SMED30035359

Overview
NameSMED30035359
Smed IDSMED30035359
Length (bp)1476
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30035359 (SMED30035359) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30035359 (SMED30035359) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035359

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 33

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30035359SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SmedASXL_018089SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30035359SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035359SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000064992.1 SMESG000064086.1 SMESG000060260.1 SMESG000050492.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000026762.1 SMESG000025022.1 SMESG000021640.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000012464.1 SMESG000011816.1 SMESG000007021.1 SMESG000000031.1 SMESG000070487.1 SMESG000068881.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000008519.1 SMESG000005066.1 Contig40604uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000064992.1 SMESG000064086.1 SMESG000060260.1 SMESG000050492.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000026762.1 SMESG000025022.1 SMESG000021640.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000012464.1 SMESG000011816.1 SMESG000007021.1 SMESG000000031.1 SMESG000070487.1 SMESG000068881.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000008519.1 SMESG000005066.1 Contig40604newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035359SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000041949.1 SMESG000041948.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig17437uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035359SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000041949.1 SMESG000041948.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig17437newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000080770.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065333.1 SMESG000060260.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000054970.1 SMESG000052813.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000043769.1 SMESG000043147.1 SMESG000041246.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000033763.1 SMESG000031415.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019663.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010897.1 SMESG000010825.1 SMESG000009005.1 SMESG000007021.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 SMESG000025201.1 Contig34191uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000080770.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065333.1 SMESG000060260.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000054970.1 SMESG000052813.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000043769.1 SMESG000043147.1 SMESG000041246.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000033763.1 SMESG000031415.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019663.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010897.1 SMESG000010825.1 SMESG000009005.1 SMESG000007021.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 SMESG000025201.1 Contig34191newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30035359SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SMED30032823smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30035359SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SMED30032823smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065669.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig12382uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035359SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065669.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig12382newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035359SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035359SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035359SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060389.1 SMESG000060365.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig17772newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035359SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060389.1 SMESG000060365.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig17772uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30035359SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30035359SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30035359SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30035359SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30035359 vs. Planmine SMEST
Match: SMESG000046313.1 (SMESG000046313.1)

HSP 1 Score: 214.927 bits (546), Expect = 2.520e-66
Identity = 105/144 (72.92%), Postives = 127/144 (88.19%), Query Frame = 1
Query: 1018 RRPNDRRDQIELPSIAIKRKPGRNPAREARQRAEYTAXXXXXXXXXYHKKAILARQRLAQINRDIASGIIPSTDGYPPDYGVSFELDDPILQQMAAPTKLILPEKLIQPALRNRLGPRQQDEHAYASRHPQWAFSSRVRRNANS 1449
            RRP DR D++ELPSIAIKR+PGRNPARE  QRAEYT+MKMEEME+KYH+KA+LARQRLAQINRDIASG+IPSTD +PP YGVSFELDDP L QM APTKL++PE+LIQP LRNRLG R+  +H YASRHP+W F+++ R++ ++
Sbjct:  657 RRPKDREDEVELPSIAIKREPGRNPAREVHQRAEYTSMKMEEMERKYHRKAVLARQRLAQINRDIASGVIPSTDSFPPTYGVSFELDDPRLLQMTAPTKLVIPEELIQPGLRNRLGSRRTGDHTYASRHPKWTFANKNRKDTHT 800          

HSP 2 Score: 57.3806 bits (137), Expect = 2.520e-66
Identity = 24/36 (66.67%), Postives = 30/36 (83.33%), Query Frame = 3
Query:  885 RNPHGGWNEDYRSTLRISSNSAARYRQALWDQGYVV 992
            R+PHGGW +D + TL+IS+ SAARYRQALWD GY +
Sbjct:  612 RDPHGGWRDDSQITLQISNASAARYRQALWDNGYTL 647          
BLAST of SMED30035359 vs. Planmine SMEST
Match: SMESG000046313.1 (SMESG000046313.1)

HSP 1 Score: 214.157 bits (544), Expect = 4.008e-66
Identity = 105/144 (72.92%), Postives = 127/144 (88.19%), Query Frame = 1
Query: 1018 RRPNDRRDQIELPSIAIKRKPGRNPAREARQRAEYTAXXXXXXXXXYHKKAILARQRLAQINRDIASGIIPSTDGYPPDYGVSFELDDPILQQMAAPTKLILPEKLIQPALRNRLGPRQQDEHAYASRHPQWAFSSRVRRNANS 1449
            RRP DR D++ELPSIAIKR+PGRNPARE  QRAEYT+MKMEEME+KYH+KA+LARQRLAQINRDIASG+IPSTD +PP YGVSFELDDP L QM APTKL++PE+LIQP LRNRLG R+  +H YASRHP+W F+++ R++ ++
Sbjct:  713 RRPKDREDEVELPSIAIKREPGRNPAREVHQRAEYTSMKMEEMERKYHRKAVLARQRLAQINRDIASGVIPSTDSFPPTYGVSFELDDPRLLQMTAPTKLVIPEELIQPGLRNRLGSRRTGDHTYASRHPKWTFANKNRKDTHT 856          

HSP 2 Score: 57.3806 bits (137), Expect = 4.008e-66
Identity = 24/36 (66.67%), Postives = 30/36 (83.33%), Query Frame = 3
Query:  885 RNPHGGWNEDYRSTLRISSNSAARYRQALWDQGYVV 992
            R+PHGGW +D + TL+IS+ SAARYRQALWD GY +
Sbjct:  668 RDPHGGWRDDSQITLQISNASAARYRQALWDNGYTL 703          
BLAST of SMED30035359 vs. Planmine SMEST
Match: SMESG000046313.1 (SMESG000046313.1)

HSP 1 Score: 214.157 bits (544), Expect = 4.319e-66
Identity = 105/144 (72.92%), Postives = 127/144 (88.19%), Query Frame = 1
Query: 1018 RRPNDRRDQIELPSIAIKRKPGRNPAREARQRAEYTAXXXXXXXXXYHKKAILARQRLAQINRDIASGIIPSTDGYPPDYGVSFELDDPILQQMAAPTKLILPEKLIQPALRNRLGPRQQDEHAYASRHPQWAFSSRVRRNANS 1449
            RRP DR D++ELPSIAIKR+PGRNPARE  QRAEYT+MKMEEME+KYH+KA+LARQRLAQINRDIASG+IPSTD +PP YGVSFELDDP L QM APTKL++PE+LIQP LRNRLG R+  +H YASRHP+W F+++ R++ ++
Sbjct:  709 RRPKDREDEVELPSIAIKREPGRNPAREVHQRAEYTSMKMEEMERKYHRKAVLARQRLAQINRDIASGVIPSTDSFPPTYGVSFELDDPRLLQMTAPTKLVIPEELIQPGLRNRLGSRRTGDHTYASRHPKWTFANKNRKDTHT 852          

HSP 2 Score: 57.3806 bits (137), Expect = 4.319e-66
Identity = 24/36 (66.67%), Postives = 30/36 (83.33%), Query Frame = 3
Query:  885 RNPHGGWNEDYRSTLRISSNSAARYRQALWDQGYVV 992
            R+PHGGW +D + TL+IS+ SAARYRQALWD GY +
Sbjct:  664 RDPHGGWRDDSQITLQISNASAARYRQALWDNGYTL 699          
BLAST of SMED30035359 vs. Planmine SMEST
Match: SMESG000044971.1 (SMESG000044971.1)

HSP 1 Score: 209.534 bits (532), Expect = 1.218e-64
Identity = 106/153 (69.28%), Postives = 123/153 (80.39%), Query Frame = 1
Query: 1006 SQLARRPNDRRDQIELPSIAIKRKPGRNPAREARQRAEYTAXXXXXXXXXYHKKAILARQRLAQINRDIASGIIPSTDGYPPDYGVSFELDDPILQQMAAPTKLILPEKLIQPALRNRLGPRQQDEHAYASRHPQWAFSSRVRRNANSENKRG 1464
            S   RR   + ++IELPSIAIKR+PG NPAREARQRAEY AMKMEE+E+KYH+KA+LARQRLAQ+NRDIASG IPSTDG+PP+YGVSFELDDP L QM APTK+++PEKL+Q  LRNRLG RQ  +H YASRHPQW   +  R N  SE   G
Sbjct: 1171 SSWPRRSEYQAEEIELPSIAIKREPGHNPAREARQRAEYVAMKMEELERKYHRKAVLARQRLAQVNRDIASGAIPSTDGFPPEYGVSFELDDPRLMQMTAPTKMVIPEKLVQSTLRNRLGSRQTGDHTYASRHPQW---NPKRNNRRSERFNG 1320          

HSP 2 Score: 56.9954 bits (136), Expect = 1.218e-64
Identity = 22/36 (61.11%), Postives = 29/36 (80.56%), Query Frame = 3
Query:  885 RNPHGGWNEDYRSTLRISSNSAARYRQALWDQGYVV 992
            R+PHG W+++ R TL+I S SAARYRQ LWD GY++
Sbjct: 1130 RDPHGNWSDNSRVTLQIPSASAARYRQVLWDNGYLL 1165          

HSP 3 Score: 70.0922 bits (170), Expect = 5.714e-19
Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = -2
Query:   60 ILLMIKETVDKLIKNPKDPCCGKSECNLSDGCELS 164
            +LLMIKETVDKLIKN KDPCCGKSECNLSDGCELS
Sbjct:  281 LLLMIKETVDKLIKNSKDPCCGKSECNLSDGCELS 315          

HSP 4 Score: 43.1282 bits (100), Expect = 5.714e-19
Identity = 19/20 (95.00%), Postives = 20/20 (100.00%), Query Frame = -1
Query:    1 LILPYSEGFTNYKRKLGKLI 60
            L+LPYSEGFTNYKRKLGKLI
Sbjct:  334 LVLPYSEGFTNYKRKLGKLI 353          
BLAST of SMED30035359 vs. Planmine SMEST
Match: SMESG000056869.1 (SMESG000056869.1)

HSP 1 Score: 201.83 bits (512), Expect = 4.067e-62
Identity = 105/152 (69.08%), Postives = 127/152 (83.55%), Query Frame = 1
Query: 1009 QLARR-----PNDRRDQIELPSIAIKRKPGRNPAREARQRAEYTAXXXXXXXXXYHKKAILARQRLAQINRDIASGIIPSTDGYPPDYGVSFELDDPILQQMAAPTKLILPEKLIQPALRNRLGPRQQDEHAYASRHPQWAFSSRVRRNANS 1449
            +LARR       DR D++ELPSIAIKR+PGRNPARE RQ+AEYT MKMEEME+KYH+KA+LARQRLAQINRDIASG+IPSTD +PP Y VSFELDDP L QM APTKL++PE+LIQP LRNRLG R+  +H YAS HPQW F+++ R++ ++
Sbjct:   48 ELARRCWPRLSKDRGDEVELPSIAIKREPGRNPAREVRQQAEYTVMKMEEMERKYHRKAVLARQRLAQINRDIASGVIPSTDSFPPTYEVSFELDDPRLLQMTAPTKLVIPEELIQPVLRNRLGSRRTGDHTYASCHPQWTFANKNRKDTHT 199          
The following BLAST results are available for this feature:
BLAST of SMED30035359 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035359 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035359 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035359 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035359 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035359 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035359 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035359 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035359 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035359 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035359 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035359 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035359 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035359 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046313.12.520e-6672.92SMESG000046313.1[more]
SMESG000046313.14.008e-6672.92SMESG000046313.1[more]
SMESG000046313.14.319e-6672.92SMESG000046313.1[more]
SMESG000044971.11.218e-6469.28SMESG000044971.1[more]
SMESG000056869.14.067e-6269.08SMESG000056869.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035359 ID=SMED30035359|Name=SMED30035359|organism=Schmidtea mediterranea sexual|type=transcript|length=1476bp
TATCAGTTTACCCAACTTCCTCTTATAATTTGTAAAGCCTTCAGAGTACG
GCAATATTAACTCAATTCACACCCATCCGACAAATTACATTCAGACTTTC
CACAACATGGATCCTTAGGATTTTTAATCAATTTATCAACAGTTTCTTTT
ATCATCAACAATATCGTTAATAAAGACCCTTTCCAGGGTTATGATGATTT
GCGGATTTCATTGGCGGATTCCAGAAGCACAAAACTCGAAAACTAAATCT
TCACCAAATTTCTATAACCTTCGACAGCATTTCTAGTTTTTTTGAATTCA
ATACAATGTAATACCGTAAAAGAACTTTGCAAATTGACATGTTGACGCGA
ACAAAAATCACATAATAATGTGATAAAAATTATTGTTTTATTAAACACAG
AAGAGCGCGTATGTATAAACACAATGGTAAAAAGAAAGAGCCATACATGT
TTTTGACGAAATAGTTCATACTTGTTAAAATTTTGAATTTGAATTTTTCT
GTAGACATTTATGTTTATATTTATTTTATCCAATTTCTGTACAAATATAA
TGATAATCTGACTAAGCCTATTCTTATTCAAAATCACTCAATTCAATACA
TTTCACAATTCAAATTCTCTTGTTCAGCTCAATAACGAATGACTCATTTT
GAATTAATAAATTTCTGTCCGAAGGAAGTCCACCTCAAACAAATTTTTAT
TTTGGAAAACACTTGCAAATCTGAAAAGCAAAATCCAAATAATTATATTG
GAAGGTCAGATTTGGTAGTAGATAACTGTATGGAGCAAAAAAGTTAAAGA
TCGTTCCGGTCGTTGCAAACGTTAGCTAAGACACTACTTCAACCATTTAT
ATTCTGCTCCGATTGAAAAATGAAGCATGTTGGCAGAAATCCGCACGGAG
GATGGAACGAAGACTACCGATCGACATTGCGGATTTCCTCCAATTCAGCC
GCACGATACCGACAGGCATTGTGGGACCAAGGATATGTCGTTATACTTAT
GGAGAAGCCAGCTGGCCCGACGACCAAACGATCGCAGAGACCAGATTGAG
CTACCTAGCATTGCCATCAAGCGGAAACCGGGCAGGAACCCGGCACGGGA
AGCCCGTCAGCGAGCTGAGTATACTGCAATGAAAATGGAAGAAATGGAGA
AGAAGTACCACAAAAAGGCGATTCTGGCCAGGCAGCGATTGGCCCAAATA
AATCGGGACATCGCGAGTGGGATCATTCCCAGCACTGACGGATATCCTCC
GGATTATGGAGTCTCTTTTGAACTAGATGACCCAATACTCCAACAAATGG
CCGCTCCAACGAAGTTGATCCTGCCCGAGAAATTGATCCAACCAGCTCTT
CGTAATCGACTTGGGCCGAGGCAACAGGACGAGCATGCTTATGCCAGCCG
ACACCCACAATGGGCATTCTCCAGCCGCGTTCGCCGTAACGCCAATTCCG
AGAACAAAAGAGGATCTTAAACGGAT
back to top

protein sequence of SMED30035359-orf-1

>SMED30035359-orf-1 ID=SMED30035359-orf-1|Name=SMED30035359-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=198bp
MLAEIRTEDGTKTTDRHCGFPPIQPHDTDRHCGTKDMSLYLWRSQLARRP
NDRRDQIELPSIAIKRKPGRNPAREARQRAEYTAMKMEEMEKKYHKKAIL
ARQRLAQINRDIASGIIPSTDGYPPDYGVSFELDDPILQQMAAPTKLILP
EKLIQPALRNRLGPRQQDEHAYASRHPQWAFSSRVRRNANSENKRGS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell