follistatin

Overview
Namefollistatin (AFJ24723.1)
Smed IDSMED30035357
Length (bp)1887
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of follistatin (SMED30035357) t-SNE clustered cells

Violin plots show distribution of expression levels for follistatin (SMED30035357) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of follistatin (SMED30035357) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for follistatin (SMED30035357) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035357

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior poleSMED30035357SMESG000013298.1 follistatinsmed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior pole cellSMED30035357SMESG000013298.1 follistatinsmed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30035357SMESG000013298.1 SmedASXL_012581SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30035357SMESG000013298.1 dd_Smed_v4_9584_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035357SMESG000013298.1 dd_Smed_v4_9584_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30035357SMESG000013298.1 dd_Smed_v4_9584_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
muscle cellSMED30035357SMESG000013298.1 dd_Smed_v4_9584_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035357SMESG000013298.1 dd_Smed_v4_9584_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035357SMESG000013298.1 dd_Smed_v4_9584_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035357SMESG000013298.1 dd_Smed_v6_9584_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
anterior poleSMED30035357SMESG000013298.1 follistatinsmed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
muscle cellSMED30035357SMESG000013298.1 dd_Smed_v4_9584_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of follistatin vs. Ensembl Human
Match: FST (follistatin [Source:HGNC Symbol;Acc:HGNC:3971])

HSP 1 Score: 62.3882 bits (150), Expect = 8.244e-10
Identity = 73/305 (23.93%), Postives = 120/305 (39.34%), Query Frame = 2
Query:  410 SLKIGACFLEKSTRGCSEFI--GYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP--ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCI----KCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            S + G C+L ++  G  + +    +++ +CC        +  E           +     PNC     K+ C +  C  G+ C M  ++                GPVC   G+ Y+N+C L    C    +  +     C K  C  + C   +  C++     + CV   +IC         +CG D VTYSS CHL +++    + I +AY G C    +C +++C      C+   + G   C      CP S         K+ E +C S N    + C     +C + V +EV +SG C
Sbjct:   26 SAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPC--KETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKT-CRDVFCPG-SSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCT-GGKKCLWDFKVGRGRCSLCDELCPDS---------KSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 316          
BLAST of follistatin vs. Ensembl Human
Match: FST (follistatin [Source:HGNC Symbol;Acc:HGNC:3971])

HSP 1 Score: 61.6178 bits (148), Expect = 1.350e-9
Identity = 71/300 (23.67%), Postives = 119/300 (39.67%), Query Frame = 2
Query:  410 SLKIGACFLEKSTRGCSEFI--GYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCA--KFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP--ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            S + G C+L ++  G  + +    +++ +CC        +  E           +     PNC     K+ C +  C  G+ C M  ++                GPVC   G+ Y+N+C L    C    +  +      K  C  + C   +  C++     + CV   +IC         +CG D VTYSS CHL +++    + I +AY G C    +C +++C      C+   + G   C  C      C +   K+ E +C S N    + C     +C + V +EV +SG C
Sbjct:   26 SAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPC--KETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPG-SSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCT-GGKKCLWDFKVGRGRCSLCD---ELCPDS--KSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 316          
BLAST of follistatin vs. Ensembl Human
Match: FST (follistatin [Source:HGNC Symbol;Acc:HGNC:3971])

HSP 1 Score: 57.3806 bits (137), Expect = 9.828e-9
Identity = 54/195 (27.69%), Postives = 85/195 (43.59%), Query Frame = 2
Query:  710 GPVCTATGRRYKNKCELHLESCWTNSQQNIIPCA--KFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP--ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            GPVC   G+ Y+N+C L    C    +  +      K  C  + C   +  C++     + CV   +IC         +CG D VTYSS CHL +++    + I +AY G C    +C +++C      C+   + G   C  C      C +   K+ E +C S N    + C     +C + V +EV +SG C
Sbjct:    1 GPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPG-SSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKC-ITKSCEDIQCT-GGKKCLWDFKVGRGRCSLCD---ELCPDS--KSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 187          
BLAST of follistatin vs. Ensembl Human
Match: AGRN (agrin [Source:HGNC Symbol;Acc:HGNC:329])

HSP 1 Score: 59.6918 bits (143), Expect = 1.528e-8
Identity = 53/196 (27.04%), Postives = 77/196 (39.29%), Query Frame = 2
Query:  713 PVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFG-CERLNCHKRNKKCIL-----TLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANC-MNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            PVC   GR Y + C      C    QQ  IP    G C++        +C         NGQ+ C   + C   LYDP+CG D VTY S C LE ++    +EIQ+A  G C     C     C+     C+            CP+   +C        + +C S  +   + C     +C + + + V  +G C
Sbjct:  427 PVCAQDGRTYDSDCWRQQAEC---RQQRAIPSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACECLQAC-SSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQCRFGALCEAETGRCV------------CPS---EC----VALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPC 599          
BLAST of follistatin vs. Ensembl Human
Match: AGRN (agrin [Source:HGNC Symbol;Acc:HGNC:329])

HSP 1 Score: 59.3066 bits (142), Expect = 1.997e-8
Identity = 53/196 (27.04%), Postives = 77/196 (39.29%), Query Frame = 2
Query:  713 PVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFG-CERLNCHKRNKKCIL-----TLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANC-MNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            PVC   GR Y + C      C    QQ  IP    G C++        +C         NGQ+ C   + C   LYDP+CG D VTY S C LE ++    +EIQ+A  G C     C     C+     C+            CP+   +C        + +C S  +   + C     +C + + + V  +G C
Sbjct:  322 PVCAQDGRTYDSDCWRQQAEC---RQQRAIPSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACECLQAC-SSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQCRFGALCEAETGRCV------------CPS---EC----VALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPC 494          
BLAST of follistatin vs. Ensembl Celegans
Match: agr-1 (AGRin (Synaptic protein) homolog; AGRin (Synaptic protein) homolog family member [Source:UniProtKB/TrEMBL;Acc:G5EG68])

HSP 1 Score: 52.7582 bits (125), Expect = 9.587e-7
Identity = 48/161 (29.81%), Postives = 75/161 (46.58%), Query Frame = 2
Query:  716 VCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRN----KKCILTLNGQSKCVNKKICIGQLYDP---ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVC-----IKCPTSMRQC-ENGI 1159
            VC + G+ Y N+C L   +C   +Q+NI       CE     K        C++  N +++C     C     +    +CG D VTYSS CH+++S+  Q+K +  A+ G C     C++V+C+  +       R+G  VC        P S R C ENG+
Sbjct:  483 VCGSDGKTYSNECRLQNAACM--AQKNIFVKYNSACEACKLKKEKCDFYSACVVGENEKAECKCPDDCPSYEMEEGKEVCGTDGVTYSSECHMKKSACHQSKFVMTAFEGKC---DECLHVQCRYGEEC-----RSGVCVCSYNCPANPPLSARICGENGV 633          
BLAST of follistatin vs. Ensembl Fly
Match: Fs (gene:FBgn0259878 transcript:FBtr0339996)

HSP 1 Score: 54.6842 bits (130), Expect = 2.020e-7
Identity = 59/216 (27.31%), Postives = 86/216 (39.81%), Query Frame = 2
Query:  707 SGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCA---KFGCERLNCHKRNKKCILTLNGQSKCVNKKI----CIG--------------QLYD---PICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRAD-ANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            S PVC   GR Y  +C+L   +C TN+ Q  +      K  C  ++C          LNG + CV  +     CI                 YD    +CGVD  TY S C +     +  + I +AY G CRA   +C +++C   D  C+   +   P C+ C     +C     + V  +C   N    + C     SC++  FI V   G C
Sbjct:  566 SNPVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHCKNSCSGVHC----------LNGLT-CVEDQYLMPHCIACRIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGRSIAVAYPGPCRAGRVSCADIKCGPKD-NCLVDLQTRQPRCVTC---RYKCPRKQQRPVHKICGYNNQTYNSWCEMHKHSCESRYFIGVKSQGSC 766          
BLAST of follistatin vs. Ensembl Fly
Match: Fs (gene:FBgn0259878 transcript:FBtr0087398)

HSP 1 Score: 54.6842 bits (130), Expect = 2.056e-7
Identity = 59/216 (27.31%), Postives = 86/216 (39.81%), Query Frame = 2
Query:  707 SGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCA---KFGCERLNCHKRNKKCILTLNGQSKCVNKKI----CIG--------------QLYD---PICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRAD-ANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            S PVC   GR Y  +C+L   +C TN+ Q  +      K  C  ++C          LNG + CV  +     CI                 YD    +CGVD  TY S C +     +  + I +AY G CRA   +C +++C   D  C+   +   P C+ C     +C     + V  +C   N    + C     SC++  FI V   G C
Sbjct:  567 SNPVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHCKNSCSGVHC----------LNGLT-CVEDQYLMPHCIACRIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGRSIAVAYPGPCRAGRVSCADIKCGPKD-NCLVDLQTRQPRCVTC---RYKCPRKQQRPVHKICGYNNQTYNSWCEMHKHSCESRYFIGVKSQGSC 767          
BLAST of follistatin vs. Ensembl Fly
Match: CG32354 (gene:FBgn0052354 transcript:FBtr0076662)

HSP 1 Score: 46.2098 bits (108), Expect = 5.297e-6
Identity = 47/169 (27.81%), Postives = 76/169 (44.97%), Query Frame = 2
Query:  713 PVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQA-KEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIK--------CPTSMRQCENGIYKTVELLCLST 1192
            PVC + G  Y N CEL  ++C + S  ++I   + GCER     +   C      + +C  +K       DP+CG D  TY +RC L   S R     +++++ G C ++ + +   C    + C +  ++G PVC          C   ++ C  G+ KT    C ST
Sbjct:  178 PVCGSDGLIYANICELRKKTC-SRSGVSLIKDVRDGCER----SKGSDC------KHRCSTEK-------DPVCGTDGRTYLNRCMLRVQSCRVGLAAVKLSHVGPC-SNTSAVRESCP---VDCNSAPKDG-PVCSSDGNVYNSTCEMKLKTCGQGVVKTSRKHCQST 323          

HSP 2 Score: 23.8682 bits (50), Expect = 5.297e-6
Identity = 11/25 (44.00%), Postives = 13/25 (52.00%), Query Frame = 1
Query: 1282 SQCKMASLNCADH*FYI**QYLIYQ 1356
            S CKM S NC  H F +   Y + Q
Sbjct:  347 SPCKMRSSNCGKHVFEVPLSYCMSQ 371          
BLAST of follistatin vs. Ensembl Zebrafish
Match: fstb (follistatin b [Source:ZFIN;Acc:ZDB-GENE-031118-139])

HSP 1 Score: 67.781 bits (164), Expect = 7.905e-12
Identity = 71/300 (23.67%), Postives = 117/300 (39.00%), Query Frame = 2
Query:  413 LKIGACFLEKSTRGCSE--FIGYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTN---SQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDP---ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            ++ G C+L++   G  +  ++  M+R  CC        +  E           +     PNC     K+ C +  C  G+ C M   +                GPVC + G+ Y+N+C L    C  +   S Q    C K  C  + C   +  C+L     + CV       ++  P   +CG D   Y+S CHL  ++    + I +AY G C    +C ++ C+E    C+   R G   C  C  +  +   G     + +C S N    + C     +C   + +EV +SG C
Sbjct:   27 VQAGNCWLQQGKNGRCQVLYMSGMSREDCCKSGRLGTAWTEEDVPNNTLFRWLIFNGGAPNCIPC--KETCDNVDCGSGKRCKMNKRNKPRCVCAPDCSNVTFKGPVCGSDGKTYRNECALLRAKCKRHPDLSAQYQGKCKK-SCYDVRCPG-SSTCVLDQTNNAYCVTCNRFCTEVTSPEQYLCGNDGKVYASACHLRRATCIMGRSIGVAYEGKCIDARSCKDINCREG-RKCLWDKRTGRGRCAVCEDTCPESRPG-----DSVCASDNTTYPSDCAMRQAACALGLVLEVKHSGSC 316          
BLAST of follistatin vs. Ensembl Zebrafish
Match: fstb (follistatin b [Source:ZFIN;Acc:ZDB-GENE-031118-139])

HSP 1 Score: 67.3958 bits (163), Expect = 1.255e-11
Identity = 71/300 (23.67%), Postives = 117/300 (39.00%), Query Frame = 2
Query:  413 LKIGACFLEKSTRGCSE--FIGYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTN---SQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDP---ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            ++ G C+L++   G  +  ++  M+R  CC        +  E           +     PNC     K+ C +  C  G+ C M   +                GPVC + G+ Y+N+C L    C  +   S Q    C K  C  + C   +  C+L     + CV       ++  P   +CG D   Y+S CHL  ++    + I +AY G C    +C ++ C+E    C+   R G   C  C  +  +   G     + +C S N    + C     +C   + +EV +SG C
Sbjct:   27 VQAGNCWLQQGKNGRCQVLYMSGMSREDCCKSGRLGTAWTEEDVPNNTLFRWLIFNGGAPNCIPC--KETCDNVDCGSGKRCKMNKRNKPRCVCAPDCSNVTFKGPVCGSDGKTYRNECALLRAKCKRHPDLSAQYQGKCKK-SCYDVRCPG-SSTCVLDQTNNAYCVTCNRFCTEVTSPEQYLCGNDGKVYASACHLRRATCIMGRSIGVAYEGKCIDARSCKDINCREG-RKCLWDKRTGRGRCAVCEDTCPESRPG-----DSVCASDNTTYPSDCAMRQAACALGLVLEVKHSGSC 316          
BLAST of follistatin vs. Ensembl Zebrafish
Match: fstb (follistatin b [Source:ZFIN;Acc:ZDB-GENE-031118-139])

HSP 1 Score: 67.3958 bits (163), Expect = 1.255e-11
Identity = 71/300 (23.67%), Postives = 117/300 (39.00%), Query Frame = 2
Query:  413 LKIGACFLEKSTRGCSE--FIGYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTN---SQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDP---ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            ++ G C+L++   G  +  ++  M+R  CC        +  E           +     PNC     K+ C +  C  G+ C M   +                GPVC + G+ Y+N+C L    C  +   S Q    C K  C  + C   +  C+L     + CV       ++  P   +CG D   Y+S CHL  ++    + I +AY G C    +C ++ C+E    C+   R G   C  C  +  +   G     + +C S N    + C     +C   + +EV +SG C
Sbjct:   27 VQAGNCWLQQGKNGRCQVLYMSGMSREDCCKSGRLGTAWTEEDVPNNTLFRWLIFNGGAPNCIPC--KETCDNVDCGSGKRCKMNKRNKPRCVCAPDCSNVTFKGPVCGSDGKTYRNECALLRAKCKRHPDLSAQYQGKCKK-SCYDVRCPG-SSTCVLDQTNNAYCVTCNRFCTEVTSPEQYLCGNDGKVYASACHLRRATCIMGRSIGVAYEGKCIDARSCKDINCREG-RKCLWDKRTGRGRCAVCEDTCPESRPG-----DSVCASDNTTYPSDCAMRQAACALGLVLEVKHSGSC 316          
BLAST of follistatin vs. Ensembl Zebrafish
Match: fsta (follistatin a [Source:NCBI gene;Acc:100004116])

HSP 1 Score: 63.5438 bits (153), Expect = 1.959e-10
Identity = 68/301 (22.59%), Postives = 119/301 (39.53%), Query Frame = 2
Query:  413 LKIGACFLEKSTRGCSE--FIGYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP---ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            ++ G C+L++   G  +  ++  M+R +CC        +  E           +     PNC     K+ C +  C  G+ C M                    GPVC + G+ Y+++C L    C  +    +     C K  C  + C   +  C++     + CV   +IC  ++  P   +CG D + Y+S CHL  ++    + I +AY G C    +C ++ C  +   C+   +     C  C  S  +      ++ E +C S N    + C     +C   V +EV +SG C
Sbjct:   30 VQAGNCWLQQGKNGRCQVLYMPGMSREECCRSGRLGTSWTEEDVPNSTLFRWMIFNGGAPNCIPC--KETCDNVDCGPGKRCKMNRRSKPRCVCAPDCSNVTWKGPVCGSDGKTYRDECALLKSKCKGHPDLEVQYQGKCKKT-CRDVLCPG-SSTCVVDQTNNAYCVTCNRICP-EVMSPDQYLCGNDGIVYASACHLRRATCLLGRSIGVAYEGKCIKAKSCDDIHC-SAGKKCLWDAKMSRGRCAVCAESCPE-----SRSEEAVCASDNTTYPSECAMKQAACSLGVLLEVKHSGSC 319          
BLAST of follistatin vs. Ensembl Zebrafish
Match: fsta (follistatin a [Source:NCBI gene;Acc:100004116])

HSP 1 Score: 63.5438 bits (153), Expect = 1.959e-10
Identity = 68/301 (22.59%), Postives = 119/301 (39.53%), Query Frame = 2
Query:  413 LKIGACFLEKSTRGCSE--FIGYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP---ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            ++ G C+L++   G  +  ++  M+R +CC        +  E           +     PNC     K+ C +  C  G+ C M                    GPVC + G+ Y+++C L    C  +    +     C K  C  + C   +  C++     + CV   +IC  ++  P   +CG D + Y+S CHL  ++    + I +AY G C    +C ++ C  +   C+   +     C  C  S  +      ++ E +C S N    + C     +C   V +EV +SG C
Sbjct:   30 VQAGNCWLQQGKNGRCQVLYMPGMSREECCRSGRLGTSWTEEDVPNSTLFRWMIFNGGAPNCIPC--KETCDNVDCGPGKRCKMNRRSKPRCVCAPDCSNVTWKGPVCGSDGKTYRDECALLKSKCKGHPDLEVQYQGKCKKT-CRDVLCPG-SSTCVVDQTNNAYCVTCNRICP-EVMSPDQYLCGNDGIVYASACHLRRATCLLGRSIGVAYEGKCIKAKSCDDIHC-SAGKKCLWDAKMSRGRCAVCAESCPE-----SRSEEAVCASDNTTYPSECAMKQAACSLGVLLEVKHSGSC 319          
BLAST of follistatin vs. Ensembl Xenopus
Match: clcn6 (chloride channel, voltage-sensitive 6 [Source:Xenbase;Acc:XB-GENE-990272])

HSP 1 Score: 58.151 bits (139), Expect = 1.922e-8
Identity = 52/200 (26.00%), Postives = 86/200 (43.00%), Query Frame = 2
Query:  710 GPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP--ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNA 1291
            G VC   G+ YK++C L    C    + ++     C K  C  + C   +  C++     + CV   +IC   +     +CG D +TY+S CHL +++    + I +AY G C    +C +++C  +   C+   R G   C  C            K+ + +C S N    + C     +C   V +EV +SG C  N 
Sbjct:  129 GSVCGIDGKTYKDECALLKAKCKGVPELDVQYQGKCKKT-CRDVLC-PGSSTCVVDQTNNAYCVTCNRICPEPVSPDQYLCGNDGITYASACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCS-AGKKCLWDSRVGRGRCALCDDVC----GAESKSDDTVCASDNTTYPSECAMKQAACSTGVLLEVKHSGSCNWNV 321          
BLAST of follistatin vs. Ensembl Xenopus
Match: clcn6 (chloride channel, voltage-sensitive 6 [Source:Xenbase;Acc:XB-GENE-990272])

HSP 1 Score: 57.3806 bits (137), Expect = 2.791e-8
Identity = 51/196 (26.02%), Postives = 85/196 (43.37%), Query Frame = 2
Query:  710 GPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP--ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            G VC   G+ YK++C L    C    + ++     C K  C  + C   +  C++     + CV   +IC   +     +CG D +TY+S CHL +++    + I +AY G C    +C +++C  +   C+   R G   C  C            K+ + +C S N    + C     +C   V +EV +SG C
Sbjct:  113 GSVCGIDGKTYKDECALLKAKCKGVPELDVQYQGKCKKT-CRDVLCPG-SSTCVVDQTNNAYCVTCNRICPEPVSPDQYLCGNDGITYASACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCS-AGKKCLWDSRVGRGRCALCDDVC----GAESKSDDTVCASDNTTYPSECAMKQAACSTGVLLEVKHSGSC 301          
BLAST of follistatin vs. Ensembl Xenopus
Match: clcn6 (chloride channel, voltage-sensitive 6 [Source:Xenbase;Acc:XB-GENE-990272])

HSP 1 Score: 57.3806 bits (137), Expect = 3.092e-8
Identity = 51/196 (26.02%), Postives = 85/196 (43.37%), Query Frame = 2
Query:  710 GPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP--ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            G VC   G+ YK++C L    C    + ++     C K  C  + C   +  C++     + CV   +IC   +     +CG D +TY+S CHL +++    + I +AY G C    +C +++C  +   C+   R G   C  C            K+ + +C S N    + C     +C   V +EV +SG C
Sbjct:  129 GSVCGIDGKTYKDECALLKAKCKGVPELDVQYQGKCKKT-CRDVLC-PGSSTCVVDQTNNAYCVTCNRICPEPVSPDQYLCGNDGITYASACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCS-AGKKCLWDSRVGRGRCALCDDVC----GAESKSDDTVCASDNTTYPSECAMKQAACSTGVLLEVKHSGSC 317          
BLAST of follistatin vs. Ensembl Xenopus
Match: clcn6 (chloride channel, voltage-sensitive 6 [Source:Xenbase;Acc:XB-GENE-990272])

HSP 1 Score: 56.9954 bits (136), Expect = 3.912e-8
Identity = 51/196 (26.02%), Postives = 85/196 (43.37%), Query Frame = 2
Query:  710 GPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP--ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            G VC   G+ YK++C L    C    + ++     C K  C  + C   +  C++     + CV   +IC   +     +CG D +TY+S CHL +++    + I +AY G C    +C +++C  +   C+   R G   C  C            K+ + +C S N    + C     +C   V +EV +SG C
Sbjct:  129 GSVCGIDGKTYKDECALLKAKCKGVPELDVQYQGKCKKT-CRDVLC-PGSSTCVVDQTNNAYCVTCNRICPEPVSPDQYLCGNDGITYASACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCS-AGKKCLWDSRVGRGRCALCDDVC----GAESKSDDTVCASDNTTYPSECAMKQAACSTGVLLEVKHSGSC 317          
BLAST of follistatin vs. Ensembl Xenopus
Match: clcn6 (chloride channel, voltage-sensitive 6 [Source:Xenbase;Acc:XB-GENE-990272])

HSP 1 Score: 56.6102 bits (135), Expect = 4.955e-8
Identity = 51/196 (26.02%), Postives = 85/196 (43.37%), Query Frame = 2
Query:  710 GPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP--ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            G VC   G+ YK++C L    C    + ++     C K  C  + C   +  C++     + CV   +IC   +     +CG D +TY+S CHL +++    + I +AY G C    +C +++C  +   C+   R G   C  C            K+ + +C S N    + C     +C   V +EV +SG C
Sbjct:  130 GSVCGIDGKTYKDECALLKAKCKGVPELDVQYQGKCKKT-CRDVLCPG-SSTCVVDQTNNAYCVTCNRICPEPVSPDQYLCGNDGITYASACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCS-AGKKCLWDSRVGRGRCALCDDVC----GAESKSDDTVCASDNTTYPSECAMKQAACSTGVLLEVKHSGSC 318          
BLAST of follistatin vs. Ensembl Mouse
Match: Fst (follistatin [Source:MGI Symbol;Acc:MGI:95586])

HSP 1 Score: 62.003 bits (149), Expect = 7.357e-10
Identity = 73/305 (23.93%), Postives = 120/305 (39.34%), Query Frame = 2
Query:  410 SLKIGACFLEKSTRGCSEFI--GYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP--ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCI----KCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            S + G C+L ++  G  + +    +++ +CC        +  E           +     PNC     K+ C +  C  G+ C M  ++                GPVC   G+ Y+N+C L    C    +  +     C K  C  + C   +  C++     + CV   +IC         +CG D VTYSS CHL +++    + I +AY G C    +C +++C      C+   + G   C      CP S         K+ E +C S N    + C     +C + V +EV +SG C
Sbjct:   26 SAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPC--KETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKT-CRDVFCPG-SSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCG-GGKKCLWDSKVGRGRCSLCDELCPDS---------KSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 316          
BLAST of follistatin vs. Ensembl Mouse
Match: Fst (follistatin [Source:MGI Symbol;Acc:MGI:95586])

HSP 1 Score: 62.003 bits (149), Expect = 7.609e-10
Identity = 73/305 (23.93%), Postives = 120/305 (39.34%), Query Frame = 2
Query:  410 SLKIGACFLEKSTRGCSEFI--GYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP--ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCI----KCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            S + G C+L ++  G  + +    +++ +CC        +  E           +     PNC     K+ C +  C  G+ C M  ++                GPVC   G+ Y+N+C L    C    +  +     C K  C  + C   +  C++     + CV   +IC         +CG D VTYSS CHL +++    + I +AY G C    +C +++C      C+   + G   C      CP S         K+ E +C S N    + C     +C + V +EV +SG C
Sbjct:   26 SAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPC--KETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKT-CRDVFCPG-SSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCG-GGKKCLWDSKVGRGRCSLCDELCPDS---------KSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 316          
BLAST of follistatin vs. Ensembl Mouse
Match: Agrn (agrin [Source:MGI Symbol;Acc:MGI:87961])

HSP 1 Score: 61.6178 bits (148), Expect = 3.001e-9
Identity = 38/111 (34.23%), Postives = 52/111 (46.85%), Query Frame = 2
Query:  713 PVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTL-----NGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVC 1030
            PVC   G  Y N C      C    QQ I P  +  C++     R  +C         NG++ C  +++C G  YDP+CG D VTY S C LE  +    +EI++A  G C
Sbjct:  322 PVCAQDGHTYDNDCWRQQAEC--RQQQTIPPKHQGPCDQTPSPCRGAQCAFGATCTVKNGKAVCECQRVCSGG-YDPVCGSDGVTYGSVCELESMACTLGREIRVARRGPC 429          

HSP 2 Score: 50.0618 bits (118), Expect = 9.521e-6
Identity = 41/131 (31.30%), Postives = 54/131 (41.22%), Query Frame = 2
Query:  698 QKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFG-CERLNCHK------RNKKCILTLNGQ-----------SKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRA 1036
                GPVC + G  Y + CEL   +C    QQ  I  A+ G CE   C         +  C   L  Q             CV    C   L  P+CG D VTYS+ CHL+++     +E+ +A  G CR 
Sbjct:  520 HPPPGPVCGSDGVTYLSACELREAAC---QQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDFSCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRG 647          
BLAST of follistatin vs. Ensembl Mouse
Match: Agrn (agrin [Source:MGI Symbol;Acc:MGI:87961])

HSP 1 Score: 61.2326 bits (147), Expect = 3.965e-9
Identity = 51/195 (26.15%), Postives = 80/195 (41.03%), Query Frame = 2
Query:  713 PVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCIL-----TLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANC-MNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            PVC   G  Y N C      C    QQ I P  +  C++     R  +C         NG++ C  +++C G  YDP+CG D VTY S C LE  +    +EI++A  G C     C     C+     C+            CP+   +C     ++ + +C S  +   + C     +C + + + V  +G C
Sbjct:  429 PVCAQDGHTYDNDCWRQQAEC--RQQQTIPPKHQGPCDQTPSPCRGAQCAFGATCTVKNGKAVCECQRVCSGG-YDPVCGSDGVTYGSVCELESMACTLGREIRVARRGPCDRCGQCRFGSLCEVETGRCV------------CPS---EC----VESAQPVCGSDGHTYASECELHVHACTHQISLYVASAGHC 601          

HSP 2 Score: 51.2174 bits (121), Expect = 5.317e-6
Identity = 37/135 (27.41%), Postives = 58/135 (42.96%), Query Frame = 2
Query:  875 GQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            G++ CV KK     +  P+CG D  TYS+ C L+ +   Q + I++   G C +   C NV C     TC+      +  C+ CPT+     +G       +C S   +  + C     +C N   I   + G C
Sbjct:  193 GRASCVCKKNVCPAMVAPVCGSDASTYSNECELQRAQCNQQRRIRLLRQGPCGSRDPCANVTCSFGS-TCVPSADGQTASCL-CPTTCFGAPDGT------VCGSDGVDYPSECQLLRHACANQEHIFKKFDGPC 319          

HSP 3 Score: 50.8322 bits (120), Expect = 5.501e-6
Identity = 41/127 (32.28%), Postives = 54/127 (42.52%), Query Frame = 2
Query:  710 GPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFG-CERLNCHK------RNKKCILTLNGQ-----------SKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRA 1036
            GPVC + G  Y + CEL   +C    QQ  I  A+ G CE   C         +  C   L  Q             CV    C   L  P+CG D VTYS+ CHL+++     +E+ +A  G CR 
Sbjct:  631 GPVCGSDGVTYLSACELREAAC---QQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDFSCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRG 754          
BLAST of follistatin vs. Ensembl Mouse
Match: Agrn (agrin [Source:MGI Symbol;Acc:MGI:87961])

HSP 1 Score: 60.8474 bits (146), Expect = 4.797e-9
Identity = 51/195 (26.15%), Postives = 80/195 (41.03%), Query Frame = 2
Query:  713 PVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCIL-----TLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANC-MNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            PVC   G  Y N C      C    QQ I P  +  C++     R  +C         NG++ C  +++C G  YDP+CG D VTY S C LE  +    +EI++A  G C     C     C+     C+            CP+   +C     ++ + +C S  +   + C     +C + + + V  +G C
Sbjct:  322 PVCAQDGHTYDNDCWRQQAEC--RQQQTIPPKHQGPCDQTPSPCRGAQCAFGATCTVKNGKAVCECQRVCSGG-YDPVCGSDGVTYGSVCELESMACTLGREIRVARRGPCDRCGQCRFGSLCEVETGRCV------------CPS---EC----VESAQPVCGSDGHTYASECELHVHACTHQISLYVASAGHC 494          

HSP 2 Score: 50.8322 bits (120), Expect = 6.275e-6
Identity = 41/127 (32.28%), Postives = 54/127 (42.52%), Query Frame = 2
Query:  710 GPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFG-CERLNCHK------RNKKCILTLNGQ-----------SKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRA 1036
            GPVC + G  Y + CEL   +C    QQ  I  A+ G CE   C         +  C   L  Q             CV    C   L  P+CG D VTYS+ CHL+++     +E+ +A  G CR 
Sbjct:  524 GPVCGSDGVTYLSACELREAAC---QQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDFSCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRG 647          

HSP 3 Score: 50.8322 bits (120), Expect = 6.383e-6
Identity = 37/135 (27.41%), Postives = 58/135 (42.96%), Query Frame = 2
Query:  875 GQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            G++ CV KK     +  P+CG D  TYS+ C L+ +   Q + I++   G C +   C NV C     TC+      +  C+ CPT+     +G       +C S   +  + C     +C N   I   + G C
Sbjct:   86 GRASCVCKKNVCPAMVAPVCGSDASTYSNECELQRAQCNQQRRIRLLRQGPCGSRDPCANVTCSFGS-TCVPSADGQTASCL-CPTTCFGAPDGT------VCGSDGVDYPSECQLLRHACANQEHIFKKFDGPC 212          
BLAST of follistatin vs. UniProt/SwissProt
Match: sp|O62650|FST_HORSE (Follistatin OS=Equus caballus OX=9796 GN=FST PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 4.078e-10
Identity = 73/301 (24.25%), Postives = 121/301 (40.20%), Query Frame = 2
Query:  410 SLKIGACFLEKSTRGCSEFI--GYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP--ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            S + G C+L ++  G  + +    +++ +CC        +  E           +     PNC     K+ C +  C  G+ C M  ++                GPVC   G+ Y+N+C L    C    +  +     C K  C  +NC   +  C++     + CV   +IC         +CG D VTYSS CHL +++    + I +AY G C    +C +++C      C+   + G   C  C      C +   K+ E +C S N    + C     +C + V +EV +SG C
Sbjct:   26 SAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPC--KETCDNVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKT-CRDVNCPG-SSTCVVDQTNNAYCVTCNRICPEPTSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCT-GGKKCLWDFKVGRGRCSLCD---ELCPDS--KSEEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 316          
BLAST of follistatin vs. UniProt/SwissProt
Match: sp|Q9YHV4|FSTA_DANRE (Follistatin-A OS=Danio rerio OX=7955 GN=fsta PE=2 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 1.479e-9
Identity = 68/301 (22.59%), Postives = 119/301 (39.53%), Query Frame = 2
Query:  413 LKIGACFLEKSTRGCSE--FIGYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP---ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            ++ G C+L++   G  +  ++  M+R +CC        +  E           +     PNC     K+ C +  C  G+ C M                    GPVC + G+ Y+++C L    C  +    +     C K  C  + C   +  C++     + CV   +IC  ++  P   +CG D + Y+S CHL  ++    + I +AY G C    +C ++ C  +   C+   +     C  C  S  +      ++ E +C S N    + C     +C   V +EV +SG C
Sbjct:   30 VQAGNCWLQQGKNGRCQVLYMPGMSREECCRSGRLGTSWTEEDVPNSTLFRWMIFNGGAPNCIPC--KETCDNVDCGPGKRCKMNRRSKPRCVCAPDCSNVTWKGPVCGSDGKTYRDECALLKSKCKGHPDLEVQYQGKCKKT-CRDVLCPG-SSTCVVDQTNNAYCVTCNRICP-EVMSPDQYLCGNDGIVYASACHLRRATCLLGRSIGVAYEGKCIKAKSCDDIHC-SAGKKCLWDAKMSRGRCAVCAESCPE-----SRSEEAVCASDNTTYPSECAMKQAACSLGVLLEVKHSGSC 319          
BLAST of follistatin vs. UniProt/SwissProt
Match: sp|P21674|FST_RAT (Follistatin OS=Rattus norvegicus OX=10116 GN=Fst PE=1 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 3.369e-9
Identity = 72/301 (23.92%), Postives = 120/301 (39.87%), Query Frame = 2
Query:  410 SLKIGACFLEKSTRGCSEFI--GYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICI--GQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            S + G C+L ++  G  + +    +++ +CC        +  E           +     PNC     K+ C +  C  G+ C M  ++                GPVC   G+ Y+N+C L    C    +  +     C K  C  + C   +  C++     + CV   +IC         +CG D VTYSS CHL +++    + I +AY G C    +C +++C      C+   + G   C  C      C +   K+ E +C S N    + C     +C + V +EV +SG C
Sbjct:   26 SAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPC--KETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKT-CRDVFCPG-SSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCG-GGKKCLWDFKVGRGRCSLCD---ELCPDS--KSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 316          
BLAST of follistatin vs. UniProt/SwissProt
Match: sp|P10669|FST_PIG (Follistatin OS=Sus scrofa OX=9823 GN=FST PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 4.254e-9
Identity = 71/301 (23.59%), Postives = 119/301 (39.53%), Query Frame = 2
Query:  410 SLKIGACFLEKSTRGCSEFI--GYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP--ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            S + G C+L ++  G  + +    +++ +CC        +  E           +     PNC     K+ C +  C  G+ C M  ++                GPVC   G+ Y+N+C L    C    +  +     C K  C  + C   +  C++     + CV   +IC         +CG D VTYSS CHL +++    + I +AY G C    +C +++C      C+   + G   C  C     +      K+ E +C S N    + C     +C + V +EV +SG C
Sbjct:   26 SAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPC--KETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKT-CRDVFCPG-SSTCVVDQTNNAYCVTCNRICPEPTSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCT-GGKKCLWDFKVGRGRCSLCDELCPE-----SKSEEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 316          
BLAST of follistatin vs. UniProt/SwissProt
Match: sp|P47931|FST_MOUSE (Follistatin OS=Mus musculus OX=10090 GN=Fst PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 5.323e-9
Identity = 73/305 (23.93%), Postives = 120/305 (39.34%), Query Frame = 2
Query:  410 SLKIGACFLEKSTRGCSEFI--GYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP--ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCI----KCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            S + G C+L ++  G  + +    +++ +CC        +  E           +     PNC     K+ C +  C  G+ C M  ++                GPVC   G+ Y+N+C L    C    +  +     C K  C  + C   +  C++     + CV   +IC         +CG D VTYSS CHL +++    + I +AY G C    +C +++C      C+   + G   C      CP S         K+ E +C S N    + C     +C + V +EV +SG C
Sbjct:   26 SAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPC--KETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKT-CRDVFCPG-SSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCG-GGKKCLWDSKVGRGRCSLCDELCPDS---------KSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 316          
BLAST of follistatin vs. TrEMBL
Match: I1ZI69 (Follistatin OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 323/323 (100.00%), Postives = 323/323 (100.00%), Query Frame = 2
Query:  335 MKMFITXXXXXXXXXCNLASSTTIGSLKIGACFLEKSTRGCSEFIGYMNRNKCCHYNGFFVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWPR 1303
            MKMFITLSLLLLSVVCNLASSTTIGSLKIGACFLEKSTRGCSEFIGYMNRNKCCHYNGFFVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRDEDSICSSECICSEEQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWPR
Sbjct:    1 MKMFITLSLLLLSVVCNLASSTTIGSLKIGACFLEKSTRGCSEFIGYMNRNKCCHYNGFFVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRDEDSICSSECICSEEQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWPR 323          
BLAST of follistatin vs. TrEMBL
Match: T1DF95 (Follistatin OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 1.379e-102
Identity = 161/307 (52.44%), Postives = 219/307 (71.34%), Query Frame = 2
Query:  383 NLASSTTIGSLKIGACFLEKSTRGCSEFIGYMNRNKCCHYNGFFVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNK-KICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWP 1300
            N AS T   S   GACF  K++RGC+ F+GY  RN+CC + G+FVR  + GQLFLA  +  + + NCE+SC  D+C  KIC  G+ CIMR+ DSICSS+C C+ +Q+ SGP+C   G +Y+N C+LHLESC T++   ++PC+K GC+R  C +R+  CIL  NG+S+CV+K + C+G++Y P+CGV+NVTY S CH+ ++ I + +EI +AY G CRA A C NVEC  S+M C+ HH N SPVC+ CP SM +C+N  Y T E  CLSTN+ ++NTCYKD+LSCQNNVF+EV++SG CL   K P
Sbjct:   15 NAASITKDLSPITGACFYNKNSRGCNSFMGYFTRNECCRHGGYFVRSADRGQLFLAIMINTYSVTNCENSCGIDYCEGKICKSGDKCIMRENDSICSSDCKCTRKQRESGPICVRNGPKYRNMCDLHLESCLTDTSHTLVPCSKSGCDRKRCGRRS--CILNQNGKSECVDKVRSCVGEVYKPLCGVNNVTYPSLCHITKAGIERGREIYVAYEGTCRASATCSNVECPHSNMVCVKHHSNSSPVCLTCPESMEKCDNTKYNTDEHFCLSTNHHSRNTCYKDYLSCQNNVFVEVIHSGMCLHTVKLP 319          
BLAST of follistatin vs. TrEMBL
Match: A0A5K3FSG7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 4.419e-22
Identity = 89/315 (28.25%), Postives = 142/315 (45.08%), Query Frame = 2
Query:  386 LASSTTIGSLKIGACFLEKSTRG-CSEFI--GYMNRNKCCHYNGFFV-REPNAGQLFLAAFLKKHIIPNCESSCSKDF----CADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII------PCAKFGCE---------------RLNCHKRNKKCILTL-NGQSKCVNKKI---------------------CIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVEL 1177
            + ++  + + + G+CF  +   G C + I   Y++R++CC   GF+V R     Q      L +    NC   C        CA   CP G  C ++   ++C+   IC+++   SGPVCT   R+++N+C    E C     Q+++      P A+  C                 +    RN+ CI+ L +G++ C +                          GQ    +CG DN TY+++CHL  +SIR+  EI+IAY G CR DA+C  V CQ +DM C+ H   G PVC+ C      C   ++ + E+
Sbjct:   25 VLATLLLDTSEAGSCFKIRLPNGRCHQLIQRNYISRSECCQIGGFYVHRFLTETQFVRDILLHRSGTDNCHYPCQSGMRSESCARVNCPAGYKCELQRGKAVCACSSICTKDDFESGPVCTTDFRQFRNRCSFMKERC---RNQDVMLEEMECPPAEHVCPYKRNVTDVDAGDYELPVRICPRNQVCIVRLYSGKASCEDPNWLGRRRMKSTFDALDVNSLNSCANGQFRSYVCGTDNTTYTNQCHLRRASIRRGIEIRIAYMGPCRRDASCGKVRCQSADMICVRHVNTGQPVCLDCKDLPLNCNPQVFPSREV 336          
BLAST of follistatin vs. TrEMBL
Match: A0A068WUV7 (Follistatin OS=Echinococcus granulosus OX=6210 GN=EgrG_000189700 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 6.064e-22
Identity = 103/346 (29.77%), Postives = 154/346 (44.51%), Query Frame = 2
Query:  422 GACFLEKSTRG-CSEFI--GYMNRNKCCHYNGFFVR----EPNAGQLFLAAFLKKHIIPNCESSCSKDF----CADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII----PCAKFGC------ERLNCHK---------RNKKCIL-TLNGQSKC--------------------VNKKICIGQLY-DPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWPR 1303
            G+CF  +   G C E +   Y+ R++CC   GF+V     EP   Q      L++  I NC  SC + F    CA   CP G  C +++ +++C+   IC  E   SGPVCT   R+++N+C    E C  N    ++    P A   C        L  H           NK CI+   +G++ C                     N   C    Y  PICG DN TY+++CHL ++SI++  EI++AY G CR +A C  + CQ   MTC+ H R G PVC+ C      C   ++  +    ++     + T ++ F   + N F +  + G    N  WPR
Sbjct:   21 GSCFRIRLPNGRCHELLQRNYITRSECCRLGGFYVSGHLTEP---QFVRDLLLRRTGIANCHYSCQRGFHNESCARVNCPDGFRCEVQNHEAVCACSSICIVEDFESGPVCTTDFRQFRNRCSFLKERC-RNLDTLLVEMECPPADHVCPYRQNTSHLEDHDYAYPVRICPPNKVCIVRQYSGRASCEDPNWLGRKHIESAFDRVTVSNLDSCANSPYGSPICGTDNNTYNNQCHLRKASIQKGLEIRVAYLGPCRKNATCDQIRCQSPHMTCVPHVRTGQPVCLDCTDLPPNCNPRVFVRINPADIA-----EMTLFEMFKEAKQN-FGDPRWHGDVFTNG-WPR 355          
BLAST of follistatin vs. TrEMBL
Match: A0A068XT73 (Follistatin OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000278400 PE=4 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 5.078e-21
Identity = 105/354 (29.66%), Postives = 158/354 (44.63%), Query Frame = 2
Query:  422 GACFLEKSTRG-CSEFI--GYMNRNKCCHYNGFFVR----EPNAGQLFLAAFLKKHIIPNCESSCSKDF----CADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII----PCAKFGCE------RLNCH---------KRNKKCIL-TLNGQSKCVNK-------------KICIGQLYD--------PICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLS--TNYETKNTCYKDF--LSCQNNVFIEVLYSGQCLLNAKWPR*IVQ 1315
            G+CF  +   G C E +   Y+ R++CC   GF+V     EP   Q      L++  I NC  SC + F    CA   CP G  C +++ +++C+   IC  E   SGPVCT   R+++N+C    E C  N    ++    P A   C        L  H           NK CI+   +G++ C +              ++ +  L          PICG DN TY+++CHL ++SI++  EI+IAY G CR +A C  + CQ   MTC+ H R G PVC+ C      C   ++  +    ++  T +E      ++F       +VF   L SG      KW + I Q
Sbjct:   21 GSCFRIRLPNGRCHELLQRNYITRSECCRLGGFYVSGHLTEP---QFVRDLLLRRTGIANCHYSCQRGFHNESCARVNCPDGFRCEVQNHEAVCACSSICIVEDFESGPVCTTDFRQFRNRCSFLKERC-RNLDTLLVEMECPPADHVCPYRQNTSHLEDHDYAYPVRICPPNKVCIVRQYSGRASCEDPNWLGRKHIESAFDRVAVSNLDSCANSPYGSPICGTDNNTYNNQCHLRKASIQKGLEIRIAYLGPCRKNATCDQIRCQSPHMTCVPHVRTGQPVCLDCTDLPPNCNPRVFVRINPAEIAEMTLFEMFKEAKQNFGDPRWHGDVFTXWLASGM----WKWKKVIPQ 366          
BLAST of follistatin vs. Ensembl Cavefish
Match: fstb (follistatin-A-like [Source:NCBI gene;Acc:103035751])

HSP 1 Score: 73.1738 bits (178), Expect = 1.634e-13
Identity = 73/299 (24.41%), Postives = 116/299 (38.80%), Query Frame = 2
Query:  413 LKIGACFLEKSTRGCSE--FIGYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESC--WTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDP---ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            ++ G C+LE+   G  +  ++  M+R +CC        +  E           L     PNC     K+ C +  C  G+ C M   +                GPVC + G+ Y+N+C L    C  + N         +  CE + C   +  C++     + CV       +L  P   +CG D V Y+S CHL  ++    + I +AY G C    +C ++ C E   TC+   R G   C  C     +   G     + +C S N    + C     +C     +EV +SG C
Sbjct:   68 VQGGNCWLEQGKNGRCQVLYMSGMSREECCRSERLGTAWTEEDVGSNTLFRWLLLNGGAPNCIPC--KETCDNVDCGPGKRCKMNKRNRPRCVCAPDCSSSTFKGPVCGSDGKTYRNECALLRAKCKRYPNLVAQYQGKCRKTCEDVRCPG-SSTCVVDQINNAYCVTCNRLCPELTSPEQYLCGNDGVVYASACHLRRATCILGRSIGVAYEGKCIDAQSCNDIRCPEGK-TCLWDARTGRGRCSACEEDCPESRPG-----DSVCASDNTTYPSECTMRRAACSLGRVLEVKHSGSC 357          
BLAST of follistatin vs. Ensembl Cavefish
Match: fstb (follistatin-A-like [Source:NCBI gene;Acc:103035751])

HSP 1 Score: 72.7886 bits (177), Expect = 1.808e-13
Identity = 73/299 (24.41%), Postives = 116/299 (38.80%), Query Frame = 2
Query:  413 LKIGACFLEKSTRGCSE--FIGYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESC--WTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDP---ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            ++ G C+LE+   G  +  ++  M+R +CC        +  E           L     PNC     K+ C +  C  G+ C M   +                GPVC + G+ Y+N+C L    C  + N         +  CE + C   +  C++     + CV       +L  P   +CG D V Y+S CHL  ++    + I +AY G C    +C ++ C E   TC+   R G   C  C     +   G     + +C S N    + C     +C     +EV +SG C
Sbjct:   30 VQGGNCWLEQGKNGRCQVLYMSGMSREECCRSERLGTAWTEEDVGSNTLFRWLLLNGGAPNCIPC--KETCDNVDCGPGKRCKMNKRNRPRCVCAPDCSSSTFKGPVCGSDGKTYRNECALLRAKCKRYPNLVAQYQGKCRKTCEDVRCPG-SSTCVVDQINNAYCVTCNRLCPELTSPEQYLCGNDGVVYASACHLRRATCILGRSIGVAYEGKCIDAQSCNDIRCPEGK-TCLWDARTGRGRCSACEEDCPESRPG-----DSVCASDNTTYPSECTMRRAACSLGRVLEVKHSGSC 319          
BLAST of follistatin vs. Ensembl Cavefish
Match: fsta (follistatin [Source:NCBI gene;Acc:103024347])

HSP 1 Score: 68.1662 bits (165), Expect = 5.519e-12
Identity = 71/301 (23.59%), Postives = 121/301 (40.20%), Query Frame = 2
Query:  413 LKIGACFLEKSTRGCSE--FIGYMNRNKCCH---YNGFFVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP---ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            L  G C+L++   G  +  ++  M+R +CC       F+  E           +     PNC     K+ C +  C  G+ C M                    GPVC + G+ Y+++C L    C  +    +     C K  C  + C   +  C++     + CV   +IC  ++  P   +CG D + Y+S CHL  ++    + I +AY G C    +C +++C  +   C+   R G   C  C  +  +      ++ E +C S N    + C     +C   V +EV +SG C
Sbjct:    6 LNSGNCWLQQGKNGRCQVLYMPGMSREECCRSGRLGTFWTEEDVPNSTLFRWTIFNGGAPNCIPC--KETCDNVDCGPGKKCKMNRRSKPRCVCAPDCSNITWKGPVCGSDGKTYRDECALLKSKCKGHPDLEVQYQGKCKKT-CRDVLCPG-SSTCVVDQTNNAYCVTCNRICP-EVTSPDQYLCGNDGIVYASACHLRRATCLLGRSIGVAYEGKCIKAKSCDDIQCS-AGKKCLWDVRMGRGRCALCEETCPE-----SRSDEAVCASDNTSYPSVCAMKQAACSLGVLLEVKHSGSC 295          
BLAST of follistatin vs. Ensembl Cavefish
Match: fsta (follistatin [Source:NCBI gene;Acc:103024347])

HSP 1 Score: 67.781 bits (164), Expect = 7.709e-12
Identity = 70/301 (23.26%), Postives = 122/301 (40.53%), Query Frame = 2
Query:  413 LKIGACFLEKSTRGCSE--FIGYMNRNKCCH---YNGFFVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVN-KKICIGQLYDP---ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            ++ G C+L++   G  +  ++  M+R +CC       F+  E           +     PNC     K+ C +  C  G+ C M                    GPVC + G+ Y+++C L    C  +    +     C K  C  + C   +  C++     + CV   +IC  ++  P   +CG D + Y+S CHL  ++    + I +AY G C    +C +++C  +   C+   R G   C  C  +  +      ++ E +C S N    + C     +C   V +EV +SG C
Sbjct:   28 VQAGNCWLQQGKNGRCQVLYMPGMSREECCRSGRLGTFWTEEDVPNSTLFRWTIFNGGAPNCIPC--KETCDNVDCGPGKKCKMNRRSKPRCVCAPDCSNITWKGPVCGSDGKTYRDECALLKSKCKGHPDLEVQYQGKCKKT-CRDVLCPG-SSTCVVDQTNNAYCVTCNRICP-EVTSPDQYLCGNDGIVYASACHLRRATCLLGRSIGVAYEGKCIKAKSCDDIQC-SAGKKCLWDVRMGRGRCALCEETCPE-----SRSDEAVCASDNTSYPSVCAMKQAACSLGVLLEVKHSGSC 317          
BLAST of follistatin vs. Ensembl Cavefish
Match: agrn (agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033])

HSP 1 Score: 55.4546 bits (132), Expect = 2.082e-7
Identity = 58/237 (24.47%), Postives = 97/237 (40.93%), Query Frame = 2
Query:  599 KDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQ---LYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWP 1300
            KD C D  C  G  CI   +       C  S E+     VC + G  Y ++CEL++++C T  Q+NI       C+     +        +N Q++ +             +P+C  D  +YSS C ++ +++ + + ++  +SG C+        EC+ S +  + + R       +C      C+ G YK    LC    +   N C +    C+    I V   G C LNA  P
Sbjct:  128 KDPCNDVTCSYGSTCIQSSDGLSAKCMCPLSCERVPKQVVCGSDGLDYPSECELNMKACST--QKNIRLQHSGSCDPCRDIQSGLNFTCLVNAQTRKMETSAPPDSCPPGAEPLCASDGRSYSSECQMQRTAVLKERHLKKVHSGPCQPQGKECKEECRFSAVCLLENGR------ARCSCDPIHCD-GTYKP---LCGKDGHTYPNDCERRNAECRTQTHIPVKQQGTCDLNAPSP 352          
BLAST of follistatin vs. Ensembl Sea Lamprey
Match: FST (follistatin [Source:HGNC Symbol;Acc:HGNC:3971])

HSP 1 Score: 66.6254 bits (161), Expect = 1.265e-12
Identity = 59/207 (28.50%), Postives = 88/207 (42.51%), Query Frame = 2
Query:  704 SSGPVCTATGRRYKNKCELHLESCWTNSQQNI-----IPCAKFGCERLNCHKRNKKCILTLNGQSKCV--NKKICIGQ--------LYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            S   VC   G+ Y++ C L    C    Q N+      PC K  C+ + C      C++  N  + CV  N + C  +            +CG D VTY+S CHL  ++    K I +AY G C    +C +V C  S   C+     G P C +C    R       K +E +C + N    N C     +C + V++EV ++G C
Sbjct:   34 SRASVCGTDGKTYRDGCALLKARC--KGQPNLEMQYHGPCQK-NCKDVQC-PSGTFCVVDQNNNAHCVLCNLRPCPAESGQGEQQQQQQHVCGKDGVTYASVCHLRRATCLLGKSIGVAYQGRCSKSKSCDDVLCG-SGKKCLWDPAEGGPHCAQCNDICRD-----AKRMEPVCATNNNTYPNACAMGNAACSSGVYLEVKHTGYC 230          
BLAST of follistatin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001644.1 (pep scaffold:Pmarinus_7.0:GL489999:4503:6705:-1 gene:ENSPMAG00000001484.1 transcript:ENSPMAT00000001644.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 4.037e-7
Identity = 30/119 (25.21%), Postives = 50/119 (42.02%), Query Frame = 2
Query:  929 ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVE--LLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            +CG D VTY   CHL  ++ ++ + I +A+ G C+   +C +  C      C+       P C+ CP +        +   E   +C S N    + C     +C   V++E    G C
Sbjct:   49 LCGNDGVTYPGVCHLRRATCQRGRSIGVAHHGPCQDRPSCADTRCGPG-RRCLWDSEARRPHCVLCPEAPCSTAATRHGPDERAAVCASDNVTYPSACAMREAACARGVYLEPRAPGFC 166          
BLAST of follistatin vs. Ensembl Nematostella
Match: EDO30230 (Follistatin-like protein; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1D7])

HSP 1 Score: 58.151 bits (139), Expect = 3.345e-9
Identity = 64/233 (27.47%), Postives = 99/233 (42.49%), Query Frame = 2
Query:  482 RNKCCHYNGFF--VREPNAGQLFLAAFLKKHIIPNCESSCSKD------FCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSS-GPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFG-----CERLNCHKRNKKCILTLNGQSKCVNKKICIGQ--LYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPT 1132
            + +CC  +G F   +  + G+ F    +K+ I P+C   CS+        C+D  C    +C  R + S C            +  PVC   G+ Y+N C L   +C   S+QN +  A  G     C  + C    + C++    +S CV+             +CG D VTY S C L  ++ +  K I +AY G C+  ++C  V+C      C+T    G P C  C T
Sbjct:   17 KRECCMNDGMFYTTQTFDPGRFFRFRIVKQGI-PDCYQ-CSETRQNPGIACSDMDCGPDRYCKARFQKSKCVCRRTHQRCSTLAISPVCGTNGKTYQNMCFLERRAC---SKQNRVTVAYRGPCNDNCVNVTCPT-GQSCVVDQYNKSHCVSNCSSCNSSPADTEVCGADGVTYGSLCRLRVATCKLGKTIGVAYLGSCKEGSDCSTVKCSRHKR-CLTDE-TGQPRCTSCHT 241          
BLAST of follistatin vs. Ensembl Nematostella
Match: EDO40385 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7E4])

HSP 1 Score: 53.9138 bits (128), Expect = 1.247e-8
Identity = 39/137 (28.47%), Postives = 63/137 (45.99%), Query Frame = 2
Query:  713 PVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCM-NVEC-QESDMTCITHHRNGSPVC 1117
            P+C + G+ Y NKC +  ES       ++ PC++  C          +C++  NG++ CV  + C  + + P+CG D   Y +RC L  ++ R    I++   G+C     C  N EC  E+   C    R  S  C
Sbjct:   11 PLCGSDGKNYWNKCHIERES-------SVSPCSRISCSHYG------RCVVRNNGKAHCVCPRQCQVR-FKPVCGTDGREYLNRCFLRRNACRTQTSIKVHKWGLCSKYIICECNTECPSEASPVCGQDGRTYSSTC 133          
BLAST of follistatin vs. Ensembl Nematostella
Match: EDO40386 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7E5])

HSP 1 Score: 56.9954 bits (136), Expect = 1.771e-8
Identity = 37/111 (33.33%), Postives = 55/111 (49.55%), Query Frame = 2
Query:  701 KSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKF-GCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVC 1030
            K + PVC + G+ Y+N+C+L +ESC  N    II   K   C    C+     C  + +  + C+    C    +DP+CG D VTY + CHL   +    + I+  Y GVC
Sbjct:  473 KEASPVCGSDGKTYENECKLRVESCKANQNVRIISRTKCNACTLSTCNLVYGTCSAS-SANASCICPTNCPSD-WDPVCGDDGVTYQNLCHLLREACTSGRIIRRLYRGVC 581          

HSP 2 Score: 55.4546 bits (132), Expect = 5.617e-8
Identity = 52/197 (26.40%), Postives = 95/197 (48.22%), Query Frame = 2
Query:  704 SSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFG----CERLNCHKRNKKCILTLNGQSKCVNKKICIGQL-YDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            S  PVC+ TG  +  KC + +E+C T S+  ++  A+ G    C R+ C K ++ C++ ++ + KC+        L  D +CG D  +Y + C ++  + R+ K + +A+ G C A   C   +  E    CI++  +G+  C     + R+ EN   +  + +C S        C+ D  +C+ +  I V + G C
Sbjct:  127 SMDPVCSTTGETFITKCHMEVEAC-TESRSMMV--ARRGECDPCSRVKC-KEDRHCVVDMDMKPKCICPSESECPLTVDTVCGTDKSSYLNECVMKARACRKEKSVTVAHRGFCGA---CSLAKPCEHRAKCISNT-DGTLTC-----TCRKEENCPGR-ADYVCGSDGNSYFTECHMDATACRESRDITVKHKGPC 309          

HSP 3 Score: 52.7582 bits (125), Expect = 3.309e-7
Identity = 48/201 (23.88%), Postives = 83/201 (41.29%), Query Frame = 2
Query:  713 PVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFG------------CERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            PVC   G+ Y N C L   +C   S   +    + G            C  L C   ++  ++    Q  C + + C   + DP+C     T+ ++CH+E  +  +++ + +A  G C     C  V+C+E D  C+    +  P CI CP+     E+    TV+ +C +      N C     +C+    + V + G C
Sbjct:   48 PVCGTDGKTYNNDCLLRATACHNGSNIQVAGLGQCGTAKFLGFSSLGPCASLRCKSPSRCQVIKGKPQCVCRDVRECPSSM-DPVCSTTGETFITKCHMEVEACTESRSMMVARRGECDP---CSRVKCKE-DRHCVVDM-DMKPKCI-CPS-----ESECPLTVDTVCGTDKSSYLNECVMKARACRKEKSVTVAHRGFC 236          
BLAST of follistatin vs. Ensembl Nematostella
Match: EDO42283 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1Y8])

HSP 1 Score: 52.7582 bits (125), Expect = 2.793e-7
Identity = 37/145 (25.52%), Postives = 62/145 (42.76%), Query Frame = 2
Query:  701 KSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTS 1135
            K   PVC + G+ Y N C   +  C  N Q  +         R  C  R  KC    N             ++Y P+CG DNVTYS+ C L  ++ +    I + + G C +  +C   +C+ + +  +  ++   P C++ P +
Sbjct:  236 KELNPVCGSDGKTYDNPCVFKIAVCQMNGQLRLK-------HRGACGSRPDKCAPICN-------------KMYQPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSSQSCEQKKCKGTKVCKMIGNK---PRCMRPPQT 357          

HSP 2 Score: 52.7582 bits (125), Expect = 2.818e-7
Identity = 53/207 (25.60%), Postives = 79/207 (38.16%), Query Frame = 2
Query:  713 PVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCI------------------KCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            PVC   G+ Y NKC L   +C +N     I  A  G     C  +  KC              IC  ++Y P+CG DNVTYS+ C L  ++ +    I + + G C +   CM    +E +  C +  +     C+                   C +S+R C     K +  +C S      N C      CQ N  + + + G C
Sbjct:   89 PVCGTDGKTYGNKCMLGAATCRSNG---TITLAYPG----ECKPKPDKCA------------PICP-KIYRPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSSPRCMRRCTKELNPVCGSDGKTYDNPCVFKIAVCQMRGELRLKHRGACGSSLR-CMRRCTKELNPVCGSDGKTYDNPCVFKIAVCQMNGQLRLKHRGAC 274          
BLAST of follistatin vs. Ensembl Nematostella
Match: EDO42282 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1Y7])

HSP 1 Score: 47.7506 bits (112), Expect = 1.172e-6
Identity = 33/106 (31.13%), Postives = 46/106 (43.40%), Query Frame = 2
Query:  713 PVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVC 1030
            PVC   G+ Y N+C L   +C +N     I  A  G     C  R  KC    N             ++Y P+CG DNVTYS+ C L  ++ +    I + + G C
Sbjct:   11 PVCGTDGKTYGNECMLGAATCHSNG---TITLAYPG----ECGSRPDKCAPICN-------------KMYQPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKC 96          
BLAST of follistatin vs. Ensembl Medaka
Match: fsta (follistatin [Source:NCBI gene;Acc:101167370])

HSP 1 Score: 67.0106 bits (162), Expect = 1.191e-11
Identity = 70/300 (23.33%), Postives = 118/300 (39.33%), Query Frame = 2
Query:  413 LKIGACFLEKSTRGCSE--FIGYMNRNKCCHYNGF---FVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNII---PCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDP---ICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            ++ G C+L++   G  +  ++  M++ +CC        +  E           +     PNC     K+ C +  C  G+ C M                    GPVC   G+ YK++C L    C  +   ++     C K  C  + C   +  C++     + CV       +   P   +CG D + Y+S CHL +++    K I +AY G C    +C +++C      C+   R G   C  C  S ++      +T E +C S N    + C     +C   V +EV +SG C
Sbjct:   29 VQAGNCWLQQGRNGRCQVLYMQGMSKEECCRSGRLGTSWTEEDVPNSTLFKWIIFNGGAPNCIPC--KESCDNVDCGPGKRCKMNRRSKPRCVCAPDCSNITWKGPVCGFDGKTYKDECALLKAKCRGHPDLDVQYQGKCKKT-CRDVLC-PGSSTCVVDQTNNAYCVMCNRLCPEATSPEQYLCGNDGIIYASACHLRKATCLLGKSIGVAYEGKCIKAKSCEDIQC-SGGKKCLWDSRMGRGRCSLCDESCQE-----SRTDESVCASDNTTYPSECAMKQAACSKGVLLEVKHSGPC 318          
BLAST of follistatin vs. Ensembl Medaka
Match: agrn (agrin [Source:NCBI gene;Acc:101156494])

HSP 1 Score: 56.225 bits (134), Expect = 1.006e-7
Identity = 51/197 (25.89%), Postives = 86/197 (43.65%), Query Frame = 2
Query:  713 PVCTATGRRYKNKCELHLESCWTNSQQNII---PCA-KFGCERLNCHKRNKKCILTLNG-QSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRA--DA-NCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            PVC +    Y N+CE+    C    +  ++   PC+ K  C  + C      C+ + +G  +KC+    C G+  + +CG D   Y S C L + + +  K I++ + G C    DA N +NV C+   +T         P+    P S   C  G     + LC S  +   N C+      Q  + ++ +++GQC
Sbjct:  105 PVCGSDSSTYSNECEMERAQCKAQRRIKVLRRGPCSLKDPCAEVTC-SYGSTCVQSSDGLAAKCMCPLGCDGKAGETVCGSDGNDYPSECELHQHACKNQKNIRVQHLGPCDPCKDAENSLNVLCRVEALT-------RRPLLYSPPES---CPPGD----DPLCASDGHTYPNECHMTATGVQKGIKLQKIHAGQC 286          

HSP 2 Score: 54.6842 bits (130), Expect = 3.263e-7
Identity = 37/118 (31.36%), Postives = 56/118 (47.46%), Query Frame = 2
Query:  701 KSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTL-NGQSKCVNKK----ICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRAD 1039
            KS  PVC + G  Y ++CELH+++C   +   ++  ++  C         K C  T+    + CV  K     C+G+   P+CG D  TY + C L  SS  Q K+I +   G C  D
Sbjct:  460 KSRQPVCGSDGNTYDSECELHVKACTQQTDLQVV--SQGAC---------KTCGPTVCAWGALCVQNKCECQQCVGEALSPLCGSDGKTYDNECELRRSSCLQNKKIDVEKDGSCDED 566          

HSP 3 Score: 54.299 bits (129), Expect = 4.107e-7
Identity = 57/239 (23.85%), Postives = 93/239 (38.91%), Query Frame = 2
Query:  599 KDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQ---QNIIPCA--KFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWP 1300
            KD CA+  C  G  C+   +       C    + K+   VC + G  Y ++CELH  +C        Q++ PC   K     LN   R    +  L  +    +         DP+C  D  TY + CH+  + +++  ++Q  ++G CR    C + EC   +  C+       P   +C     +C++    T + LC        N C +    C+    I +   G C LN   P
Sbjct:  142 KDPCAEVTCSYGSTCVQSSDGLAAKCMCPLGCDGKAGETVCGSDGNDYPSECELHQHACKNQKNIRVQHLGPCDPCKDAENSLNVLCR----VEALTRRPLLYSPPESCPPGDDPLCASDGHTYPNECHMTATGVQKGIKLQKIHAGQCRRLDECQD-ECL-FNAVCVVE-----PEGPRCSCDPLECDD----TYKPLCGRNGRTYTNDCLRRKAECEMKTLISIRSQGPCDLNTPSP 365          
BLAST of follistatin vs. Ensembl Medaka
Match: agrn (agrin [Source:NCBI gene;Acc:101156494])

HSP 1 Score: 56.225 bits (134), Expect = 1.007e-7
Identity = 51/197 (25.89%), Postives = 86/197 (43.65%), Query Frame = 2
Query:  713 PVCTATGRRYKNKCELHLESCWTNSQQNII---PCA-KFGCERLNCHKRNKKCILTLNG-QSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRA--DA-NCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            PVC +    Y N+CE+    C    +  ++   PC+ K  C  + C      C+ + +G  +KC+    C G+  + +CG D   Y S C L + + +  K I++ + G C    DA N +NV C+   +T         P+    P S   C  G     + LC S  +   N C+      Q  + ++ +++GQC
Sbjct:  105 PVCGSDSSTYSNECEMERAQCKAQRRIKVLRRGPCSLKDPCAEVTC-SYGSTCVQSSDGLAAKCMCPLGCDGKAGETVCGSDGNDYPSECELHQHACKNQKNIRVQHLGPCDPCKDAENSLNVLCRVEALT-------RRPLLYSPPES---CPPGD----DPLCASDGHTYPNECHMTATGVQKGIKLQKIHAGQC 286          

HSP 2 Score: 54.6842 bits (130), Expect = 3.584e-7
Identity = 37/118 (31.36%), Postives = 56/118 (47.46%), Query Frame = 2
Query:  701 KSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTL-NGQSKCVNKK----ICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRAD 1039
            KS  PVC + G  Y ++CELH+++C   +   ++  ++  C         K C  T+    + CV  K     C+G+   P+CG D  TY + C L  SS  Q K+I +   G C  D
Sbjct:  460 KSRQPVCGSDGNTYDSECELHVKACTQQTDLQVV--SQGAC---------KTCGPTVCAWGALCVQNKCECQQCVGEALSPLCGSDGKTYDNECELRRSSCLQNKKIDVEKDGSCDED 566          

HSP 3 Score: 53.9138 bits (128), Expect = 6.027e-7
Identity = 57/239 (23.85%), Postives = 93/239 (38.91%), Query Frame = 2
Query:  599 KDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQ---QNIIPCA--KFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWP 1300
            KD CA+  C  G  C+   +       C    + K+   VC + G  Y ++CELH  +C        Q++ PC   K     LN   R    +  L  +    +         DP+C  D  TY + CH+  + +++  ++Q  ++G CR    C + EC   +  C+       P   +C     +C++    T + LC        N C +    C+    I +   G C LN   P
Sbjct:  142 KDPCAEVTCSYGSTCVQSSDGLAAKCMCPLGCDGKAGETVCGSDGNDYPSECELHQHACKNQKNIRVQHLGPCDPCKDAENSLNVLCR----VEALTRRPLLYSPPESCPPGDDPLCASDGHTYPNECHMTATGVQKGIKLQKIHAGQCRRLDECQD-ECL-FNAVCVVE-----PEGPRCSCDPLECDD----TYKPLCGRNGRTYTNDCLRRKAECEMKTLISIRSQGPCDLNTPSP 365          
BLAST of follistatin vs. Ensembl Medaka
Match: agrn (agrin [Source:NCBI gene;Acc:101156494])

HSP 1 Score: 56.225 bits (134), Expect = 1.100e-7
Identity = 51/197 (25.89%), Postives = 86/197 (43.65%), Query Frame = 2
Query:  713 PVCTATGRRYKNKCELHLESCWTNSQQNII---PCA-KFGCERLNCHKRNKKCILTLNG-QSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRA--DA-NCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQC 1279
            PVC +    Y N+CE+    C    +  ++   PC+ K  C  + C      C+ + +G  +KC+    C G+  + +CG D   Y S C L + + +  K I++ + G C    DA N +NV C+   +T         P+    P S   C  G     + LC S  +   N C+      Q  + ++ +++GQC
Sbjct:   34 PVCGSDSSTYSNECEMERAQCKAQRRIKVLRRGPCSLKDPCAEVTC-SYGSTCVQSSDGLAAKCMCPLGCDGKAGETVCGSDGNDYPSECELHQHACKNQKNIRVQHLGPCDPCKDAENSLNVLCRVEALT-------RRPLLYSPPES---CPPGD----DPLCASDGHTYPNECHMTATGVQKGIKLQKIHAGQC 215          

HSP 2 Score: 54.299 bits (129), Expect = 3.658e-7
Identity = 37/118 (31.36%), Postives = 56/118 (47.46%), Query Frame = 2
Query:  701 KSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTL-NGQSKCVNKK----ICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRAD 1039
            KS  PVC + G  Y ++CELH+++C   +   ++  ++  C         K C  T+    + CV  K     C+G+   P+CG D  TY + C L  SS  Q K+I +   G C  D
Sbjct:  389 KSRQPVCGSDGNTYDSECELHVKACTQQTDLQVV--SQGAC---------KTCGPTVCAWGALCVQNKCECQQCVGEALSPLCGSDGKTYDNECELRRSSCLQNKKIDVEKDGSCDED 495          

HSP 3 Score: 53.5286 bits (127), Expect = 6.757e-7
Identity = 57/239 (23.85%), Postives = 93/239 (38.91%), Query Frame = 2
Query:  599 KDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQ---QNIIPCA--KFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWP 1300
            KD CA+  C  G  C+   +       C    + K+   VC + G  Y ++CELH  +C        Q++ PC   K     LN   R    +  L  +    +         DP+C  D  TY + CH+  + +++  ++Q  ++G CR    C + EC   +  C+       P   +C     +C++    T + LC        N C +    C+    I +   G C LN   P
Sbjct:   71 KDPCAEVTCSYGSTCVQSSDGLAAKCMCPLGCDGKAGETVCGSDGNDYPSECELHQHACKNQKNIRVQHLGPCDPCKDAENSLNVLCR----VEALTRRPLLYSPPESCPPGDDPLCASDGHTYPNECHMTATGVQKGIKLQKIHAGQCRRLDECQD-ECL-FNAVCVVE-----PEGPRCSCDPLECDD----TYKPLCGRNGRTYTNDCLRRKAECEMKTLISIRSQGPCDLNTPSP 294          
BLAST of follistatin vs. Planmine SMEST
Match: SMESG000013298.1 (SMESG000013298.1)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 323/323 (100.00%), Postives = 323/323 (100.00%), Query Frame = 2
Query:  335 MKMFITXXXXXXXXXCNLASSTTIGSLKIGACFLEKSTRGCSEFIGYMNRNKCCHYNGFFVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWPR 1303
            MKMFITLSLLLLSVVCNLASSTTIGSLKIGACFLEKSTRGCSEFIGYMNRNKCCHYNGFFVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRDEDSICSSECICSEEQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWPR
Sbjct:    1 MKMFITLSLLLLSVVCNLASSTTIGSLKIGACFLEKSTRGCSEFIGYMNRNKCCHYNGFFVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRDEDSICSSECICSEEQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWPR 323          
BLAST of follistatin vs. Planmine SMEST
Match: SMESG000013298.1 (SMESG000013298.1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 321/321 (100.00%), Postives = 321/321 (100.00%), Query Frame = 2
Query:  341 MFITXXXXXXXXXCNLASSTTIGSLKIGACFLEKSTRGCSEFIGYMNRNKCCHYNGFFVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWPR 1303
            MFITLSLLLLSVVCNLASSTTIGSLKIGACFLEKSTRGCSEFIGYMNRNKCCHYNGFFVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRDEDSICSSECICSEEQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWPR
Sbjct:    1 MFITLSLLLLSVVCNLASSTTIGSLKIGACFLEKSTRGCSEFIGYMNRNKCCHYNGFFVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVGEFCIMRDEDSICSSECICSEEQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTCITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLSCQNNVFIEVLYSGQCLLNAKWPR 321          
BLAST of follistatin vs. Planmine SMEST
Match: SMESG000028859.1 (SMESG000028859.1)

HSP 1 Score: 58.9214 bits (141), Expect = 4.734e-9
Identity = 37/120 (30.83%), Postives = 58/120 (48.33%), Query Frame = 2
Query:  716 VCTATGRRYKNKCELHLESCWTNSQQNII---PC--AKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVE 1060
            +C ++G+ Y N C L+L+ C T     I+   PC      C  + C    + C +  NG+S C   K    ++  P+CG D VTY S C+L  ++    K + I Y+G+C  +  C   E
Sbjct:  144 LCGSSGKTYDNLCLLNLDKCQTGQHIYIVNKGPCQFENNPCNGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQE 263          
BLAST of follistatin vs. Planmine SMEST
Match: SMESG000028865.1 (SMESG000028865.1)

HSP 1 Score: 59.3066 bits (142), Expect = 8.088e-9
Identity = 45/159 (28.30%), Postives = 67/159 (42.14%), Query Frame = 2
Query:  581 CESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIP---CAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANC 1048
            C++    D C++  C  G  CI         S      +     PVC   G  Y NKC L   SC    + ++I    C    C  + C    + C +  NG+S C   K    ++  P+CG D VTY S C+L  ++    K + I Y+G+C  +  C
Sbjct:  379 CQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRC 537          
BLAST of follistatin vs. Planmine SMEST
Match: SMESG000028865.1 (SMESG000028865.1)

HSP 1 Score: 59.3066 bits (142), Expect = 8.824e-9
Identity = 45/159 (28.30%), Postives = 67/159 (42.14%), Query Frame = 2
Query:  581 CESSCSKDFCADKICPVGEFCIMRXXXXXXXXXXXXXXXQKSSGPVCTATGRRYKNKCELHLESCWTNSQQNIIP---CAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPICGVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANC 1048
            C++    D C++  C  G  CI         S      +     PVC   G  Y NKC L   SC    + ++I    C    C  + C    + C +  NG+S C   K    ++  P+CG D VTY S C+L  ++    K + I Y+G+C  +  C
Sbjct:  379 CQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRC 537          
The following BLAST results are available for this feature:
BLAST of follistatin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FST8.244e-1023.93follistatin [Source:HGNC Symbol;Acc:HGNC:3971][more]
FST1.350e-923.67follistatin [Source:HGNC Symbol;Acc:HGNC:3971][more]
FST9.828e-927.69follistatin [Source:HGNC Symbol;Acc:HGNC:3971][more]
AGRN1.528e-827.04agrin [Source:HGNC Symbol;Acc:HGNC:329][more]
AGRN1.997e-827.04agrin [Source:HGNC Symbol;Acc:HGNC:329][more]
back to top
BLAST of follistatin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
agr-19.587e-729.81AGRin (Synaptic protein) homolog; AGRin (Synaptic ... [more]
back to top
BLAST of follistatin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Fs2.020e-727.31gene:FBgn0259878 transcript:FBtr0339996[more]
Fs2.056e-727.31gene:FBgn0259878 transcript:FBtr0087398[more]
CG323545.297e-627.81gene:FBgn0052354 transcript:FBtr0076662[more]
back to top
BLAST of follistatin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fstb7.905e-1223.67follistatin b [Source:ZFIN;Acc:ZDB-GENE-031118-139... [more]
fstb1.255e-1123.67follistatin b [Source:ZFIN;Acc:ZDB-GENE-031118-139... [more]
fstb1.255e-1123.67follistatin b [Source:ZFIN;Acc:ZDB-GENE-031118-139... [more]
fsta1.959e-1022.59follistatin a [Source:NCBI gene;Acc:100004116][more]
fsta1.959e-1022.59follistatin a [Source:NCBI gene;Acc:100004116][more]
back to top
BLAST of follistatin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clcn61.922e-826.00chloride channel, voltage-sensitive 6 [Source:Xenb... [more]
clcn62.791e-826.02chloride channel, voltage-sensitive 6 [Source:Xenb... [more]
clcn63.092e-826.02chloride channel, voltage-sensitive 6 [Source:Xenb... [more]
clcn63.912e-826.02chloride channel, voltage-sensitive 6 [Source:Xenb... [more]
clcn64.955e-826.02chloride channel, voltage-sensitive 6 [Source:Xenb... [more]
back to top
BLAST of follistatin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fst7.357e-1023.93follistatin [Source:MGI Symbol;Acc:MGI:95586][more]
Fst7.609e-1023.93follistatin [Source:MGI Symbol;Acc:MGI:95586][more]
Agrn3.001e-934.23agrin [Source:MGI Symbol;Acc:MGI:87961][more]
Agrn3.965e-926.15agrin [Source:MGI Symbol;Acc:MGI:87961][more]
Agrn4.797e-926.15agrin [Source:MGI Symbol;Acc:MGI:87961][more]
back to top
BLAST of follistatin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O62650|FST_HORSE4.078e-1024.25Follistatin OS=Equus caballus OX=9796 GN=FST PE=2 ... [more]
sp|Q9YHV4|FSTA_DANRE1.479e-922.59Follistatin-A OS=Danio rerio OX=7955 GN=fsta PE=2 ... [more]
sp|P21674|FST_RAT3.369e-923.92Follistatin OS=Rattus norvegicus OX=10116 GN=Fst P... [more]
sp|P10669|FST_PIG4.254e-923.59Follistatin OS=Sus scrofa OX=9823 GN=FST PE=1 SV=1[more]
sp|P47931|FST_MOUSE5.323e-923.93Follistatin OS=Mus musculus OX=10090 GN=Fst PE=2 S... [more]
back to top
BLAST of follistatin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI690.000e+0100.00Follistatin OS=Schmidtea mediterranea OX=79327 PE=... [more]
T1DF951.379e-10252.44Follistatin OS=Dendrocoelum lacteum OX=27895 PE=2 ... [more]
A0A5K3FSG74.419e-2228.25Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068WUV76.064e-2229.77Follistatin OS=Echinococcus granulosus OX=6210 GN=... [more]
A0A068XT735.078e-2129.66Follistatin OS=Echinococcus multilocularis OX=6211... [more]
back to top
BLAST of follistatin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fstb1.634e-1324.41follistatin-A-like [Source:NCBI gene;Acc:103035751... [more]
fstb1.808e-1324.41follistatin-A-like [Source:NCBI gene;Acc:103035751... [more]
fsta5.519e-1223.59follistatin [Source:NCBI gene;Acc:103024347][more]
fsta7.709e-1223.26follistatin [Source:NCBI gene;Acc:103024347][more]
agrn2.082e-724.47agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033][more]
back to top
BLAST of follistatin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
FST1.265e-1228.50follistatin [Source:HGNC Symbol;Acc:HGNC:3971][more]
ENSPMAT00000001644.14.037e-725.21pep scaffold:Pmarinus_7.0:GL489999:4503:6705:-1 ge... [more]
back to top
BLAST of follistatin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of follistatin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO302303.345e-927.47Follistatin-like protein; Predicted protein [Sour... [more]
EDO403851.247e-828.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403861.771e-833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422832.793e-725.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422821.172e-631.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of follistatin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fsta1.191e-1123.33follistatin [Source:NCBI gene;Acc:101167370][more]
agrn1.006e-725.89agrin [Source:NCBI gene;Acc:101156494][more]
agrn1.007e-725.89agrin [Source:NCBI gene;Acc:101156494][more]
agrn1.100e-725.89agrin [Source:NCBI gene;Acc:101156494][more]
back to top
BLAST of follistatin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013298.10.000e+0100.00SMESG000013298.1[more]
SMESG000013298.10.000e+0100.00SMESG000013298.1[more]
SMESG000028859.14.734e-930.83SMESG000028859.1[more]
SMESG000028865.18.088e-928.30SMESG000028865.1[more]
SMESG000028865.18.824e-928.30SMESG000028865.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035357
GenBankAFJ24723.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035357 ID=SMED30035357|Name=follistatin|organism=Schmidtea mediterranea sexual|type=transcript|length=1887bp
AATTATTTTAAAAAAAAATTTTTTACAACTGTACATTTAATAAATAAAAA
GTAATTTATAATATTTAATTGATTGGAAAAGTAAATTTTATTGTTTCGAT
TACCAAAGGAAATAATATCTGTATAATTGCAATGATCAGTGGTGAGTCGG
TATTAATTATATTTCATTTAATCATTAAAATAATAAAAATTGATATCTTG
GGGAAATGTGTGTGGAAAAATCTGTCCAATGAAATTCAGCTAAGATTTTG
AATGGCGATTTCAGCGAGAATATTTTATTCCAAAACCTATATAAATAGAA
TTGAATTAGATTGTCTATTATTAAAAAAACTTGAATGAAAATGTTTATCA
CTTTATCACTTTTGCTTTTGTCAGTGGTGTGCAATTTAGCGAGTTCTACG
ACAATTGGCAGTTTAAAAATTGGAGCGTGTTTTTTAGAGAAATCCACAAG
AGGCTGCAGTGAATTTATTGGATATATGAATCGAAACAAGTGTTGTCATT
ATAACGGATTTTTTGTCAGAGAACCAAATGCCGGCCAATTATTTCTGGCA
GCATTTTTGAAAAAACACATTATTCCCAATTGTGAAAGTTCGTGTAGCAA
AGATTTCTGTGCTGACAAAATATGTCCGGTCGGAGAGTTTTGTATAATGC
GAGACGAAGACAGTATCTGTTCTTCTGAATGCATTTGTTCGGAGGAGCAA
AAATCAAGCGGACCAGTGTGCACCGCAACTGGTCGACGCTACAAAAATAA
ATGCGAGCTTCATTTGGAATCGTGTTGGACCAATTCTCAGCAAAACATTA
TTCCATGCGCAAAATTCGGATGCGAACGACTTAATTGTCACAAAAGAAAC
AAAAAATGCATTTTGACTTTAAATGGGCAGAGTAAATGTGTAAATAAAAA
AATTTGCATTGGACAATTGTATGACCCGATTTGTGGAGTTGATAATGTCA
CGTATTCAAGTCGATGTCATTTAGAGGAATCTAGCATTCGCCAGGCGAAA
GAAATCCAGATTGCCTATAGTGGAGTTTGCAGAGCTGACGCAAATTGTAT
GAATGTCGAATGTCAAGAAAGTGACATGACGTGCATTACTCACCACAGAA
ATGGATCACCAGTTTGTATCAAATGCCCCACCTCAATGCGCCAATGTGAG
AATGGCATTTATAAAACTGTGGAATTGTTGTGCTTGTCAACGAATTACGA
AACCAAGAATACCTGCTATAAAGATTTTTTATCCTGTCAAAATAATGTTT
TTATTGAAGTTCTTTATTCTGGACAATGCCTTCTCAATGCAAAATGGCCT
CGTTGAATTGTGCAGATCATTGATTTTATATATAATAACAATATTTAATC
TATCAATTTTTGGATTTTTCTAACACAAAATGAGTGGCATAATTATTATT
TAATTAATGTGTAAAGTATATTTACGGAATAGCTGTACTTCAATTGATAG
AACGCATTTATAAATATTATTATTACCATTATTATTATTATTACTATTTC
TTCGAGTCACTGATTTTGTACAAATAAGATTACTTTTGTAAAACAATATT
TCTTATTATTAATTTGTGCTTTTTTTGGTTTATAGTTGTTATGTTGTGTA
TTGGAAATCATCTCACAGAAACCGAATTTATTCGTATTTTTACATGTTGA
ATAGACTATTTATTTGAGTTCTTTTTTGTTGTTGTAAAGATCAGTCTGAT
CACGTGATAAATGTCCGTTTTGTTGATTTACTTGTCAAATGTCAAATAAA
TTTACAGAGTCATATTTTATCGTATATTTATTCTCTGCGATCTCTATATT
TAACATTCACTATCAAAGCGATTGCTAATTTTGTTGCATAAAAATGTTTA
TTTCAGTGTCAATATAGTTTGTTTGTTATTTTTTAGG
back to top

protein sequence of SMED30035357-orf-1

>SMED30035357-orf-1 ID=SMED30035357-orf-1|Name=SMED30035357-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=324bp
MKMFITLSLLLLSVVCNLASSTTIGSLKIGACFLEKSTRGCSEFIGYMNR
NKCCHYNGFFVREPNAGQLFLAAFLKKHIIPNCESSCSKDFCADKICPVG
EFCIMRDEDSICSSECICSEEQKSSGPVCTATGRRYKNKCELHLESCWTN
SQQNIIPCAKFGCERLNCHKRNKKCILTLNGQSKCVNKKICIGQLYDPIC
GVDNVTYSSRCHLEESSIRQAKEIQIAYSGVCRADANCMNVECQESDMTC
ITHHRNGSPVCIKCPTSMRQCENGIYKTVELLCLSTNYETKNTCYKDFLS
CQNNVFIEVLYSGQCLLNAKWPR*
back to top
Aliases
The feature 'follistatin' has the following synonyms
Synonym
follistatin
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0043236laminin binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0007213G-protein coupled acetylcholine receptor signaling pathway
GO:0043113receptor clustering
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003109anterior pole cell
PLANA:0007524anterior pole
Vocabulary: INTERPRO
TermDefinition
IPR036058Kazal_dom_sf
IPR002350Kazal_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002350Kazal domainSMARTSM00280kazal_3coord: 190..232
e-value: 4.4E-9
score: 46.2
coord: 115..163
e-value: 2.1
score: 0.0
IPR002350Kazal domainPFAMPF07648Kazal_2coord: 189..232
e-value: 2.4E-9
score: 37.2
coord: 113..154
e-value: 0.0062
score: 16.6
IPR002350Kazal domainPROSITEPS51465KAZAL_2coord: 179..234
score: 9.128
IPR002350Kazal domainPROSITEPS51465KAZAL_2coord: 106..160
score: 8.121
NoneNo IPR availableGENE3DG3DSA:3.30.60.30coord: 87..162
e-value: 2.4E-8
score: 36.3
NoneNo IPR availableGENE3DG3DSA:3.30.60.30coord: 163..232
e-value: 6.2E-14
score: 54.2
NoneNo IPR availablePANTHERPTHR10913FOLLISTATIN-RELATEDcoord: 82..315
NoneNo IPR availablePANTHERPTHR10913:SF64FOLLISTATIN, ISOFORM Acoord: 82..315
NoneNo IPR availableCDDcd17336MFS_SLCO_OATPcoord: 155..286
e-value: 4.01991E-4
score: 39.5298
NoneNo IPR availableCDDcd00104KAZAL_FScoord: 196..232
e-value: 2.86754E-6
score: 41.4866
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.836
IPR036058Kazal domain superfamilySUPERFAMILYSSF100895Kazal-type serine protease inhibitorscoord: 96..152
IPR036058Kazal domain superfamilySUPERFAMILYSSF100895Kazal-type serine protease inhibitorscoord: 175..232