Peptidyl-prolyl cis-trans isomerase

Overview
NamePeptidyl-prolyl cis-trans isomerase
Smed IDSMED30035360
Length (bp)1068
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidyl-prolyl cis-trans isomerase (SMED30035360) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidyl-prolyl cis-trans isomerase (SMED30035360) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidyl-prolyl cis-trans isomerase (SMED30035360) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidyl-prolyl cis-trans isomerase (SMED30035360) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035360

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30035360SMESG000006589.1 dd_Smed_v4_133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30035360SMESG000006589.1 dd_Smed_v4_133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035360SMESG000006589.1 dd_Smed_v4_133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035360SMESG000006589.1 dd_Smed_v4_133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035360SMESG000006589.1 dd_Smed_v4_133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035360SMESG000006589.1 dd_Smed_v4_133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035360SMESG000006589.1 dd_Smed_v4_133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035360SMESG000006589.1 dd_Smed_v4_133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035360SMESG000006589.1 dd_Smed_v4_133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035360SMESG000006589.1 dd_Smed_v4_133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035360SMESG000006589.1 dd_Smed_v4_133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035360SMESG000006589.1 dd_Smed_v4_133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035360SMESG000081529.1 SMESG000070576.1 SMESG000058567.1 SMESG000052523.1 SMESG000049990.1 SMESG000047442.1 SMESG000047318.1 SMESG000045754.1 SMESG000038610.1 SMESG000026672.1 SMESG000013980.1 SMESG000007764.1 SMESG000006589.1 SMESG000004279.1 Contig15066uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035360SMESG000081529.1 SMESG000070576.1 SMESG000058567.1 SMESG000052523.1 SMESG000049990.1 SMESG000047442.1 SMESG000047318.1 SMESG000045754.1 SMESG000038610.1 SMESG000026672.1 SMESG000013980.1 SMESG000007764.1 SMESG000006589.1 SMESG000004279.1 Contig15066newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30035360SMESG000006589.1 dd_Smed_v6_133_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIA (peptidylprolyl isomerase A [Source:HGNC Symbol;Acc:HGNC:9253])

HSP 1 Score: 209.149 bits (531), Expect = 1.280e-66
Identity = 113/158 (71.52%), Postives = 128/158 (81.01%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            FFDIAVD + LGR+ F L+   VPKT ENFR L TGEKGFGYKGS FHRIIP FM QGGDFT+ NGTGGKSIYGEKF DENF  KHT PG+LSMANAGPNTNGSQFFI T  T WLDGKHVVFG+V EGM++V+ +E+ GS +GK + +I I +CGQL
Sbjct:    7 FFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIF (peptidylprolyl isomerase F [Source:HGNC Symbol;Acc:HGNC:9259])

HSP 1 Score: 206.838 bits (525), Expect = 3.016e-65
Identity = 107/158 (67.72%), Postives = 124/158 (78.48%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + D+  + K LGR+V  L    VPKT ENFR LCTGEKGFGYKGS FHR+IP+FM Q GDFT  NGTGGKSIYG +F DENF  KH  PG+LSMANAGPNTNGSQFFI T+ T+WLDGKHVVFG V EGMD+VK+IE  GS SG+ + +I+I +CGQL
Sbjct:   49 YLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQL 206          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIE (peptidylprolyl isomerase E [Source:HGNC Symbol;Acc:HGNC:9258])

HSP 1 Score: 196.823 bits (499), Expect = 1.024e-60
Identity = 105/159 (66.04%), Postives = 121/159 (76.10%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQ 593
            Q + DI +  K  GRI   L    VP T ENFR LCT EKGFG+KGS FHRIIP FM QGGDFT  NGTGGKSIYG+KF DENF  KHT PGLLSMAN+GPNTNGSQFF+T   T+WLDGKHVVFGEV EG+D+++QIE  GS  GKP  +++I +CG+
Sbjct:   90 QVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGE 248          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIE (peptidylprolyl isomerase E [Source:HGNC Symbol;Acc:HGNC:9258])

HSP 1 Score: 197.208 bits (500), Expect = 3.465e-60
Identity = 105/159 (66.04%), Postives = 121/159 (76.10%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQ 593
            Q + DI +  K  GRI   L    VP T ENFR LCT EKGFG+KGS FHRIIP FM QGGDFT  NGTGGKSIYG+KF DENF  KHT PGLLSMAN+GPNTNGSQFF+T   T+WLDGKHVVFGEV EG+D+++QIE  GS  GKP  +++I +CG+
Sbjct:  141 QVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGE 299          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIB (peptidylprolyl isomerase B [Source:HGNC Symbol;Acc:HGNC:9255])

HSP 1 Score: 190.274 bits (482), Expect = 1.210e-58
Identity = 100/165 (60.61%), Postives = 133/165 (80.61%), Query Frame = 3
Query:  105 NMVVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDS-GKPANEILIENCGQL 596
             + V+ +FD+ +  + +GR++F L+   VPKTV+NF  L TGEKGFGYK SKFHR+I +FM+QGGDFT+G+GTGGKSIYGE+F DENFK KH  PG +SMANAG +TNGSQFFITTV T WLDGKHVVFG+V+EGM++V+++E   +DS  KP  +++I +CG++
Sbjct:   41 KVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKI 205          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-3 (Peptidyl-prolyl cis-trans isomerase 3 [Source:UniProtKB/Swiss-Prot;Acc:P52011])

HSP 1 Score: 211.46 bits (537), Expect = 6.595e-68
Identity = 116/167 (69.46%), Postives = 130/167 (77.84%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFG-------YKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + FFDI +  K  GRIV  LYD  VPKT  NFR LCTGE G G       +KGSKFHRIIPNFM+QGGDFT+GNGTGG+SIYGEKF DENFK KHT PG+LSMANAGPNTNGSQFF+ TV T WLDGKHVVFG VVEG+D+VK +E  GS SGKP  + +I +CGQL
Sbjct:    5 KVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQSGKPVKDCMIADCGQL 171          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-7 (Peptidyl-prolyl cis-trans isomerase 7 [Source:UniProtKB/Swiss-Prot;Acc:P52015])

HSP 1 Score: 210.69 bits (535), Expect = 1.333e-67
Identity = 116/167 (69.46%), Postives = 131/167 (78.44%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFG-------YKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + FFDI +  K  GRIV  LY+  VPKT ENFR LCTGEKG G       +KGSKFHRIIP FM+QGGDFT+GNGTGG+SIYGEKF DENFK KHT PG+LSMANAGPNTNGSQFF+ TV T WLDGKHVVFG VVEG+D+V ++E  GS SG P +E LI +CGQL
Sbjct:    5 RVFFDITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLDGKHVVFGRVVEGLDIVSKVEGNGSSSGTPKSECLIADCGQL 171          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-7 (Peptidyl-prolyl cis-trans isomerase 7 [Source:UniProtKB/Swiss-Prot;Acc:P52015])

HSP 1 Score: 210.69 bits (535), Expect = 1.333e-67
Identity = 116/167 (69.46%), Postives = 131/167 (78.44%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFG-------YKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + FFDI +  K  GRIV  LY+  VPKT ENFR LCTGEKG G       +KGSKFHRIIP FM+QGGDFT+GNGTGG+SIYGEKF DENFK KHT PG+LSMANAGPNTNGSQFF+ TV T WLDGKHVVFG VVEG+D+V ++E  GS SG P +E LI +CGQL
Sbjct:    5 RVFFDITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLDGKHVVFGRVVEGLDIVSKVEGNGSSSGTPKSECLIADCGQL 171          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-1 (Peptidyl-prolyl cis-trans isomerase 1 [Source:UniProtKB/Swiss-Prot;Acc:P52009])

HSP 1 Score: 205.297 bits (521), Expect = 2.995e-65
Identity = 110/176 (62.50%), Postives = 132/176 (75.00%), Query Frame = 3
Query:   90 SIYFLNMVVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFG-------YKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            S+ F +   + FFD+++ ++  GR+   L++  VPKT ENFR LCTGEKG G       +KGSKFHRIIP FM+QGGDFT+ NGTGG+SIYG KF DENF  KHT PG LSMANAGPNTNGSQFFI TV T WLDG HVVFG+V +GM +VK+IEKMGS SG PA  + I +CG+L
Sbjct:   14 SLRFASQRPKVFFDVSIGEEPAGRVTMELFNDVVPKTAENFRALCTGEKGVGEQGVALHFKGSKFHRIIPEFMIQGGDFTRHNGTGGESIYGNKFKDENFDLKHTGPGCLSMANAGPNTNGSQFFICTVDTPWLDGGHVVFGQVTDGMSVVKKIEKMGSRSGAPAKTVTIADCGEL 189          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-2 (Peptidyl-prolyl cis-trans isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:P52010])

HSP 1 Score: 189.889 bits (481), Expect = 1.440e-59
Identity = 111/168 (66.07%), Postives = 130/168 (77.38%), Query Frame = 3
Query:  114 VQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKG-------FGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            V+ FFDI +  KK GRIV  LY+  VPKT ENFR LCTGEKG         +KGSKFHRIIP FM+QGGDFT+GNGTGG+SI+GEKF DENFK KHT PG+LSMAN G NTNGSQFF+ TV T WLDGKHVVFG+V+EGMD+VK IE  GS+ G P+   +I +CG++
Sbjct:    4 VKVFFDITIGGKKGGRIVMELYNDIVPKTAENFRALCTGEKGKGKSGKKLHFKGSKFHRIIPEFMIQGGDFTEGNGTGGESIHGEKFDDENFKEKHTGPGVLSMANCGANTNGSQFFLCTVKTTWLDGKHVVFGKVIEGMDVVKAIESKGSEDGAPSAPCVIADCGEM 171          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: Cyp1 (gene:FBgn0004432 transcript:FBtr0074238)

HSP 1 Score: 208.764 bits (530), Expect = 4.740e-66
Identity = 112/165 (67.88%), Postives = 128/165 (77.58%), Query Frame = 3
Query:  102 LNMVVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            ++ + + FFD+  D + LGRIV  L    VPKT ENFR LCTGEKGFGYKGS FHR+IPNFM QGGDFT  NGTGGKSIYG KF DENF+ KHT  G+LSMANAG NTNGSQFFI TV T WLD KHVVFGEVVEG+D+VK+IE  GS SGK + +I++ N G L
Sbjct:   63 MSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG7768 (gene:FBgn0036415 transcript:FBtr0075736)

HSP 1 Score: 205.297 bits (521), Expect = 1.820e-65
Identity = 108/160 (67.50%), Postives = 126/160 (78.75%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + +FDIA   +KLGRIV  L    VPKT ENFR LCTGEKG+GYKGS FHR+IPNFM QGGDFT  NGTGG+SIYG KF DENF+ KHT  G+LSMANAG NTNGSQFFI T  T WLD KHVVFG+VVEGMD+V+++E  GS  GK + +++IE+CG L
Sbjct:    5 RVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG7768 (gene:FBgn0036415 transcript:FBtr0075737)

HSP 1 Score: 205.297 bits (521), Expect = 1.820e-65
Identity = 108/160 (67.50%), Postives = 126/160 (78.75%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + +FDIA   +KLGRIV  L    VPKT ENFR LCTGEKG+GYKGS FHR+IPNFM QGGDFT  NGTGG+SIYG KF DENF+ KHT  G+LSMANAG NTNGSQFFI T  T WLD KHVVFG+VVEGMD+V+++E  GS  GK + +++IE+CG L
Sbjct:    5 RVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: cyp33 (gene:FBgn0028382 transcript:FBtr0086945)

HSP 1 Score: 183.341 bits (464), Expect = 3.295e-55
Identity = 99/160 (61.88%), Postives = 118/160 (73.75%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            Q FFDI +     GRIV  L    VPKT ENFR LCT E+G+GYKG  FHR+IP FM QGGDFT  NGTGGKSIYG+KF DENF  KH   G LSMAN+G NTNGSQFFI T  T+WLD KHVVFG V+ G ++V+++E+ GS SG P+ +I+I +CG+L
Sbjct:  140 QVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSGTPSQKIVIYSCGEL 299          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG2852 (gene:FBgn0034753 transcript:FBtr0071933)

HSP 1 Score: 174.096 bits (440), Expect = 8.575e-53
Identity = 98/167 (58.68%), Postives = 125/167 (74.85%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDS-GKPANEILIENCGQL*ISIVF 614
            + FFDI +  +  GRI   L+   VPKTVENF+ L    +G GYKGSKFHRII +FM+QGGDFTKG+GTGG+SIYGE+F DENFK KH   G LSMANAG +TNGSQFFITT  T+WLDG+HVVFG+++ GM++V+QIE   +D+  +P  +++I N G L +S  F
Sbjct:   30 KVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSEAF 196          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppiab (peptidylprolyl isomerase Ab (cyclophilin A) [Source:ZFIN;Acc:ZDB-GENE-030131-7459])

HSP 1 Score: 209.534 bits (532), Expect = 4.892e-67
Identity = 113/160 (70.62%), Postives = 125/160 (78.12%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + FFDI +D K+ GRIV  L    VPKT ENFR LCTGEKGFGYKGS FHR+IP FM QGGDFT  NGTGGKSIYG KF DENF  KH   G LSMANAGPNTNGSQFFI T  TNWLDGKHVVFG+VV+G+D+V  IEK GS SGK + +++I NCGQL
Sbjct:    5 KVFFDITIDGKEAGRIVMELRADVVPKTAENFRALCTGEKGFGYKGSGFHRVIPQFMCQGGDFTNHNGTGGKSIYGNKFEDENFTLKHGGKGTLSMANAGPNTNGSQFFICTADTNWLDGKHVVFGKVVDGLDVVDAIEKKGSSSGKCSAKVVIANCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppifb (peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-GENE-051030-126])

HSP 1 Score: 206.838 bits (525), Expect = 1.236e-65
Identity = 109/158 (68.99%), Postives = 123/158 (77.85%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            FFDIA D + LGR+ F L    VPKT ENFR LCTGE GFGYKGS FHR+IP FM QGGDFT  NGTGGKSIYG +F DENFK KHT PG+LSMANAG NTNGSQFFI T  T WLDG+HVVFG V EGMD+V+++E +GS SG+ A  I I +CG+L
Sbjct:   34 FFDIAADNQPLGRVTFELNADVVPKTAENFRALCTGEHGFGYKGSIFHRVIPQFMCQGGDFTNHNGTGGKSIYGPRFPDENFKLKHTGPGILSMANAGVNTNGSQFFICTAKTEWLDGRHVVFGSVKEGMDVVRKVEALGSRSGRTAQRISITDCGEL 191          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppiaa (peptidylprolyl isomerase Aa (cyclophilin A) [Source:ZFIN;Acc:ZDB-GENE-030131-8556])

HSP 1 Score: 203.371 bits (516), Expect = 1.065e-64
Identity = 105/160 (65.62%), Postives = 125/160 (78.12%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + FFD+      +GR+V  L    VP+T ENFR LCTG+ G+GYKGS FHR+IP FM QGGDFT  NGTGGKSIYG KFADENF  KHT  G LSMANAGPNTNGSQFFI T +T+WLDGKHVVFG+VVEG+D++K++E  GS SGK + +I+I +CGQL
Sbjct:    5 KVFFDLTAGGSPVGRVVMELRTDVVPRTAENFRQLCTGQPGYGYKGSSFHRVIPGFMCQGGDFTNHNGTGGKSIYGNKFADENFNLKHTGAGCLSMANAGPNTNGSQFFICTALTSWLDGKHVVFGQVVEGLDVIKKVEGFGSSSGKTSAKIIIADCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppifa (peptidylprolyl isomerase Fa [Source:ZFIN;Acc:ZDB-GENE-040912-52])

HSP 1 Score: 190.274 bits (482), Expect = 3.475e-59
Identity = 104/158 (65.82%), Postives = 118/158 (74.68%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            F DIA D + +GRI+  L+   VPKTV NFR LCTGE GFGYKGS FHRIIP FM QGGDFT  NGTGGKSIYG+KF DENFK KHT  G+LSMAN+GPNTNGSQFFI T  T WLDGKHVVFG+V EGM+ V  +E  G   G    ++ I +CG+L
Sbjct:   31 FMDIAADGEFIGRIIIELFADVVPKTVANFRALCTGEHGFGYKGSVFHRIIPEFMCQGGDFTNHNGTGGKSIYGKKFNDENFKLKHTGAGILSMANSGPNTNGSQFFICTAKTEWLDGKHVVFGQVKEGMETVSLMESYGLHDGGTVKKVAITDCGEL 188          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppie (peptidylprolyl isomerase E (cyclophilin E) [Source:ZFIN;Acc:ZDB-GENE-050417-167])

HSP 1 Score: 191.815 bits (486), Expect = 5.948e-58
Identity = 102/159 (64.15%), Postives = 118/159 (74.21%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQ 593
            Q + DI +  K  GR+ F L    VP T ENFR LCT EKGFG+KGS FHRIIP FM QGGDFT  NGTGGKSIYG KF DENF  KHT  G LSMAN+GPNTNGSQFFIT   T+WLDGKHVVFGE+ EGMD+++ +E  G+  GKP  +++I NCG+
Sbjct:  173 QVYMDIKIGNKPAGRLRFLLRADVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGRKFEDENFVLKHTHAGQLSMANSGPNTNGSQFFITVDKTDWLDGKHVVFGELTEGMDVLRAMEAQGTKDGKPKQKVIISNCGE 331          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: ppia (peptidylprolyl isomerase A (cyclophilin A) [Source:NCBI gene;Acc:394470])

HSP 1 Score: 216.468 bits (550), Expect = 1.228e-69
Identity = 114/160 (71.25%), Postives = 129/160 (80.62%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + FFDIAVD   +GRI+  L    VPKT ENFR LCT EKGFGYK S FHRIIP FM QGGDFT  NGTGGKSIYG KFADENF+ +HT PG+LSMANAG NTNGSQFFI T  T+WLDGKHVVFG V++GMD+V+ +EK+GS SGKPA +I+I NCGQL
Sbjct:    5 RVFFDIAVDGCPMGRIIMELRSDVVPKTAENFRALCTNEKGFGYKNSGFHRIIPEFMCQGGDFTNHNGTGGKSIYGNKFADENFQLRHTGPGILSMANAGANTNGSQFFICTAKTSWLDGKHVVFGTVIDGMDVVRNMEKLGSQSGKPAKKIVIANCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: neurl4 (neuralized E3 ubiquitin protein ligase 4 [Source:Xenbase;Acc:XB-GENE-5825550])

HSP 1 Score: 200.675 bits (509), Expect = 7.101e-63
Identity = 103/158 (65.19%), Postives = 123/158 (77.85%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + D+  D + LGR+ F L    VPKT ENFR LCTGEKGFGYKGS FHRIIPNFM QGGDFT  NGTGGKSIYG +F DENF  KHT PG++SMANAGPNTNGSQFFI TV T WLD KHVVFG + +G D++K+IE  GS +G+P+ ++++  CG+L
Sbjct:   42 YMDLVADNQPLGRVTFELRADVVPKTAENFRALCTGEKGFGYKGSTFHRIIPNFMCQGGDFTNHNGTGGKSIYGSRFPDENFFLKHTGPGVVSMANAGPNTNGSQFFICTVETEWLDNKHVVFGCIKDGYDIMKKIESFGSKTGRPSKKVVVAECGEL 199          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: PPIE (peptidylprolyl isomerase E (cyclophilin E) [Source:NCBI gene;Acc:100495035])

HSP 1 Score: 199.904 bits (507), Expect = 4.244e-62
Identity = 108/159 (67.92%), Postives = 120/159 (75.47%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQ 593
            Q + DI +  K  GRI F L    VP TVENFR LC  EKGFGYKGS FHRIIP FMLQ GDFT  NGTGGKSIYG KF DENF  KHT PGLLSMAN+G NTNGSQFFIT   T+WLDGKHVVFGEV+EGMD+V+QIE  G   GKP  +++I +CG+
Sbjct:   79 QVYMDIKIGNKPAGRIRFLLRADIVPMTVENFRCLCNHEKGFGYKGSSFHRIIPQFMLQAGDFTNHNGTGGKSIYGRKFDDENFILKHTGPGLLSMANSGANTNGSQFFITCDKTDWLDGKHVVFGEVMEGMDVVRQIEAQGGKDGKPKQKVIISDCGE 237          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: PPIE (peptidylprolyl isomerase E (cyclophilin E) [Source:NCBI gene;Acc:100495035])

HSP 1 Score: 200.29 bits (508), Expect = 1.260e-61
Identity = 108/159 (67.92%), Postives = 120/159 (75.47%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQ 593
            Q + DI +  K  GRI F L    VP TVENFR LC  EKGFGYKGS FHRIIP FMLQ GDFT  NGTGGKSIYG KF DENF  KHT PGLLSMAN+G NTNGSQFFIT   T+WLDGKHVVFGEV+EGMD+V+QIE  G   GKP  +++I +CG+
Sbjct:  121 QVYMDIKIGNKPAGRIRFLLRADIVPMTVENFRCLCNHEKGFGYKGSSFHRIIPQFMLQAGDFTNHNGTGGKSIYGRKFDDENFILKHTGPGLLSMANSGANTNGSQFFITCDKTDWLDGKHVVFGEVMEGMDVVRQIEAQGGKDGKPKQKVIISDCGE 279          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: PPIE (peptidylprolyl isomerase E (cyclophilin E) [Source:NCBI gene;Acc:100495035])

HSP 1 Score: 200.675 bits (509), Expect = 2.063e-61
Identity = 108/159 (67.92%), Postives = 120/159 (75.47%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQ 593
            Q + DI +  K  GRI F L    VP TVENFR LC  EKGFGYKGS FHRIIP FMLQ GDFT  NGTGGKSIYG KF DENF  KHT PGLLSMAN+G NTNGSQFFIT   T+WLDGKHVVFGEV+EGMD+V+QIE  G   GKP  +++I +CG+
Sbjct:  152 QVYMDIKIGNKPAGRIRFLLRADIVPMTVENFRCLCNHEKGFGYKGSSFHRIIPQFMLQAGDFTNHNGTGGKSIYGRKFDDENFILKHTGPGLLSMANSGANTNGSQFFITCDKTDWLDGKHVVFGEVMEGMDVVRQIEAQGGKDGKPKQKVIISDCGE 310          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppif (peptidylprolyl isomerase F (cyclophilin F) [Source:MGI Symbol;Acc:MGI:2145814])

HSP 1 Score: 209.92 bits (533), Expect = 1.630e-66
Identity = 107/158 (67.72%), Postives = 123/158 (77.85%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + D+  D + LGR+V  L    VPKT ENFR LCTGEKGFGYKGS FHR+IP FM Q GDFT  NGTGG+SIYG +F DENF  KH  PG+LSMANAGPNTNGSQFFI T+ T+WLDGKHVVFG V EGMD+VK+IE  GS SGK + +I+I +CGQL
Sbjct:   48 YLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGRSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQL 205          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppia (peptidylprolyl isomerase A [Source:MGI Symbol;Acc:MGI:97749])

HSP 1 Score: 207.608 bits (527), Expect = 2.862e-66
Identity = 110/158 (69.62%), Postives = 126/158 (79.75%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            FFDI  D + LGR+ F L+   VPKT ENFR L TGEKGFGYKGS FHRIIP FM QGGDFT+ NGTGG+SIYGEKF DENF  KHT PG+LSMANAGPNTNGSQFFI T  T WLDGKHVVFG+V EGM++V+ +E+ GS +GK + +I I +CGQL
Sbjct:    7 FFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppie (peptidylprolyl isomerase E (cyclophilin E) [Source:MGI Symbol;Acc:MGI:1917118])

HSP 1 Score: 197.978 bits (502), Expect = 1.347e-60
Identity = 105/159 (66.04%), Postives = 121/159 (76.10%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQ 593
            Q + DI +  K  GRI   L    VP T ENFR LCT EKGFG+KGS FHRIIP FM QGGDFT  NGTGGKSIYG+KF DENF  KHT PGLLSMAN+GPNTNGSQFF+T   T+WLDGKHVVFGEV EG+D+++QIE  GS  GKP  +++I +CG+
Sbjct:  141 QVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVMIADCGE 299          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppia (peptidylprolyl isomerase A [Source:MGI Symbol;Acc:MGI:97749])

HSP 1 Score: 189.504 bits (480), Expect = 3.058e-59
Identity = 101/141 (71.63%), Postives = 115/141 (81.56%), Query Frame = 3
Query:  174 LYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            L+   VPKT ENFR L TGEKGFGYKGS FHRIIP FM QGGDFT+ NGTGG+SIYGEKF DENF  KHT PG+LSMANAGPNTNGSQFFI T  T WLDGKHVVFG+V EGM++V+ +E+ GS +GK + +I I +CGQL
Sbjct:   16 LFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL 156          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppib (peptidylprolyl isomerase B [Source:MGI Symbol;Acc:MGI:97750])

HSP 1 Score: 189.119 bits (479), Expect = 2.238e-58
Identity = 101/164 (61.59%), Postives = 133/164 (81.10%), Query Frame = 3
Query:  108 MVVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDS-GKPANEILIENCGQL 596
            + V+ +FD+ +  + +GR+VF L+   VPKTV+NF  L TGEKGFGYK SKFHR+I +FM+QGGDFT+G+GTGGKSIYGE+F DENFK KH  PG +SMANAG +TNGSQFFITTV T+WLDGKHVVFG+V+EGMD+V+++E   +DS  KP  +++I + G++
Sbjct:   42 VTVKVYFDLQIGDESVGRVVFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVESTKTDSRDKPLKDVIIVDSGKI 205          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P14088|PPIA_ECHGR (Peptidyl-prolyl cis-trans isomerase OS=Echinococcus granulosus OX=6210 GN=CYP-1 PE=2 SV=2)

HSP 1 Score: 223.016 bits (567), Expect = 1.627e-71
Identity = 122/163 (74.85%), Postives = 135/163 (82.82%), Query Frame = 3
Query:  108 MVVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            M V+ FFDI++  K  GRIVF L+D DVPKTVENFR LCTGEKGFGYKGSKFHRIIP FM QGGDFT GNGTGGKSIYG KF DENF  KH+KP +LSMANAG NTNGSQFFITT VT+WLDGKHVVFGEV  G D+VK +E +GS SGK + E+LI +CGQL
Sbjct:    1 MGVKCFFDISIGGKPAGRIVFALFD-DVPKTVENFRALCTGEKGFGYKGSKFHRIIPGFMCQGGDFTAGNGTGGKSIYGSKFEDENFNHKHSKPMMLSMANAGKNTNGSQFFITTAVTSWLDGKHVVFGEVESGEDVVKDMEAVGSSSGKTSQEVLITDCGQL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P18253|CYPH_SCHPO (Peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppi1 PE=3 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 3.549e-70
Identity = 116/158 (73.42%), Postives = 131/158 (82.91%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            FFD+  + + LGRIVF L+D  VPKT  NFR LCTGEKG+GY GS FHR+IP FMLQGGDFT+GNGTGGKSIYGEKF DENF  KH KPGLLSMANAGPNTNGSQFFITTVVT WLDGKHVVFGEV EGMD+VK++E +GS+SG     I+I+ CG +
Sbjct:    5 FFDVIANGQPLGRIVFKLFDDVVPKTAANFRALCTGEKGYGYAGSTFHRVIPQFMLQGGDFTRGNGTGGKSIYGEKFPDENFALKHNKPGLLSMANAGPNTNGSQFFITTVVTPWLDGKHVVFGEVTEGMDVVKKVESLGSNSGATRARIVIDKCGTV 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|Q9TW32|PPIB_DICDI (Peptidyl-prolyl cis-trans isomerase B OS=Dictyostelium discoideum OX=44689 GN=cypB PE=1 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 8.940e-70
Identity = 119/167 (71.26%), Postives = 135/167 (80.84%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFG-------YKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + FFDI +D K  GRIVF LY   VPKTVENFR LCTGEKG G       YK SKFHRIIPNFM+QGGDFT+G+GTGG+SIYG+KF DENFK KH+KPGLLSMANAGPNTNGSQFFITTVVT+WLDG+H VFGEV+EGMD+VK +E +GS SG P+    I N G+L
Sbjct:   31 KVFFDIEIDNKPAGRIVFGLYGKTVPKTVENFRALCTGEKGLGTSGKPLHYKDSKFHRIIPNFMIQGGDFTRGDGTGGESIYGKKFNDENFKIKHSKPGLLSMANAGPNTNGSQFFITTVVTSWLDGRHTVFGEVIEGMDIVKLLESIGSQSGTPSKIAKISNSGEL 197          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P91791|PPIA_HEMPU (Peptidyl-prolyl cis-trans isomerase OS=Hemicentrotus pulcherrimus OX=7650 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 6.866e-69
Identity = 113/160 (70.62%), Postives = 130/160 (81.25%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            Q FFD+  + + LGRIV  L    VPKT ENFR LCTGEKGFGYKGS FHR+IP FM QGGDFT+ NGTGGKSIYGEKFADENF  KHT+PG+LSMANAG NTNGSQFFI T VT+WLDGKHVVFG V +G+D++K++E  GSDSGK + +I I +CGQL
Sbjct:    5 QVFFDLQANGENLGRIVMELRADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPGFMCQGGDFTRHNGTGGKSIYGEKFADENFTLKHTQPGILSMANAGVNTNGSQFFICTAVTSWLDGKHVVFGAVTQGLDIIKKVESYGSDSGKTSKKITIADCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P22011|PPIA_CANAL (Peptidyl-prolyl cis-trans isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CYP1 PE=3 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 9.919e-69
Identity = 115/158 (72.78%), Postives = 130/158 (82.28%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            +FD++ D +KLG+I F LYD  VPKT ENFR LCTGEKGFGYKGS FHR+IP FMLQGGDFT  NGTGGKSIYG KFADENF  +H +PGLLSMANAGPNTNGSQFFITTV   WLDGKHVVFGEV +G+D+VK+IE  GS SG  + +I+IE  GQL
Sbjct:    5 YFDVSADGQKLGKITFKLYDDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPQFMLQGGDFTNFNGTGGKSIYGTKFADENFVKRHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTDGLDIVKKIESFGSGSGATSKKIVIEESGQL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A1D7V8 (Peptidyl-prolyl cis-trans isomerase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_069730 PE=3 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 7.511e-75
Identity = 129/163 (79.14%), Postives = 139/163 (85.28%), Query Frame = 3
Query:  108 MVVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            MVV+TFFDIA+D +  GRI F L+D  VPKT ENFR LCTGEKGFGYKGS FHRIIP FMLQGGDFTKGNGTGGKSIYGEKFADENF+ KH KPGLLSMANAG NTNGSQFFITTVVT+WL+G HVVFGEV EGMDLVK+IE  GS SG P  +I I +CGQL
Sbjct:    1 MVVKTFFDIAIDGQPAGRITFKLFDEVVPKTAENFRALCTGEKGFGYKGSSFHRIIPQFMLQGGDFTKGNGTGGKSIYGEKFADENFQLKHDKPGLLSMANAGRNTNGSQFFITTVVTDWLNGAHVVFGEVEEGMDLVKKIESYGSSSGTPKKKITIADCGQL 163          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A2C6A2A9 (Peptidyl-prolyl cis-trans isomerase OS=Cordyceps sp. RAO-2017 OX=2004951 GN=CDD83_10551 PE=3 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 1.211e-74
Identity = 123/160 (76.88%), Postives = 138/160 (86.25%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            Q +F+++ DKK LG+IV  LYD  VPKT ENFR L TGEKGFGY GS FHR+I +FMLQGGDFT  NGTGGKSIYGEKFADENFK KHTKPGLLSMANAGPNTNGSQFFITTVVT+WLDGKHVVFGEV EGMD+VKQIE +GS SGK + +++I+ CGQL
Sbjct:    3 QVYFEVSADKKPLGKIVMKLYDDVVPKTAENFRALATGEKGFGYAGSSFHRVITDFMLQGGDFTNHNGTGGKSIYGEKFADENFKLKHTKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVTEGMDVVKQIEALGSQSGKTSKKVIIDKCGQL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A2I1C2E5 (Peptidyl-prolyl cis-trans isomerase OS=Aspergillus novofumigatus IBT 16806 OX=1392255 GN=P174DRAFT_453038 PE=3 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 2.739e-74
Identity = 128/163 (78.53%), Postives = 139/163 (85.28%), Query Frame = 3
Query:  108 MVVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            MVV+TFFDI +D +  GRI F L+D  VPKT ENFR LCTGEKGFGYKGS FHRIIP FMLQGGDFTKGNGTGGKSIYGEKFADENF+ KH KPGLLSMANAG NTNGSQFFITTVVT+WL+G HVVFGEV EGMDLVK IEK+GS SG P  ++ I +CGQL
Sbjct:    1 MVVKTFFDITIDGQPAGRIKFKLFDDVVPKTAENFRALCTGEKGFGYKGSSFHRIIPQFMLQGGDFTKGNGTGGKSIYGEKFADENFQLKHDKPGLLSMANAGRNTNGSQFFITTVVTDWLNGAHVVFGEVEEGMDLVKTIEKLGSSSGTPKKKVTIADCGQL 163          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A1CJM3 (Peptidyl-prolyl cis-trans isomerase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) OX=344612 GN=ACLA_035500 PE=3 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 7.285e-74
Identity = 126/163 (77.30%), Postives = 138/163 (84.66%), Query Frame = 3
Query:  108 MVVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            M V+TFFDIA+D    GRI F L+D  VPKT ENFR LCTGEKGFGYKGS FHR+IP FMLQGGDFT+GNGTGGKSIYGEKFADENF  KH KPGLLSMANAG NTNGSQFFITTVVT+WLDG HVVFGEV +GMDLVK+IE +G+ SG    +I+IENCGQL
Sbjct:    1 MGVKTFFDIAIDGAPAGRITFNLFDDVVPKTAENFRALCTGEKGFGYKGSAFHRVIPQFMLQGGDFTRGNGTGGKSIYGEKFADENFTLKHNKPGLLSMANAGKNTNGSQFFITTVVTSWLDGAHVVFGEVEDGMDLVKKIEGLGTSSGTTKKKIVIENCGQL 163          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A0B4HTC6 (Peptidyl-prolyl cis-trans isomerase (Fragment) OS=Metarhizium majus (strain ARSEF 297) OX=1276143 GN=MAJ_01670 PE=3 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 9.671e-74
Identity = 125/160 (78.12%), Postives = 136/160 (85.00%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            Q FFD++ D   LG+IVF LYD  VPKT ENFR L TGEKGFGY GS FHR+IP+FMLQGGDFT  NGTGGKSIYGEKFADENF  KHTKPGLLSMANAGPNTNGSQFFITTVVT+WLDGKHVVFGEVVEGMD+VK+IE MGS SGK   +I+I+  GQL
Sbjct:    5 QVFFDVSADGAPLGKIVFKLYDDVVPKTAENFRALATGEKGFGYAGSSFHRVIPDFMLQGGDFTNHNGTGGKSIYGEKFADENFSLKHTKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVVEGMDVVKKIETMGSGSGKTKKKIVIDKSGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppifb (peptidyl-prolyl cis-trans isomerase A-like [Source:NCBI gene;Acc:103040813])

HSP 1 Score: 207.994 bits (528), Expect = 4.042e-66
Identity = 108/158 (68.35%), Postives = 124/158 (78.48%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            +FDIA D + LGR+ F L    VPKT ENFR LCTGE G+GYKGS FHR+IP FM QGGDFT  NGTGGKSIYG +F DENFK +HT PG+LSMANAGPNTNGSQFFI TV T WLDG+HVVFG V +G+D+VKQ+E  GS SGK +  I I +CG+L
Sbjct:   36 YFDIAADNQPLGRVTFELNADVVPKTAENFRALCTGEHGYGYKGSIFHRVIPQFMCQGGDFTHHNGTGGKSIYGPRFHDENFKLRHTGPGILSMANAGPNTNGSQFFICTVKTEWLDGRHVVFGSVKDGLDVVKQVEAFGSRSGKTSKRITITDCGEL 193          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppiab (peptidylprolyl isomerase Ab (cyclophilin A) [Source:ZFIN;Acc:ZDB-GENE-030131-7459])

HSP 1 Score: 197.208 bits (500), Expect = 2.375e-62
Identity = 111/160 (69.38%), Postives = 123/160 (76.88%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + FFDI V+    GRIV  + D       ENFR LCTGEKGFGYKGS FHRIIP FM QGGDFTK NGTGGKSIYGEKFADENF  KH   G LSMANAGPNTNGSQFFI T  T WLDGKHVVFG+VVEG+D+V+ +EK GS SGK + ++LI +CGQL
Sbjct:    5 RVFFDITVNGTSAGRIVIEVSD-------ENFRALCTGEKGFGYKGSGFHRIIPGFMCQGGDFTKHNGTGGKSIYGEKFADENFTLKHQGLGTLSMANAGPNTNGSQFFICTADTAWLDGKHVVFGKVVEGIDVVEAVEKKGSSSGKCSAKVLIADCGQL 157          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppifa (peptidyl-prolyl cis-trans isomerase F, mitochondrial [Source:NCBI gene;Acc:103029282])

HSP 1 Score: 192.2 bits (487), Expect = 5.592e-60
Identity = 105/158 (66.46%), Postives = 120/158 (75.95%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            F D++ D + +GRIV  L+   VPKT ENFR LCTGE GFGYKGS FHRIIP FM QGGDFT  NGTGGKSIYG+KF+DENFK KHT PG+LSMAN+GPNTNGSQFFI TV T  LDGKHVVFG V EGM+ V  +E  G   G    +I+I +CG+L
Sbjct:   31 FLDVSADGEFIGRIVIELHADVVPKTAENFRALCTGEHGFGYKGSVFHRIIPEFMCQGGDFTNHNGTGGKSIYGKKFSDENFKLKHTGPGVLSMANSGPNTNGSQFFICTVKTECLDGKHVVFGHVTEGMETVSVMESYGLHDGGTVKKIVITDCGEL 188          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppie (peptidylprolyl isomerase E (cyclophilin E) [Source:ZFIN;Acc:ZDB-GENE-050417-167])

HSP 1 Score: 189.504 bits (480), Expect = 1.354e-57
Identity = 101/159 (63.52%), Postives = 119/159 (74.84%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQ 593
            Q + DI +  K  GR+ F L    VP T ENFR LCT EKGFG+KGS FHR+IP FM QGGDFT  NGTGGKSIYG KF DENF  KHT PG LSMAN+G NTNGSQFFIT   T+WLDGKHVVFGE++EGMD+V+ +E  G+  GKP  +++I +CG+
Sbjct:  138 QVYMDIKIGNKPAGRLRFLLRADVVPMTAENFRCLCTHEKGFGFKGSSFHRVIPQFMCQGGDFTNHNGTGGKSIYGRKFDDENFVLKHTGPGQLSMANSGTNTNGSQFFITCDKTDWLDGKHVVFGELMEGMDVVRAMEAQGTKDGKPKQKVIISDCGE 296          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppifb (peptidyl-prolyl cis-trans isomerase A-like [Source:NCBI gene;Acc:103040813])

HSP 1 Score: 181.8 bits (460), Expect = 1.639e-55
Identity = 95/132 (71.97%), Postives = 108/132 (81.82%), Query Frame = 3
Query:  201 VENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            VENFR LCTGE G+GYKGS FHR+IP FM QGGDFT  NGTGGKSIYG +F DENFK +HT PG+LSMANAGPNTNGSQFFI TV T WLDG+HVVFG V +G+D+VKQ+E  GS SGK +  I I +CG+L
Sbjct:   89 VENFRALCTGEHGYGYKGSIFHRVIPQFMCQGGDFTHHNGTGGKSIYGPRFHDENFKLRHTGPGILSMANAGPNTNGSQFFICTVKTEWLDGRHVVFGSVKDGLDVVKQVEAFGSRSGKTSKRITITDCGEL 220          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010135.1 (pep scaffold:Pmarinus_7.0:GL476417:32947:40880:1 gene:ENSPMAG00000009125.1 transcript:ENSPMAT00000010135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 1.851e-65
Identity = 107/162 (66.05%), Postives = 127/162 (78.40%), Query Frame = 3
Query:  111 VVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            V Q FFD+  D   +GR+V  L    VPKT ENFR LCTGEKGFGYKGS FHR+IP+FM QGGDFTKGNGTGGKSIYG KF DENF  KH  PG+LSMANAGPNTNGSQFFI T  T WLD KHVVFG+V+ G+D++K++E  G+ SGK + +I++ +CG+L
Sbjct:    3 VKQVFFDLTADGASVGRVVMELRGDVVPKTAENFRALCTGEKGFGYKGSTFHRVIPDFMCQGGDFTKGNGTGGKSIYGNKFEDENFTLKHEGPGILSMANAGPNTNGSQFFICTAKTAWLDNKHVVFGKVISGLDVIKKVESYGAASGKTSKKIVVADCGEL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppifb (peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-GENE-051030-126])

HSP 1 Score: 196.438 bits (498), Expect = 1.687e-62
Identity = 105/158 (66.46%), Postives = 118/158 (74.68%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            F D++ D   LGRI   L    VPKT ENFR LCTGE GFGYKGS FHRIIPNFM QGGDFT+ NGTGG SIYG  F DENF  KHT PG+LSMANAG NTNGSQFFI T +TNWLDGKHVVFG V  GMD+VK++EK+GS  G     + I +CG++
Sbjct:   17 FMDVSADSGPLGRITLKLRADVVPKTAENFRALCTGEHGFGYKGSIFHRIIPNFMCQGGDFTRNNGTGGVSIYGTTFRDENFILKHTGPGILSMANAGKNTNGSQFFICTELTNWLDGKHVVFGHVTSGMDIVKKMEKLGSSKGDVKGRVEITDCGEV 174          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004654.1 (pep scaffold:Pmarinus_7.0:GL489343:42315:43690:-1 gene:ENSPMAG00000004243.1 transcript:ENSPMAT00000004654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.229 bits (404), Expect = 7.251e-48
Identity = 86/158 (54.43%), Postives = 111/158 (70.25%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            F D+A D + LGRI   L+   VP+T ENFR LCT E GFGY+ S  HR+IP FM QGGDFT  NGTGG+SIY + F DE+FK  H++ G+LSMAN+G NTN SQFFIT   T+ LD KHV FG V  GM +V+ +E++GS SG    +I++ + G++
Sbjct:   59 FLDVAADDEPLGRISIELFANVVPRTAENFRALCTHEHGFGYRNSTIHRVIPGFMCQGGDFTNHNGTGGRSIYEKPFEDESFKILHSRAGILSMANSGRNTNTSQFFITLRATSHLDHKHVAFGAVRSGMSIVRAMEELGSQSGNTTKKIVVTDSGEV 216          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppig (peptidylprolyl isomerase G (cyclophilin G) [Source:ZFIN;Acc:ZDB-GENE-040426-2822])

HSP 1 Score: 152.525 bits (384), Expect = 1.845e-41
Identity = 90/169 (53.25%), Postives = 118/169 (69.82%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFG--------YKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGK-PANEILIENCGQL 596
            + FFDIA+++   GRIVF L+    PKT ENFR LCTGE+G G        ++ + FHRI+ NFM+QGGDF++GNG GG+SIYG  F DENF+ KH +  LLSMAN G +TNGSQFFITT     LDG+HVVFG V+ G DL+K+IE   +D+   P  +I + +CG++
Sbjct:    8 RCFFDIAINRIPAGRIVFELFFDVCPKTCENFRCLCTGERGIGKITRKPLHFRSTSFHRIVKNFMVQGGDFSEGNGRGGESIYGGFFEDENFQLKHDQEFLLSMANRGKDTNGSQFFITTKPAPHLDGEHVVFGRVLSGQDLLKEIENQKTDANSLPYADIRVVHCGEV 176          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppil1 (peptidylprolyl isomerase (cyclophilin)-like 1 [Source:ZFIN;Acc:ZDB-GENE-051009-1])

HSP 1 Score: 119.013 bits (297), Expect = 9.208e-33
Identity = 73/149 (48.99%), Postives = 91/149 (61.07%), Query Frame = 3
Query:  144 KKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADE-NFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQI---EKMGSDSGKPANEILI 578
            +  +G +V  LY    P+T  NF  L    +G+ Y G++FHRII  FM+QGGD T   G GG SIYG+ F DE +   KHT  G++SMAN+GPNTNGSQFFIT   T WLDGKH +F  V  GM  V +I   E +  D  +P  EI I
Sbjct:   17 ETTMGTVVLELYWMHAPRTCRNFAELA--RRGY-YNGTRFHRIIRGFMIQGGDPTGTAGRGGASIYGKHFEDEIHPDLKHTGAGIISMANSGPNTNGSQFFITLGPTQWLDGKHSIFARVARGMSTVNRIGLVETVAQD--RPVEEISI 160          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR3 (Mitochondrial peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; involved in protein refolding after import into mitochondria [Source:SGD;Acc:S000004543])

HSP 1 Score: 214.927 bits (546), Expect = 8.240e-70
Identity = 115/160 (71.88%), Postives = 126/160 (78.75%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + FFD AV+  K+GRI F LYD  VPKT ENFR LCTGEKG+GYKG  FHRIIP+FM+QGGD    NG GGKSIYG KFADENF  KH K GLLSMANAGPNTNGSQFFITTV   WLDGKHVVFGEV +GMD+VK IE  G+ SGKP  EI+IE  G+L
Sbjct:   23 KVFFDPAVNGTKIGRIEFELYDNVVPKTAENFRALCTGEKGWGYKGVPFHRIIPDFMIQGGDTDLTNGFGGKSIYGSKFADENFVKKHDKAGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDIVKAIESYGTASGKPRAEIVIEEAGEL 182          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR1 (Cytoplasmic peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds the drug cyclosporin A; N-terminally propionylated in vivo; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002562])

HSP 1 Score: 209.92 bits (533), Expect = 3.521e-68
Identity = 111/160 (69.38%), Postives = 128/160 (80.00%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            Q +FD+  D + +GR+VF LY+  VPKT ENFR LCTGEKGFGY GS FHR+IP+FMLQGGDFT GNGTGGKSIYG KF DENFK  H +PGLLSMANAGPNTNGSQFFITTV   WLDGKHVVFGEVV+G D+VK++E +GS SG     I++   G+L
Sbjct:    3 QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSPSGATKARIVVAKSGEL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR6 (Peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; plays a role in determining prion variants; binds to Hsp82p and contributes to chaperone activity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004206])

HSP 1 Score: 165.622 bits (418), Expect = 2.047e-48
Identity = 100/171 (58.48%), Postives = 116/171 (67.84%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFG---------YKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSD--SGKPANEILIENCGQL 596
            +TFFDI++  K  GRIVF LY+  VPKT ENF  LC G  G           YKGS FHR+I +FM Q GDFT  NGTGG+SIY EKF DENF  KH KP LLSMANAGPNTNGSQ FIT V T  LDGKHVVFGEV++G  +V+ IE    D  + KP  ++ I++CG L
Sbjct:    5 KTFFDISIGGKPQGRIVFELYNDIVPKTAENFLKLCEGNAGMAKTKPDVPLSYKGSIFHRVIKDFMCQFGDFTNFNGTGGESIYDEKFEDENFTVKHDKPFLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIQGKRIVRLIENQQCDQENNKPLRDVKIDDCGVL 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR5 (Peptidyl-prolyl cis-trans isomerase (cyclophilin) of the ER; catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; transcriptionally induced in response to unfolded proteins in the ER; CPR5 has a paralog, CPR2, that arose from the whole genome duplication [Source:SGD;Acc:S000002712])

HSP 1 Score: 159.458 bits (402), Expect = 1.096e-47
Identity = 93/162 (57.41%), Postives = 114/162 (70.37%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENF-RVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDS-GKPANEILIENCGQL 596
            + +FDI    K++GRIV  LY    P+TVENF ++  + +   GY  S FHR+IPNFM+QGGDFT  +G GGKSI+G  F DENF  KH KPG LSMAN G NTNGSQFFITTV   WLDGKHVVFGEV++GMD+V  IE + +DS   P  E++I   G+L
Sbjct:   35 KVYFDINHGDKQIGRIVMGLYGLTTPQTVENFYQLTISRDPKMGYLNSIFHRVIPNFMIQGGDFTHRSGIGGKSIFGNTFKDENFDVKHDKPGRLSMANRGKNTNGSQFFITTVPCPWLDGKHVVFGEVLDGMDVVHYIENVKTDSRNMPVKEVIIVESGEL 196          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR2 (Peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; potential role in the secretory pathway; seamless-GFP and mCherry fusion proteins localize to the vacuole, while SWAT-GFP fusion localizes to both the endoplasmic reticulum and vacuole; suppresses toxicity of slow-folding human Z-type alpha1-antitrypsin variant associated with liver cirrhosis and emphysema [Source:SGD;Acc:S000001099])

HSP 1 Score: 148.673 bits (374), Expect = 7.448e-44
Identity = 91/162 (56.17%), Postives = 111/162 (68.52%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGF-GYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTV-VTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSG-KPANEILIENCGQ 593
            + FFDI   ++K+GRIV  LY    PKT +NF  L T      G+ GS FHR+IPNFM+QGGDFT G G GGKSIYG+ F DENF  KH + G LSMAN G +TNGSQFFITT    +WLDGKHVVFG+VV+GMD+V  I+ +  D+  KP   + I  CG+
Sbjct:   37 KVFFDIEHGEEKVGRIVIGLYGKVCPKTAKNFYKLSTTTNSKKGFIGSTFHRVIPNFMVQGGDFTDGTGVGGKSIYGDTFPDENFTLKHDRKGRLSMANRGKDTNGSQFFITTTEEASWLDGKHVVFGQVVDGMDVVNYIQHVSRDANDKPLEAVKIAKCGE 198          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO31539 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SXN2])

HSP 1 Score: 211.075 bits (536), Expect = 3.821e-68
Identity = 112/163 (68.71%), Postives = 130/163 (79.75%), Query Frame = 3
Query:  108 MVVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            M   T+FDI +     GRIV  L D  VPKT ENFR LCTGEKGFGYKGS FHR+IP FM QGGDFT+G+GTGGKSIYG KFADENF  KHT PG+LSMANAGP TNGSQFF+ T  T+WLDGKHVVFG V +GMD+VK+IEK+GSDSGK + +++I + G+L
Sbjct:    1 MPKTTYFDIEIGGAPAGRIVMELRDDVVPKTAENFRALCTGEKGFGYKGSSFHRVIPGFMCQGGDFTRGDGTGGKSIYGAKFADENFNLKHTGPGILSMANAGPGTNGSQFFLCTAKTSWLDGKHVVFGSVKDGMDVVKKIEKVGSDSGKTSKKVVIADSGEL 163          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO38777 (Peptidyl-prolyl cis-trans isomerase E [Source:UniProtKB/TrEMBL;Acc:A7SBW4])

HSP 1 Score: 200.675 bits (509), Expect = 2.746e-62
Identity = 106/160 (66.25%), Postives = 127/160 (79.38%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + FFDI + ++  GRIV  L    VP T ENFR LCT EKGFGYKGS FHRIIP FM QGGDFTK NGTGGKSIYG KF DENF  KHT  G+LSMAN+GPNTNGSQFF+TT  T+WLDGKHVVFG V+EG D+V+++E +GS SGK + +++I++CG+L
Sbjct:  138 RVFFDITIGERSAGRIVMELRSDVVPMTAENFRCLCTHEKGFGYKGSSFHRIIPQFMCQGGDFTKHNGTGGKSIYGAKFEDENFVLKHTGAGVLSMANSGPNTNGSQFFLTTEKTDWLDGKHVVFGNVIEGFDVVRKMEAVGSQSGKASKKVVIDDCGEL 297          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO41747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3C4])

HSP 1 Score: 194.126 bits (492), Expect = 5.989e-59
Identity = 102/168 (60.71%), Postives = 128/168 (76.19%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFG--------YKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + FFD+ +  +K+GR++F L+   VPKT ENFR LCTGEKG G        YKG  FHRII +FM+QGGDF+  NGTGG+SIYGEKFADE+F +KH KPGLLSMAN+GPNTNGSQFFITTV T  LDG+HVVFG+V++GMD+V+++E    D   P +  +IE CG+L
Sbjct:   17 RCFFDVTIGGEKVGRVLFELFADKVPKTAENFRALCTGEKGIGPSTGKPLHYKGCPFHRIIKDFMVQGGDFSNKNGTGGESIYGEKFADEDFTYKHDKPGLLSMANSGPNTNGSQFFITTVPTPHLDGRHVVFGKVLKGMDVVRELEATPVDDSSPKSPCIIEECGEL 184          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO34629 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SNV4])

HSP 1 Score: 185.267 bits (469), Expect = 1.810e-57
Identity = 95/160 (59.38%), Postives = 125/160 (78.12%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + +FD+++   K+GRIVF ++   VPKT +NF++L TGEKG+GYKGS FHRII +FM+QGGDF   +GTGG+SIYG++F DENFK KH  PG LSMANAG +TNGSQFFITTV T+WLDGKHVVFG+V+EGMD+V+++E +      P    +I++ G L
Sbjct:   37 KIYFDVSIGGDKIGRIVFGIFGKTVPKTAKNFKLLATGEKGYGYKGSIFHRIIKDFMIQGGDFINKDGTGGRSIYGDRFDDENFKLKHYGPGWLSMANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKLENVNVKGSTPVKTCMIDDSGTL 196          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO34613 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SNV5])

HSP 1 Score: 180.644 bits (457), Expect = 1.087e-55
Identity = 102/161 (63.35%), Postives = 125/161 (77.64%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSG-KPANEILIENCGQL 596
            + FFDI +  +K GRI   L+   VPKT ENF  L TGEKGFGYK S FHR+I +FM+QGGDFTKG+GTGGKSIYG+KFADENFK +H   G LSMANAG +TNGSQFFITTV T WLDG+HVVFG+V++GMD+V++IEK  +D G +P  E+ + + G L
Sbjct:   28 KVFFDITIGGEKAGRIEIGLFGKAVPKTAENFFQLATGEKGFGYKNSIFHRVIQDFMIQGGDFTKGDGTGGKSIYGQKFADENFKLQHYGAGWLSMANAGKDTNGSQFFITTVKTPWLDGRHVVFGKVLKGMDVVRKIEKSKTDHGDRPVKEVKVADSGSL 188          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppiaa (peptidyl-prolyl cis-trans isomerase [Source:NCBI gene;Acc:101156984])

HSP 1 Score: 217.238 bits (552), Expect = 4.551e-70
Identity = 116/160 (72.50%), Postives = 127/160 (79.38%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + FFDIAVD    GRIV  L    VPKT ENFR LCTGEKGFGYKGS FHR+IP FM QGGDFT  NGTGGKSIYG KFADENF   HT PG+LSMANAGPNTNGSQFFI T  T WLDGKHVVFG+VVEGMD+V+++E +GS SGK + +I I NCGQL
Sbjct:    5 RVFFDIAVDGSPAGRIVMELRADVVPKTAENFRALCTGEKGFGYKGSGFHRVIPRFMCQGGDFTNHNGTGGKSIYGNKFADENFTLTHTGPGILSMANAGPNTNGSQFFICTEKTAWLDGKHVVFGQVVEGMDVVRKMESLGSQSGKTSAKITIANCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ENSORLT00000001785.2 (peptidyl-prolyl cis-trans isomerase [Source:NCBI gene;Acc:101163424])

HSP 1 Score: 203.371 bits (516), Expect = 1.126e-64
Identity = 107/160 (66.88%), Postives = 124/160 (77.50%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + FFDI++D    GRIV  L    VPKT ENFR LCTGEKGFG+KGS FHRIIP FM QGGDFT  +GTGGKSIYGE F DENF+ KH   G LSMANAGPNTNGSQFFI T  T+WL+GKHVVFG V+EG+D+VK +EK GS SG P  +++I +CG+L
Sbjct:    5 KVFFDISIDGANAGRIVMELRADAVPKTAENFRALCTGEKGFGFKGSSFHRIIPKFMCQGGDFTNHDGTGGKSIYGETFPDENFQLKHKGMGTLSMANAGPNTNGSQFFICTASTDWLNGKHVVFGSVLEGIDVVKAMEKHGSKSGTPKAKVIIADCGEL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: PPIF (peptidylprolyl isomerase F [Source:NCBI gene;Acc:101156535])

HSP 1 Score: 199.519 bits (506), Expect = 8.054e-63
Identity = 106/158 (67.09%), Postives = 121/158 (76.58%), Query Frame = 3
Query:  123 FFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            +FDIA   + LGR+ F L    VPKT ENFR LCTGE GFGYKGS FHR+IP FM QGGDFT  NGTGGKSIYG KF DENF  KHT PG+LSMANAGPNTNGSQFFI T  T WLDG+HVVFG V +GM +VK++E  GS SG+ + +I I +CG+L
Sbjct:   35 YFDIAAGSEPLGRVTFELSADVVPKTAENFRALCTGEHGFGYKGSIFHRVIPKFMCQGGDFTNHNGTGGKSIYGLKFPDENFVLKHTGPGILSMANAGPNTNGSQFFICTSKTEWLDGRHVVFGRVKDGMSVVKKVESFGSQSGRTSQKITITDCGEL 192          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ENSORLT00000030005.1 (peptidylprolyl isomerase E [Source:NCBI gene;Acc:101158811])

HSP 1 Score: 197.593 bits (501), Expect = 1.509e-60
Identity = 105/159 (66.04%), Postives = 120/159 (75.47%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQ 593
            Q + DI +  K  GR+ F L    VP T ENFR LCT EKGFGYKGS FHRIIP FM QGGDFT  NGTGGKSIYG KF DENF  KHT PG LSMAN+GPNTNGSQFFIT   T+WLDGKHVVFGE+VEGMD+V+ +E  G+  GKP  +++I +CG+
Sbjct:  142 QVYMDIKIGNKAAGRLRFLLRADIVPMTAENFRCLCTHEKGFGYKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGRKFDDENFVLKHTAPGQLSMANSGPNTNGSQFFITNDKTDWLDGKHVVFGELVEGMDVVRAMEAQGTKDGKPKQKVIISDCGE 300          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppib (peptidylprolyl isomerase B [Source:NCBI gene;Acc:101157771])

HSP 1 Score: 187.193 bits (474), Expect = 9.376e-58
Identity = 102/165 (61.82%), Postives = 129/165 (78.18%), Query Frame = 3
Query:  105 NMVVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDS-GKPANEILIENCGQL 596
             +  + FFDI +  + +GR+V  L+   VPKTV+NF  L TGEKGFGYKGSKFHR+I  FM+QGGDFT+G+GTGGKSIYG++F DENFK KH   G LSMANAG +TNGSQFFITTV T WLDGKHVVFG+V+EGMD+V++IE   +D   KP  +++I +CG++
Sbjct:   41 KVTAKVFFDIRIGDEDVGRVVIGLFGKTVPKTVDNFVALATGEKGFGYKGSKFHRVIKQFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGAGWLSMANAGKDTNGSQFFITTVQTPWLDGKHVVFGKVLEGMDVVQKIESTKTDGRDKPLKDVIIHDCGKI 205          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000052204.1 (SMESG000052204.1)

HSP 1 Score: 252.677 bits (644), Expect = 2.985e-84
Identity = 132/162 (81.48%), Postives = 147/162 (90.74%), Query Frame = 3
Query:  111 VVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            +VQT+FDI+VD  KLGRIVF LY  DVPKTVENFR LCTGEKGFG+KGSKFHR+IPNFMLQGGDFT+GNGTGGKSIYGEKF DENFK KHTKPGLLSMANAGPNTNGSQFFITTV+TNWLDGKHVVFGEV EGMD+V+++EK+GS SGK +  + I +CGQL
Sbjct:    1 MVQTYFDISVDGAKLGRIVFNLYVKDVPKTVENFRALCTGEKGFGFKGSKFHRVIPNFMLQGGDFTRGNGTGGKSIYGEKFEDENFKIKHTKPGLLSMANAGPNTNGSQFFITTVITNWLDGKHVVFGEVAEGMDIVQKVEKLGSASGKTSKTVSITDCGQL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000006567.1 (SMESG000006567.1)

HSP 1 Score: 243.047 bits (619), Expect = 2.567e-80
Identity = 127/165 (76.97%), Postives = 148/165 (89.70%), Query Frame = 3
Query:  102 LNMVVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            ++ + +TFFDI+ +   +GRIVF LYD D+PKT +NFR LCTGEKGFGYKGSKFHRII +FMLQGGDFT+GNGTGGKSIYGEKF DE+FK+KHTKPGLLSMANAGPNTNGSQFFITTVVT WLDGKHVVFGEV EGM++VK IEK+GSDSGKP+  ++I++CGQL
Sbjct:    5 ISKMTRTFFDISANGVSMGRIVFKLYD-DIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQGGDFTRGNGTGGKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVVIDDCGQL 168          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000006567.1 (SMESG000006567.1)

HSP 1 Score: 241.891 bits (616), Expect = 5.170e-80
Identity = 127/162 (78.40%), Postives = 146/162 (90.12%), Query Frame = 3
Query:  111 VVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            + +TFFDI+ +   +GRIVF LYD D+PKT +NFR LCTGEKGFGYKGSKFHRII +FMLQGGDFT+GNGTGGKSIYGEKF DE+FK+KHTKPGLLSMANAGPNTNGSQFFITTVVT WLDGKHVVFGEV EGM++VK IEK+GSDSGKP+  ++I++CGQL
Sbjct:    1 MTRTFFDISANGVSMGRIVFKLYD-DIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQGGDFTRGNGTGGKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVVIDDCGQL 161          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000006596.1 (SMESG000006596.1)

HSP 1 Score: 206.453 bits (524), Expect = 2.647e-66
Identity = 104/162 (64.20%), Postives = 121/162 (74.69%), Query Frame = 3
Query:  111 VVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            +VQT+FDI+VD  KLGRIVF LY  DVPKTVENFR LCTGEKGFG+KGSKFHR+I     +             +I  E+        KHTKPGLLSMANAGPNTNGSQFFITTV+TNWLDGKHVVFGEV EGMD+V+++EK+GS SGK +  + I +CGQL
Sbjct:    1 MVQTYFDISVDGAKLGRIVFNLYVKDVPKTVENFRALCTGEKGFGFKGSKFHRVIQILCFKE------------AILLEEMEPVE---KHTKPGLLSMANAGPNTNGSQFFITTVITNWLDGKHVVFGEVAEGMDIVQKVEKLGSASGKTSKTVSITDCGQL 147          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000052090.1 (SMESG000052090.1)

HSP 1 Score: 183.726 bits (465), Expect = 2.685e-55
Identity = 101/160 (63.12%), Postives = 122/160 (76.25%), Query Frame = 3
Query:  117 QTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGSKFHRIIPNFMLQXXXXXXXXXXXXXSIYGEKFADENFKFKHTKPGLLSMANAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGKPANEILIENCGQL 596
            Q +FDI++  +++GRIV  L    VP+T ENF  L T  KGFG+KGSKFHRIIP+FM QGGDFT G+GTGGKSIYG KF DENF  +H   G+LSMAN GPNTNGSQFFI    T WLDGKHVVFG VVEGM++ K++E +GS SG P + ++I +CGQL
Sbjct:  148 QVYFDISIRNQQIGRIVIQLRKDVVPRTCENFISLSTHAKGFGFKGSKFHRIIPDFMCQGGDFTMGDGTGGKSIYGMKFDDENFILRHDAAGVLSMANTGPNTNGSQFFICLNKTPWLDGKHVVFGHVVEGMNVCKKMEAVGSKSGTPNDPVVITDCGQL 307          
The following BLAST results are available for this feature:
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPIA1.280e-6671.52peptidylprolyl isomerase A [Source:HGNC Symbol;Acc... [more]
PPIF3.016e-6567.72peptidylprolyl isomerase F [Source:HGNC Symbol;Acc... [more]
PPIE1.024e-6066.04peptidylprolyl isomerase E [Source:HGNC Symbol;Acc... [more]
PPIE3.465e-6066.04peptidylprolyl isomerase E [Source:HGNC Symbol;Acc... [more]
PPIB1.210e-5860.61peptidylprolyl isomerase B [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyn-36.595e-6869.46Peptidyl-prolyl cis-trans isomerase 3 [Source:Uni... [more]
cyn-71.333e-6769.46Peptidyl-prolyl cis-trans isomerase 7 [Source:Uni... [more]
cyn-71.333e-6769.46Peptidyl-prolyl cis-trans isomerase 7 [Source:Uni... [more]
cyn-12.995e-6562.50Peptidyl-prolyl cis-trans isomerase 1 [Source:Uni... [more]
cyn-21.440e-5966.07Peptidyl-prolyl cis-trans isomerase 2 [Source:Uni... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp14.740e-6667.88gene:FBgn0004432 transcript:FBtr0074238[more]
CG77681.820e-6567.50gene:FBgn0036415 transcript:FBtr0075736[more]
CG77681.820e-6567.50gene:FBgn0036415 transcript:FBtr0075737[more]
cyp333.295e-5561.88gene:FBgn0028382 transcript:FBtr0086945[more]
CG28528.575e-5358.68gene:FBgn0034753 transcript:FBtr0071933[more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppiab4.892e-6770.63peptidylprolyl isomerase Ab (cyclophilin A) [Sourc... [more]
ppifb1.236e-6568.99peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-G... [more]
ppiaa1.065e-6465.63peptidylprolyl isomerase Aa (cyclophilin A) [Sourc... [more]
ppifa3.475e-5965.82peptidylprolyl isomerase Fa [Source:ZFIN;Acc:ZDB-G... [more]
ppie5.948e-5864.15peptidylprolyl isomerase E (cyclophilin E) [Source... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppia1.228e-6971.25peptidylprolyl isomerase A (cyclophilin A) [Source... [more]
neurl47.101e-6365.19neuralized E3 ubiquitin protein ligase 4 [Source:X... [more]
PPIE4.244e-6267.92peptidylprolyl isomerase E (cyclophilin E) [Source... [more]
PPIE1.260e-6167.92peptidylprolyl isomerase E (cyclophilin E) [Source... [more]
PPIE2.063e-6167.92peptidylprolyl isomerase E (cyclophilin E) [Source... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppif1.630e-6667.72peptidylprolyl isomerase F (cyclophilin F) [Source... [more]
Ppia2.862e-6669.62peptidylprolyl isomerase A [Source:MGI Symbol;Acc:... [more]
Ppie1.347e-6066.04peptidylprolyl isomerase E (cyclophilin E) [Source... [more]
Ppia3.058e-5971.63peptidylprolyl isomerase A [Source:MGI Symbol;Acc:... [more]
Ppib2.238e-5861.59peptidylprolyl isomerase B [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P14088|PPIA_ECHGR1.627e-7174.85Peptidyl-prolyl cis-trans isomerase OS=Echinococcu... [more]
sp|P18253|CYPH_SCHPO3.549e-7073.42Peptidyl-prolyl cis-trans isomerase OS=Schizosacch... [more]
sp|Q9TW32|PPIB_DICDI8.940e-7071.26Peptidyl-prolyl cis-trans isomerase B OS=Dictyoste... [more]
sp|P91791|PPIA_HEMPU6.866e-6970.63Peptidyl-prolyl cis-trans isomerase OS=Hemicentrot... [more]
sp|P22011|PPIA_CANAL9.919e-6972.78Peptidyl-prolyl cis-trans isomerase OS=Candida alb... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A1D7V87.511e-7579.14Peptidyl-prolyl cis-trans isomerase OS=Neosartorya... [more]
A0A2C6A2A91.211e-7476.88Peptidyl-prolyl cis-trans isomerase OS=Cordyceps s... [more]
A0A2I1C2E52.739e-7478.53Peptidyl-prolyl cis-trans isomerase OS=Aspergillus... [more]
A1CJM37.285e-7477.30Peptidyl-prolyl cis-trans isomerase OS=Aspergillus... [more]
A0A0B4HTC69.671e-7478.13Peptidyl-prolyl cis-trans isomerase (Fragment) OS=... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppifb4.042e-6668.35peptidyl-prolyl cis-trans isomerase A-like [Source... [more]
ppiab2.375e-6269.38peptidylprolyl isomerase Ab (cyclophilin A) [Sourc... [more]
ppifa5.592e-6066.46peptidyl-prolyl cis-trans isomerase F, mitochondri... [more]
ppie1.354e-5763.52peptidylprolyl isomerase E (cyclophilin E) [Source... [more]
ppifb1.639e-5571.97peptidyl-prolyl cis-trans isomerase A-like [Source... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010135.11.851e-6566.05pep scaffold:Pmarinus_7.0:GL476417:32947:40880:1 g... [more]
ppifb1.687e-6266.46peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000004654.17.251e-4854.43pep scaffold:Pmarinus_7.0:GL489343:42315:43690:-1 ... [more]
ppig1.845e-4153.25peptidylprolyl isomerase G (cyclophilin G) [Source... [more]
ppil19.208e-3348.99peptidylprolyl isomerase (cyclophilin)-like 1 [Sou... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CPR38.240e-7071.88Mitochondrial peptidyl-prolyl cis-trans isomerase ... [more]
CPR13.521e-6869.38Cytoplasmic peptidyl-prolyl cis-trans isomerase (c... [more]
CPR62.047e-4858.48Peptidyl-prolyl cis-trans isomerase (cyclophilin);... [more]
CPR51.096e-4757.41Peptidyl-prolyl cis-trans isomerase (cyclophilin) ... [more]
CPR27.448e-4456.17Peptidyl-prolyl cis-trans isomerase (cyclophilin);... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO315393.821e-6868.71Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO387772.746e-6266.25Peptidyl-prolyl cis-trans isomerase E [Source:Uni... [more]
EDO417475.989e-5960.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346291.810e-5759.38Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO346131.087e-5563.35Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppiaa4.551e-7072.50peptidyl-prolyl cis-trans isomerase [Source:NCBI g... [more]
ENSORLT00000001785.21.126e-6466.88peptidyl-prolyl cis-trans isomerase [Source:NCBI g... [more]
PPIF8.054e-6367.09peptidylprolyl isomerase F [Source:NCBI gene;Acc:1... [more]
ENSORLT00000030005.11.509e-6066.04peptidylprolyl isomerase E [Source:NCBI gene;Acc:1... [more]
ppib9.376e-5861.82peptidylprolyl isomerase B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052204.12.985e-8481.48SMESG000052204.1[more]
SMESG000006567.12.567e-8076.97SMESG000006567.1[more]
SMESG000006567.15.170e-8078.40SMESG000006567.1[more]
SMESG000006596.12.647e-6664.20SMESG000006596.1[more]
SMESG000052090.12.685e-5563.13SMESG000052090.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035360 ID=SMED30035360|Name=Peptidyl-prolyl cis-trans isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=1068bp
TTATATAAGTTTCTTTACTAATTTTGAAAGCTGAATTTAATATTTTATTT
TGTTTTAAATAAAGAACCTTCTTGTTTTTCTGACAAAGCAGTATTTATTT
CCTCAACATGGTGGTACAAACTTTTTTTGACATTGCTGTTGATAAGAAAA
AGCTTGGTCGAATTGTTTTTACTCTTTATGATGCAGATGTTCCAAAAACC
GTTGAAAATTTTCGAGTTCTTTGTACAGGAGAAAAAGGGTTCGGATACAA
AGGAAGCAAATTCCATAGAATAATTCCAAATTTTATGCTTCAAGGAGGTG
ATTTCACGAAAGGTAATGGAACAGGGGGGAAGAGTATTTACGGTGAAAAG
TTTGCTGATGAAAACTTCAAATTCAAGCATACTAAGCCTGGACTTTTGTC
TATGGCTAATGCAGGACCAAATACGAATGGCTCTCAATTTTTTATTACTA
CAGTAGTAACTAATTGGTTGGATGGAAAACACGTTGTATTTGGTGAAGTA
GTAGAAGGAATGGATTTGGTAAAACAAATAGAAAAAATGGGAAGTGATAG
TGGGAAACCGGCAAATGAAATACTTATCGAAAACTGTGGGCAATTGTAAA
TATCAATAGTATTTTATGAACAGTGAAATCGTTGTGAAAGTATTTTCCAG
TTGGATAGTCGATAAGTAAATGTGCTGAATTTTGGTTTATTTAATTGTAT
CGTTTTCAAATTTGTATTTAACTTTTTTCTATTTGACTAATTTTAGTTCA
AAGTTGGTTAATGTTAGTTAACGATTTTGTAGTATATTAAATATTCATCA
AAATTTGTCATTTGAACATAAAGTTTTCAGTTATGTTATTTTGGAAATTT
CGTTTCTCTACGTATGGTTAGCGGTTGTTTGGTTATTTTTTAATTGCCGG
CTACTTGATTTGATAGTTGGTGGTTTTGGATTTCTTGTTATTTATTTGCG
TTTAAGTCGTTTTGATTATTTTCATTAGTTTACTTAATTTGAGATTCTTT
AAACTTCTTGATATTTAATTTTCTCGTTATTAGGATTTATAAATTTTCAA
TTAGTTGAAGGGTTTTTG
back to top

protein sequence of SMED30035360-orf-1

>SMED30035360-orf-1 ID=SMED30035360-orf-1|Name=SMED30035360-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=164bp
MVVQTFFDIAVDKKKLGRIVFTLYDADVPKTVENFRVLCTGEKGFGYKGS
KFHRIIPNFMLQGGDFTKGNGTGGKSIYGEKFADENFKFKHTKPGLLSMA
NAGPNTNGSQFFITTVVTNWLDGKHVVFGEVVEGMDLVKQIEKMGSDSGK
PANEILIENCGQL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR002130Cyclophilin-type_PPIase_dom
IPR029000Cyclophilin-like_dom_sf
IPR024936Cyclophilin-type_PPIase
IPR020892Cyclophilin-type_PPIase_CS
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0000413protein peptidyl-prolyl isomerization
Vocabulary: molecular function
TermDefinition
GO:0003755peptidyl-prolyl cis-trans isomerase activity
GO:0016853isomerase activity