ ++G   G+ Y+VN PLRDGIDD++Y S+FKPV+  VI+ ++P  IVLQCGADSL  DRLGCFNLS KGHG+CV +M+   +P+L+LGGGGYTIRNVARCW YET+L +   +  E+PYNDY EYF PDF LH    S + NQNT +YL++++Q + ENL+++  APSVQMQ +P D + ++  E   +AD     D+   +LA ++Y + E D+   E
Sbjct:   23 HPMKPHRLTLTHNLVFNYGLHKKMEVYKPYRATNHDMSRFHSSDYIDFLSRVTIQNNPNLSKSMSDFNVGEDCPVFPGLFDFCSIYTGASLEGAVRLNQGICDIAINWAGGLHHAKKCEASGFCYVNDIVVAILELLKYHNRVLYVDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNHFFPGTGDMYEVGVDNGRLYSVNVPLRDGIDDQNYASLFKPVINMVIDHYQPTCIVLQCGADSLGCDRLGCFNLSTKGHGECVRFMKTFNLPMLVLGGGGYTIRNVARCWAYETSLLVDQQVSTEIPYNDYLEYFGPDFSLHPDIASRIENQNTKQYLDQIRQTVSENLKNLNGAPSVQMQHVPPDLLCLEANEDQMDADGRQTDDETKYVLADNEYFDGEQDVDRDE 426          
BLAST of histone deacetylase 1 vs. Ensembl Nematostella
Match: EDO32559 (Histone deacetylase [Source:UniProtKB/TrEMBL;Acc:A7SUP8])

HSP 1 Score: 299.671 bits (766), Expect = 1.172e-97
Identity = 150/350 (42.86%), Postives = 231/350 (66.00%), Query Frame = -3
Query:  354 PMKPHRIRMTHNLLLNYGLY--RKMEVYKPSKATADDMTMFHTDEYIQFLQRIHP--DNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGE-YFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSI 1388
            P    R  +T +L+  YGL   R + V  P KATA ++  FH+ EY+  ++R      +  E  +++  F +G DCP F+ +++   + AG ++ +A  L   +A +A+NW GG HHA++ EA+GFCY+NDIV+GIL+L + ++RVLYVD+D+HHGDGVE+AF  T +VMTVSFHKY   +FPGTG    +G GKG+ Y +N PL+DGI D  +  +F  V+ +V   FKP+AIV QCG DSL+GD +  FNL+    G+CV+Y++   +P+L+LGGGGY + N +RCWTY T + L   +P ++P ++++  + P ++L I+PS  A+ N+PE ++   +K +  L++I
Sbjct:   34 PKVTGRASLTSSLIEAYGLLKDRNIRVIAPRKATASELAAFHSSEYVNCMRRAAEAVSDGSEECEDLVEFGLGYDCPPFEDMYDCVSMIAGATLLAADMLKTGQAKVAVNWQGGWHHAQRDEAAGFCYINDIVLGILKLREKYDRVLYVDLDVHHGDGVEDAFSFTPKVMTVSFHKYSSGFFPGTGSCCQVGHGKGRYYTLNVPLKDGITDRPFVEVFTRVMSRVKAKFKPDAIVCQCGVDSLAGDPMKAFNLTQFAVGRCVKYLQGWNLPMLVLGGGGYNMVNTSRCWTYVTGVILDRPLPRDIPEHEHFLSYGPSYQLDIAPSLQADLNSPEDIKNTIRKAYGYLQNI 383          
BLAST of histone deacetylase 1 vs. Ensembl Nematostella
Match: EDO26214 (pep supercontig:ASM20922v1:NEMVEscaffold_7977:2351:3655:-1 gene:NEMVEDRAFT_v1g225284 transcript:EDO26214 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 1.728e-31
Identity = 52/130 (40.00%), Postives = 88/130 (67.69%), Query Frame = -3
Query:  354 VVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSI 743
            ++ +V   FKP+AIV QCG DSL+GD +  FNL+    G+CV+Y++   +P+L+LGGGGY + N +RCWTY T + L   +P ++P ++++  + P ++L I+PS  A+ N+PE ++   +K +  L++I
Sbjct:    1 MMSRVKAKFKPDAIVCQCGVDSLAGDPMKAFNLTQFAVGRCVKYLQGWNLPMLVLGGGGYNMVNTSRCWTYVTGVILDRPLPRDIPEHEHFLSYGPSYQLDIAPSLQADLNSPEDIKNTIRKAYGYLQNI 130          
BLAST of histone deacetylase 1 vs. Ensembl Nematostella
Match: EDO35756 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKN6])

HSP 1 Score: 98.2117 bits (243), Expect = 3.858e-22
Identity = 95/344 (27.62%), Postives = 154/344 (44.77%), Query Frame = -3
Query:  486 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGG--------------------SVASAVKLNKNKADIAINWSGGL-----HHAKKSEASGFCYVNDIVMG--ILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXXXXXXXXXXXXKNYAVNFPLRDGID----DESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGD--RLGCFNLSLKGHGKCVEYMRQQPIPL-----LMLGGGGYTIRNVARCWTYETAL--ALGTTIPNELP 1391
            HP  P R++     L   G+    +  +P KAT  ++   H++++              +    Q     ED  +   L  F  L  GG                    +V   V+L +  A   I     +     HHA+  +A GFCY N++ +   +L L    +RVL VD DIHHG+G ++ FY    V+ +S H++  G +FPGTG  ++ GAG G  Y VN     G+D    D  Y + F+ VV  + + F+P+ I++ CG D+ +G   +LG + +S      C  ++  Q + L     ++   GGY++ ++  C   E  L   L  T+P E+P
Sbjct:   14 HPEHPGRLQSIWARLQETGVVNMCDRVRPRKATLAEILSVHSEQHTML-----------FGGSTQCRTKAEDGTITT-LKCFSSLPCGGMGVDGDTIWNEVHSANAARMAVGCVVELTQKVAAQEIKNGMAIVRPPGHHAEAHQAMGFCYFNNVAIAARLLRLKMSIDRVLIVDWDIHHGNGTQQMFYDDPHVLYISLHRHDDGTFFPGTGKAEECGAGIGVGYNVNIAWSGGLDPPYGDAEYLAAFRSVVIPIAKEFQPDIILVSCGFDAAAGHSPQLGGYKVS----APCFAHLTNQLMDLADGRVVLALEGGYSLPSL--CDAAEACLRALLSDTLP-EIP 338          
BLAST of histone deacetylase 1 vs. Ensembl Medaka
Match: hdac1 (probable histone deacetylase 1-B [Source:NCBI gene;Acc:101172913])

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 328/407 (80.59%), Postives = 374/407 (91.89%), Query Frame = -3
Query:  234 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDK 1454
             +KKVCYYYDGD+GNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA+A++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLS GGSVA AVKLNK + DIAINW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVEY++   +PLLMLGGGGYTIRNVARCWT+ETA+AL ++IPNELPYNDY+EYF PDFKLHISPSNM NQNT EYLE++KQ+LFENLR +PHAP VQMQ IPEDA   D G++ D ADPDKRISI A DK
Sbjct:    7 TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPIMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYIKGFNLPLLMLGGGGYTIRNVARCWTFETAVALDSSIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTTEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAPHPDSGDE-DEADPDKRISIRAHDK 412          
BLAST of histone deacetylase 1 vs. Ensembl Medaka
Match: HDAC2 (histone deacetylase 2 [Source:NCBI gene;Acc:101166025])

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 342/441 (77.55%), Postives = 391/441 (88.66%), Query Frame = -3
Query:  141 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFK--SKRPRL 1454
             +KKVCYYYDGD+GNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KATAD+MT +H+D+YI+FL+ I PDNM E++K+MQRFNVGEDCPVFDGLFEFCQLSAGGS A AVKLN+ + DIA+NW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVNFPLRDGIDDESYE IFKPV+ KV+E ++P+A+VLQCG+DSLSGDRLGCFNL+++GH KCVEY++   +PLLMLGGGGYTIRNVARCWTYETA+AL T IP+ELPYNDY+EYF PDFKLHISPSNM NQNT EYL+++KQ+LFENLR +PHAP VQMQ IPEDA+  DD    D  DPDKR+SI A+DK    E + SDSEDEG+  R+NV   K   KRPRL
Sbjct:    9 TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKYHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGAVKLNRQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPLRDGIDDESYEQIFKPVMSKVMEMYQPSAVVLQCGSDSLSGDRLGCFNLTIRGHAKCVEYIKSFNLPLLMLGGGGYTIRNVARCWTYETAVALDTEIPDELPYNDYFEYFGPDFKLHISPSNMTNQNTQEYLDKIKQRLFENLRMLPHAPGVQMQAIPEDAVP-DDPLDEDKEDPDKRLSIRATDKRIVCEEEFSDSEDEGEGGRRNVASHKKGGKRPRL 448          
BLAST of histone deacetylase 1 vs. Ensembl Medaka
Match: HDAC1 (histone deacetylase 1 [Source:NCBI gene;Acc:101159547])

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 337/436 (77.29%), Postives = 388/436 (88.99%), Query Frame = -3
Query:  150 VRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGD-NRKNVDCFKSKR 1454
             +KKVCYYYDGD+GNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME+Y+P KA+ ++MT +H+D+YI+FL+ I PDNM EY+K+MQRFNVGEDCPVFDGLFEFCQLSAGGSVA AVKLNK + DIAINW+GGLHHAKKSEASGFCYVNDIV+ ILELLKYH+RVLY+DIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD++DIGAGKGK YAVN+PLRDGIDDESYE+IFKP++ KV+E ++P+A+VLQCGADSLSGDRLGCFNL++KGH KCVEY++   +PLLMLGGGGYTIRNVARCWTYETA+AL ++IPNELPYNDY+EYF PDFKLHISPSNM NQNT +YLE++KQ+LFENLR +PHAP VQMQ IPEDA+  D     D  DP+KRISI A DK    E + SDSEDEG+  R+N+  FK  +
Sbjct:    8 TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPIMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYIKSFNLPLLMLGGGGYTIRNVARCWTYETAVALDSSIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYLEKIKQRLFENLRMLPHAPGVQMQPIPEDAVQEDS-GDEDEEDPNKRISIRAHDKRIACEEEFSDSEDEGEGGRRNIAGFKKAK 442          
BLAST of histone deacetylase 1 vs. Ensembl Medaka
Match: HDAC3 (histone deacetylase 3 [Source:NCBI gene;Acc:101157788])

HSP 1 Score: 503.056 bits (1294), Expect = 3.558e-176
Identity = 245/410 (59.76%), Postives = 315/410 (76.83%), Query Frame = -3
Query:  168 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEY-FPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSN-MANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVD 1391
            HPMKPHR+ +TH+L+L+YGLY+KM V+KP KA+  DM  FH+++YI FLQ++ P+NM  + K +  FNVG+DCPVF GLFEFC    G S+  A +LN    DIAINW+GGLHHAKK EASGFCYVNDIV+ ILELLKYH RVLY+DIDIHHGDGV+EAFY TDRVMTVSFHKYG Y FPGTGD+ ++GA  G+ Y +N PLRDGIDD+SY  +F+PV+++V++ ++P  IVLQCGADSL  DRLGCFNLS++GHG+CVE+++   IPLL+LGGGGYT+RNVARCWTYET+L L  +I +ELPY++Y+EYF PDF LH   S  + NQN+ +YLE+++Q +FENL+ + HAPSVQ+ D+P D +     E+ D+ DPD+R    A + Y   EA     + + DN K  D
Sbjct:   34 HPMKPHRLSLTHSLVLHYGLYKKMMVFKPYKASQHDMCRFHSEDYIDFLQKVSPNNMQGFTKSLNTFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNHKICDIAINWAGGLHHAKKFEASGFCYVNDIVISILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYRQLFQPVIKQVVDYYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEFVKSFKIPLLVLGGGGYTVRNVARCWTYETSLLLEESISDELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLEQIRQTVFENLKMLNHAPSVQIHDVPSDMLSY---ERTDDPDPDERG---AEENYTRQEAANEFYDGDHDNDKESD 437          
BLAST of histone deacetylase 1 vs. Ensembl Medaka
Match: HDAC3 (histone deacetylase 3 [Source:NCBI gene;Acc:101157788])

HSP 1 Score: 502.671 bits (1293), Expect = 3.576e-176
Identity = 245/410 (59.76%), Postives = 315/410 (76.83%), Query Frame = -3
Query:  168 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEY-FPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSN-MANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVD 1391
            HPMKPHR+ +TH+L+L+YGLY+KM V+KP KA+  DM  FH+++YI FLQ++ P+NM  + K +  FNVG+DCPVF GLFEFC    G S+  A +LN    DIAINW+GGLHHAKK EASGFCYVNDIV+ ILELLKYH RVLY+DIDIHHGDGV+EAFY TDRVMTVSFHKYG Y FPGTGD+ ++GA  G+ Y +N PLRDGIDD+SY  +F+PV+++V++ ++P  IVLQCGADSL  DRLGCFNLS++GHG+CVE+++   IPLL+LGGGGYT+RNVARCWTYET+L L  +I +ELPY++Y+EYF PDF LH   S  + NQN+ +YLE+++Q +FENL+ + HAPSVQ+ D+P D +     E+ D+ DPD+R    A + Y   EA     + + DN K  D
Sbjct:   22 HPMKPHRLSLTHSLVLHYGLYKKMMVFKPYKASQHDMCRFHSEDYIDFLQKVSPNNMQGFTKSLNTFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNHKICDIAINWAGGLHHAKKFEASGFCYVNDIVISILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYRQLFQPVIKQVVDYYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEFVKSFKIPLLVLGGGGYTVRNVARCWTYETSLLLEESISDELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLEQIRQTVFENLKMLNHAPSVQIHDVPSDMLSY---ERTDDPDPDER---GAEENYTRQEAANEFYDGDHDNDKESD 425          
BLAST of histone deacetylase 1 vs. Planmine SMEST
Match: SMESG000060876.1 (SMESG000060876.1)

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 464/464 (100.00%), Postives = 464/464 (100.00%), Query Frame = -3
Query:   75 METPVRKKVCXXXXXXXXXXXXXXGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKSKRPRLDGPNSGTGDSLDKANEDLASTN 1466
            METPVRKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDIKDIGAGKGKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKSKRPRLDGPNSGTGDSLDKANEDLASTN
Sbjct:    1 METPVRKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDIKDIGAGKGKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKSKRPRLDGPNSGTGDSLDKANEDLASTN 464          
BLAST of histone deacetylase 1 vs. Planmine SMEST
Match: SMESG000004705.1 (SMESG000004705.1)

HSP 1 Score: 451.825 bits (1161), Expect = 1.140e-156
Identity = 227/368 (61.68%), Postives = 283/368 (76.90%), Query Frame = -3
Query:  303 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKE-MQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGE-YFPXXXXXXXXXXXXXKNYAVNFPLRDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGGYTIRNVARCWTYETALALG--TTIPNELPYNDYYEYFTPDFKLHIS-PSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMD 1391
            HPMKPHR+ +TH+L+ NY L  KM++Y+P +A+A DM  FH+ +YI+FL+ +  +N+  Y KE +  +NVGEDCP+F G+F+FC L  G S+ +A  LN   ADIAINWSGGLHHAKK EASGFCYVNDIV+ ILELLK H+RVLY+DID+HHGDGV+EAFY TDRVMTVSFHKYG  +FPGTGD+ +IGA  GK+Y+VN PL++GI DE Y SIFK VV  VI  + P+ IVLQCGADSL  DRLG FNLS+KGHG  V+ ++   IPLL+LGGGGYT+RNVARCWTYETA+ L     I ++LPY++Y EYF PDF LH    S + N NT +YLE +K  + +NL+ I  APSVQMQDIP+D +D
Sbjct:   23 HPMKPHRLLLTHSLIFNYDLGEKMDIYQPFRASAQDMCTFHSQDYIEFLKEVTLENLDSYAKEKVMHYNVGEDCPIFPGIFDFCSLYTGASLQAAKFLNNKVADIAINWSGGLHHAKKFEASGFCYVNDIVIAILELLKRHQRVLYIDIDVHHGDGVQEAFYFTDRVMTVSFHKYGNLFFPGTGDMYEIGADGGKHYSVNVPLKEGITDEMYLSIFKSVVNDVISFYDPSVIVLQCGADSLGCDRLGVFNLSIKGHGASVKIVKSFGIPLLVLGGGGYTVRNVARCWTYETAVLLDMENEISDDLPYSEYLEYFGPDFTLHPDLTSKLDNSNTKQYLEMLKSSIHDNLKQIARAPSVQMQDIPDDFID 390          
BLAST of histone deacetylase 1 vs. Planmine SMEST
Match: SMESG000006246.1 (SMESG000006246.1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.123e-20
Identity = 76/307 (24.76%), Postives = 140/307 (45.60%), Query Frame = -3
Query:  510 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRI---HPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGI-LELLKYHE---RVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXX--XXXXXXXXXXKNYAVNFPL-RDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLG-GGGYTIRNVARCWTYETALALG 1391
            HP  P R +M    L +  L  + +  +   A+ D++ + H+  Y++ L  I    P   H + +E     + +   +   L     L+    V S    ++++   AI    G HHA+ +   GFC+ N++ +     L KY E   ++L VD D+HHG+G +  F+T   V+ +S H+Y  G +FPG+       +G    + + VN    +  + D  Y S F  +V  +   F P+ +++  G D+  GD LG   ++ +  G   + +       ++L   GGY +  ++ C ++  +  LG
Sbjct:  490 HPESPRRTQMIFEFLRDNSLLSRCKQLESRLASKDEIGLIHSPNYVESLGNICQESPTIYHLFEEEFNSIYINQHSYISALLSCGLLLNVIDEVCS----DRSENGFAIIRPPG-HHAEVNYPLGFCFFNNVAIAANYALTKYSESIKKILIVDWDVHHGNGTQHQFWTNKNVLYISLHRYDNGLFFPGSTDGSPSAVGGVDAEGFNVNIAWNKRPVRDSEYISAFINIVMPISHEFNPDLVIVSAGFDAARGDPLGGLTVTPECFGNMTQMLTSLANGKVILALEGGYNLNVISDCMSHCVSSLLG 791          

HSP 2 Score: 91.6633 bits (226), Expect = 3.524e-19
Identity = 77/310 (24.84%), Postives = 140/310 (45.16%), Query Frame = -3
Query:  498 KPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGS---VASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDI-VMGILELLKYH-ERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXXXXX--XXXXXXXKNYAVNFPL-RDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPL-----LMLGGGGYTIRNVARCWTYETALALGTTIP 1382
            +P R+R+ +  +    L       +  +   + +   H+  ++Q ++    D       +++  +   DC  FD   +     + GS   V  AV  ++ K    +    G HHA +SEASGFC  N++ +      L Y  +++L VD D+HHG+  +  FY T +V+ +S H+Y  G ++P   +     IGA +G+ Y +N PL +  + +  Y SIF  ++  +   + P  +++  G DS     +GC   S+  H  C  +M  + + L     ++L  GGY + ++        A   G   P
Sbjct:   76 RPDRLRVCYEGICETNLLEDCIRIQAKEIDNELIYYSHSQSHVQLIE----DTQTMTAIQLKELSSQHDCVFFDNNTKLASFISAGSTIEVLKAVLDDRAKNGFCLIRPPG-HHAMESEASGFCIFNNVGIAAKYAQLNYSTQKILIVDWDVHHGNATQYQFYNTSKVLYISIHRYEDGNFWPKLRESNYDYIGANEGRGYNINIPLNKTNMTNSDYLSIFHSIILPIAYEYNPELVLISAGFDS----AIGCPEGSMDVHPACFAHMTHKLMDLARGRVVVLLEGGYCMESLKDSVVLTLATLTGKAPP 376          
BLAST of histone deacetylase 1 vs. Planmine SMEST
Match: SMESG000006246.1 (SMESG000006246.1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.217e-20
Identity = 76/307 (24.76%), Postives = 140/307 (45.60%), Query Frame = -3
Query:  510 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRI---HPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDIVMGI-LELLKYHE---RVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXX--XXXXXXXXXXKNYAVNFPL-RDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLG-GGGYTIRNVARCWTYETALALG 1391
            HP  P R +M    L +  L  + +  +   A+ D++ + H+  Y++ L  I    P   H + +E     + +   +   L     L+    V S    ++++   AI    G HHA+ +   GFC+ N++ +     L KY E   ++L VD D+HHG+G +  F+T   V+ +S H+Y  G +FPG+       +G    + + VN    +  + D  Y S F  +V  +   F P+ +++  G D+  GD LG   ++ +  G   + +       ++L   GGY +  ++ C ++  +  LG
Sbjct:  488 HPESPRRTQMIFEFLRDNSLLSRCKQLESRLASKDEIGLIHSPNYVESLGNICQESPTIYHLFEEEFNSIYINQHSYISALLSCGLLLNVIDEVCS----DRSENGFAIIRPPG-HHAEVNYPLGFCFFNNVAIAANYALTKYSESIKKILIVDWDVHHGNGTQHQFWTNKNVLYISLHRYDNGLFFPGSTDGSPSAVGGVDAEGFNVNIAWNKRPVRDSEYISAFINIVMPISHEFNPDLVIVSAGFDAARGDPLGGLTVTPECFGNMTQMLTSLANGKVILALEGGYNLNVISDCMSHCVSSLLG 789          

HSP 2 Score: 91.6633 bits (226), Expect = 3.648e-19
Identity = 77/310 (24.84%), Postives = 140/310 (45.16%), Query Frame = -3
Query:  498 KPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGGS---VASAVKLNKNKADIAINWSGGLHHAKKSEASGFCYVNDI-VMGILELLKYH-ERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXXXXX--XXXXXXXKNYAVNFPL-RDGIDDESYESIFKPVVEKVIESFKPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPL-----LMLGGGGYTIRNVARCWTYETALALGTTIP 1382
            +P R+R+ +  +    L       +  +   + +   H+  ++Q ++    D       +++  +   DC  FD   +     + GS   V  AV  ++ K    +    G HHA +SEASGFC  N++ +      L Y  +++L VD D+HHG+  +  FY T +V+ +S H+Y  G ++P   +     IGA +G+ Y +N PL +  + +  Y SIF  ++  +   + P  +++  G DS     +GC   S+  H  C  +M  + + L     ++L  GGY + ++        A   G   P
Sbjct:   74 RPDRLRVCYEGICETNLLEDCIRIQAKEIDNELIYYSHSQSHVQLIE----DTQTMTAIQLKELSSQHDCVFFDNNTKLASFISAGSTIEVLKAVLDDRAKNGFCLIRPPG-HHAMESEASGFCIFNNVGIAAKYAQLNYSTQKILIVDWDVHHGNATQYQFYNTSKVLYISIHRYEDGNFWPKLRESNYDYIGANEGRGYNINIPLNKTNMTNSDYLSIFHSIILPIAYEYNPELVLISAGFDS----AIGCPEGSMDVHPACFAHMTHKLMDLARGRVVVLLEGGYCMESLKDSVVLTLATLTGKAPP 374          
BLAST of histone deacetylase 1 vs. Planmine SMEST
Match: SMESG000028609.1 (SMESG000028609.1)

HSP 1 Score: 90.5077 bits (223), Expect = 8.603e-19
Identity = 93/329 (28.27%), Postives = 144/329 (43.77%), Query Frame = -3
Query:  540 HPMKPHRIRMTHNLLLNYGLYRKMEVYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPVFDGLFEFCQLSAGG-SVASAVKLNK----NKADIAINWSGGL--------------------HHAKKSEASGFCYVNDIVMGI--LELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPXXXXXXXXXXXXXKNYAVNFPLR---DG----IDDESYESIFKPVVEKVIESFKPNAIVLQCGADS--LSGDRLGCFNLSLKGHGKCVEYMRQQPI-------PLLMLGGGGYTIRNVARC 1391
            HP    R+ M    L    +  +  V +  KA+ DD+ + H D Y   L   +P N  + N            P      EFC+L  GG  V S    N     N A +A+     L                    HHA+ S+A GF Y N + +    + +    +RVL +D DIHHG+G ++ FY    V+ +S H++  G +FPGTG I++IG G G NY +N   +   DG    + D  Y + F  +V  V + F P+ I++  G D+  +    LG +++S      C  +M Q+ +        ++M   GGY I ++  C
Sbjct:  641 HPESSRRLAMVWERLKESQIVLRCHVIQGKKASMDDLQLCHEDTY-SVLFGTNPANRLKIN------------PQLLMSVEFCRLPCGGIGVDSDTIWNNAHTANAARLAVGCVVELTLKIVRGELRNGFALVRPPGHHAEFSQAMGFGYFNSVAIAAKKITMQTAVKRVLIIDWDIHHGNGTQQIFYNDPSVLYISLHRHDNGHFFPGTGLIEEIGEGAGTNYNINIAWKSPPDGSFLSMSDAEYIAAFVHIVLPVAKEFNPDLIIVSAGFDATKMHSSSLGGYSVS----PACFGWMTQKLVMSGLAEGRVVMALEGGYDIASLCDC 952          
The following BLAST results are available for this feature:
BLAST of histone deacetylase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HDAC20.000e+074.73histone deacetylase 2 [Source:HGNC Symbol;Acc:HGNC... [more]
HDAC10.000e+080.10histone deacetylase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
HDAC20.000e+073.70histone deacetylase 2 [Source:HGNC Symbol;Acc:HGNC... [more]
HDAC20.000e+073.70histone deacetylase 2 [Source:HGNC Symbol;Acc:HGNC... [more]
HDAC39.436e-17362.11histone deacetylase 3 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of histone deacetylase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hda-10.000e+065.69Histone deacetylase 1 [Source:UniProtKB/Swiss-Pro... [more]
hda-31.489e-17957.11Histone deacetylase [Source:UniProtKB/TrEMBL;Acc:... [more]
hda-31.489e-17957.11Histone deacetylase [Source:UniProtKB/TrEMBL;Acc:... [more]
hda-29.456e-12651.74Putative histone deacetylase 2 [Source:UniProtKB/... [more]
hda-101.483e-1724.19Histone deacetylase [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of histone deacetylase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HDAC10.000e+071.80gene:FBgn0015805 transcript:FBtr0073317[more]
HDAC39.648e-16656.34gene:FBgn0025825 transcript:FBtr0078767[more]
HDAC61.908e-2626.46gene:FBgn0026428 transcript:FBtr0301774[more]
HDAC62.003e-2627.42gene:FBgn0026428 transcript:FBtr0307384[more]
HDAC62.484e-2626.46gene:FBgn0026428 transcript:FBtr0307383[more]
back to top
BLAST of histone deacetylase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hdac10.000e+077.52histone deacetylase 1 [Source:ZFIN;Acc:ZDB-GENE-02... [more]
hdac10.000e+077.52histone deacetylase 1 [Source:ZFIN;Acc:ZDB-GENE-02... [more]
hdac10.000e+077.52histone deacetylase 1 [Source:ZFIN;Acc:ZDB-GENE-02... [more]
hdac32.481e-17361.78histone deacetylase 3 [Source:NCBI gene;Acc:393965... [more]
hdac32.481e-17361.78histone deacetylase 3 [Source:NCBI gene;Acc:393965... [more]
back to top
BLAST of histone deacetylase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glrx20.000e+074.30glutaredoxin 2 [Source:Xenbase;Acc:XB-GENE-963812][more]
glrx20.000e+075.29glutaredoxin 2 [Source:Xenbase;Acc:XB-GENE-963812][more]
hdac10.000e+077.83histone deacetylase 1 [Source:NCBI gene;Acc:594953... [more]
hdac10.000e+077.43histone deacetylase 1 [Source:NCBI gene;Acc:594953... [more]
hdac10.000e+077.43histone deacetylase 1 [Source:NCBI gene;Acc:594953... [more]
back to top
BLAST of histone deacetylase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hdac20.000e+074.73histone deacetylase 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Hdac10.000e+077.06histone deacetylase 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Hdac34.722e-17362.11histone deacetylase 3 [Source:MGI Symbol;Acc:MGI:1... [more]
Hdac24.042e-15183.15histone deacetylase 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Hdac82.133e-10244.57histone deacetylase 8 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of histone deacetylase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P56517|HDAC1_CHICK0.000e+077.52Histone deacetylase 1 OS=Gallus gallus OX=9031 GN=... [more]
sp|O42227|HDA1B_XENLA0.000e+077.83Probable histone deacetylase 1-B OS=Xenopus laevis... [more]
sp|Q94517|HDAC1_DROME0.000e+071.80Histone deacetylase HDAC1 OS=Drosophila melanogast... [more]
sp|Q92769|HDAC2_HUMAN0.000e+074.73Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=H... [more]
sp|P70288|HDAC2_MOUSE0.000e+074.73Histone deacetylase 2 OS=Mus musculus OX=10090 GN=... [more]
back to top
BLAST of histone deacetylase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U5NTV40.000e+099.78Histone deacetylase OS=Schmidtea mediterranea OX=7... [more]
K9MWI50.000e+0100.00Histone deacetylase OS=Schmidtea mediterranea OX=7... [more]
A0A5K3F8R80.000e+076.34Uncharacterized protein OS=Mesocestoides corti OX=... [more]
W6V5A50.000e+074.42Histone deacetylase OS=Echinococcus granulosus OX=... [more]
X5CY480.000e+074.63Histone deacetylase OS=Echinococcus multilocularis... [more]
back to top
BLAST of histone deacetylase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hdac10.000e+076.01probable histone deacetylase 1-B [Source:NCBI gene... [more]
hdac10.000e+075.53probable histone deacetylase 1-B [Source:NCBI gene... [more]
HDAC20.000e+076.87histone deacetylase 2 [Source:NCBI gene;Acc:103028... [more]
HDAC31.851e-12656.77histone deacetylase 3 [Source:HGNC Symbol;Acc:HGNC... [more]
hdac85.099e-9346.02histone deacetylase 8 [Source:NCBI gene;Acc:406740... [more]
back to top
BLAST of histone deacetylase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hdac10.000e+067.34histone deacetylase 1 [Source:ZFIN;Acc:ZDB-GENE-02... [more]
hdac32.423e-17261.84histone deacetylase 3 [Source:NCBI gene;Acc:393965... [more]
ENSPMAT00000009119.13.838e-4048.46pep scaffold:Pmarinus_7.0:GL478799:3992:27187:1 ge... [more]
hdac49.817e-2229.60histone deacetylase 4 [Source:ZFIN;Acc:ZDB-GENE-06... [more]
ENSPMAT00000005422.11.150e-2128.38pep scaffold:Pmarinus_7.0:GL501185:343872:431549:1... [more]
back to top
BLAST of histone deacetylase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
RPD30.000e+060.86Histone deacetylase, component of both the Rpd3S a... [more]
HOS28.039e-12949.62Histone deacetylase and subunit of Set3 and Rpd3L ... [more]
HOS11.674e-4639.17Class I histone deacetylase (HDAC) family member; ... [more]
HDA17.549e-2526.61Putative catalytic subunit of a class II histone d... [more]
back to top
BLAST of histone deacetylase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO499200.000e+075.86Histone deacetylase [Source:UniProtKB/TrEMBL;Acc:... [more]
EDO390627.877e-17259.90Histone deacetylase [Source:UniProtKB/TrEMBL;Acc:... [more]
EDO325591.172e-9742.86Histone deacetylase [Source:UniProtKB/TrEMBL;Acc:... [more]
EDO262141.728e-3140.00pep supercontig:ASM20922v1:NEMVEscaffold_7977:2351... [more]
EDO357563.858e-2227.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of histone deacetylase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hdac10.000e+080.59probable histone deacetylase 1-B [Source:NCBI gene... [more]
HDAC20.000e+077.55histone deacetylase 2 [Source:NCBI gene;Acc:101166... [more]
HDAC10.000e+077.29histone deacetylase 1 [Source:NCBI gene;Acc:101159... [more]
HDAC33.558e-17659.76histone deacetylase 3 [Source:NCBI gene;Acc:101157... [more]
HDAC33.576e-17659.76histone deacetylase 3 [Source:NCBI gene;Acc:101157... [more]
back to top
BLAST of histone deacetylase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060876.10.000e+0100.00SMESG000060876.1[more]
SMESG000004705.11.140e-15661.68SMESG000004705.1[more]
SMESG000006246.12.123e-2024.76SMESG000006246.1[more]
SMESG000006246.12.217e-2024.76SMESG000006246.1[more]
SMESG000028609.18.603e-1928.27SMESG000028609.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035373
GenBankAGY34711.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035373 ID=SMED30035373|Name=histone deacetylase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1510bp
TTTTTTTTTAATGAGACAAGTTTTATTACAAATACAGGAAATATGTTGTC
TATATACAATTAGAAAAACGATCAATTTGTAGATGCTAAGTCTTCATTAG
CTTTGTCTAGGCTATCACCAGTCCCGCTATTCGGACCATCTAATCGAGGT
CTTTTAGACTTGAAACAATCCACATTCTTACGGTTGTCACCCTCGTCTTC
ACTGTCTGATAAATCGGCTTCGTGCTCCCTATACTTATCACTTGCAAGGA
TTGATATTCTCTTATCTGGATCAGCATTATCCATTTGTTCTCCGTCATCT
ATATCCATTGCATCTTCAGGGATATCCTGCATTTGAACACTAGGAGCATG
AGGAATACTGCGCAAATTCTCAAACAACTTCTGTTTCATTCTTTCAAGAT
ATTCAGGAGTGTTTTGATTGGCCATATTACTAGGACTAATGTGGAGCTTG
AAATCAGGCGTGAAATATTCGTAATAATCATTGTAGGGCAACTCATTTGG
AATAGTAGTTCCTAATGCAAGTGCGGTTTCGTATGTCCAGCATCTAGCAA
CATTTCTTATCGTATATCCACCTCCACCTAGCATCAGTAGTGGAATAGGC
TGTTGCCTCATGTACTCAACACATTTACCATGACCTTTTAAGCTTAAATT
AAAACAACCTAATCGATCTCCAGACAACGAATCTGCACCACATTGCAAAA
CAATTGCATTAGGCTTAAACGATTCAATAACCTTTTCAACCACTGGTTTA
AAAATGGATTCGTAACTTTCGTCGTCAATTCCATCTCTCAATGGGAAATT
GACAGCATAATTTTTTCCTTTGCCAGCACCAATATCTTTAATATCTCCAG
TGCCGGGAAAATATTCACCATATTTATGGAAACTGACTGTCATTACTCTA
TCTGTAGTATAGAAGGCCTCTTCAACTCCATCGCCGTGATGTATATCAAT
ATCAACGTACAATACTCTTTCGTGATATTTAAGCAATTCCAAAATGCCCA
TGACAATATCATTAACATAGCAGAAACCTGAAGCTTCAGATTTTTTAGCG
TGATGCAAACCTCCAGACCAATTAATAGCAATGTCAGCTTTATTTTTATT
CAACTTCACCGCAGATGCAACAGATCCCCCAGCTGATAATTGACAAAATT
CGAATAACCCATCAAATACAGGACAATCTTCTCCAACGTTGAACCTTTGC
ATTTCTTTGTTGTATTCGTGCATATTATCGGGATGGATTCTCTGAAGAAA
TTGGATATACTCATCAGTATGAAACATAGTCATGTCGTCTGCAGTAGCCT
TTGAAGGCTTGTATACTTCCATCTTTCTATATAGGCCATAATTTAAAAGT
AAATTGTGCGTCATGCGAATACGGTGAGGTTTCATGGGATGACCCTGGCC
ATAATAATAATTCCCAATGTCTCCATCATAATAATAGCACACTTTCTTAC
GAACTGGGGTTTCCATTTTACTAAATTTAAAAAGAACCCTATTCAAACAA
ATTTATAATA
back to top

protein sequence of SMED30035373-orf-1

>SMED30035373-orf-1 ID=SMED30035373-orf-1|Name=SMED30035373-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=465bp
METPVRKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME
VYKPSKATADDMTMFHTDEYIQFLQRIHPDNMHEYNKEMQRFNVGEDCPV
FDGLFEFCQLSAGGSVASAVKLNKNKADIAINWSGGLHHAKKSEASGFCY
VNDIVMGILELLKYHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYG
EYFPGTGDIKDIGAGKGKNYAVNFPLRDGIDDESYESIFKPVVEKVIESF
KPNAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEYMRQQPIPLLMLGGGG
YTIRNVARCWTYETALALGTTIPNELPYNDYYEYFTPDFKLHISPSNMAN
QNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPEDAMDIDDGEQMDNADP
DKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKSKRPRLDGPNSGTG
DSLDKANEDLASTN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002013Category 1 cell
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000286His_deacetylse
IPR003084His_deacetylse_1
IPR023801His_deacetylse_dom
Vocabulary: molecular function
TermDefinition
GO:0004407histone deacetylase activity
Vocabulary: biological process
TermDefinition
GO:0016575histone deacetylation