C-jun-amino-terminal kinase-interacting protein, putative

Overview
NameC-jun-amino-terminal kinase-interacting protein, putative
Smed IDSMED30035356
Length (bp)4542
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C-jun-amino-terminal kinase-interacting protein, putative (SMED30035356) t-SNE clustered cells

Violin plots show distribution of expression levels for C-jun-amino-terminal kinase-interacting protein, putative (SMED30035356) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C-jun-amino-terminal kinase-interacting protein, putative (SMED30035356) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C-jun-amino-terminal kinase-interacting protein, putative (SMED30035356) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035356

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30035356SMESG000060963.1 dd_Smed_v4_3798_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035356SMESG000060963.1 dd_Smed_v6_3798_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035356SMESG000060963.1 dd_Smed_v4_3798_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Human
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 251.136 bits (640), Expect = 5.234e-67
Identity = 149/404 (36.88%), Postives = 228/404 (56.44%), Query Frame = 2
Query: 3329 TNQYVDDQFKSPNTNTFVSNSSQ------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPF--------VKDSRKENELDIVNDFNDVSYSMENSYLP-TFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETP---------------PNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            ++ Y D     PN    V   +Q      PT+W+G +NG L+VH +      CLH I+L DSI++I++    V V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+W+GT  G+I+S P         V  +R  + + +  D N       +   P TFIP+ +  + QL +HGHRD+VKFFV     VP  + +P               P+ +      P K+  L++SGGEGY DFR  +E   S      LP    +   +    SHLIVWQ++  N+
Sbjct:  927 SDAYKDQISVLPNEQDLVREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVIRVYGDENS------DKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVA----VPGQVISPQSSSSGTDLTGDKAGPSAQEPGSQTPLKS-MLVISGGEGYIDFRMGDEGGESELLGEDLP---LEPSVTKAERSHLIVWQVMYGNE 1307          

HSP 2 Score: 139.428 bits (350), Expect = 2.212e-32
Identity = 76/180 (42.22%), Postives = 113/180 (62.78%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHH 674
            + +G +Y   E   S  V+S+ V  LA  IY+EFE LI  Y E VVK LMP+VV+ LE LD V+++    +VE ELL++D+ QL+TQYEREK  RK  EE   + EDS  +  K  +  ++ L+S  + +E++ KN  DQISR E+RE E + EY+ L  R+ E++  + + +E++K H 
Sbjct:    3 LEDGVVYQE-EPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQ 181          

HSP 3 Score: 119.398 bits (298), Expect = 2.877e-26
Identity = 65/141 (46.10%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+EN+I EN  L+ TKNALNIVK+DLI+K+DE   E ++LQ E  ++   K   + +   LE E +  + E      +AKDD + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  382 DVDEGADLL-------GMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 515          

HSP 4 Score: 95.5153 bits (236), Expect = 6.491e-19
Identity = 58/178 (32.58%), Postives = 91/178 (51.12%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVE-------DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K        +K  ++P+P+Y RPL E  + +KL       CAV +N+         + VG+S+FY      +   SK         D ++ E    Q  + NQ       E+S S VWICTS+ + ++++++DA +P   LD+F + +S + C+ SVPGA + DY
Sbjct:  628 RVQAFGWSLPQKYKQVTNGQGENKMKNLPVPVYLRPLDEKDTSMKLW------CAVGVNLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQ------EELS-SLVWICTSTHSATKVLIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDY 792          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Human
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 251.136 bits (640), Expect = 5.314e-67
Identity = 149/404 (36.88%), Postives = 228/404 (56.44%), Query Frame = 2
Query: 3329 TNQYVDDQFKSPNTNTFVSNSSQ------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPF--------VKDSRKENELDIVNDFNDVSYSMENSYLP-TFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETP---------------PNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            ++ Y D     PN    V   +Q      PT+W+G +NG L+VH +      CLH I+L DSI++I++    V V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+W+GT  G+I+S P         V  +R  + + +  D N       +   P TFIP+ +  + QL +HGHRD+VKFFV     VP  + +P               P+ +      P K+  L++SGGEGY DFR  +E   S      LP    +   +    SHLIVWQ++  N+
Sbjct:  931 SDAYKDQISVLPNEQDLVREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVIRVYGDENS------DKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVA----VPGQVISPQSSSSGTDLTGDKAGPSAQEPGSQTPLKS-MLVISGGEGYIDFRMGDEGGESELLGEDLP---LEPSVTKAERSHLIVWQVMYGNE 1311          

HSP 2 Score: 139.428 bits (350), Expect = 2.144e-32
Identity = 76/180 (42.22%), Postives = 113/180 (62.78%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHH 674
            + +G +Y   E   S  V+S+ V  LA  IY+EFE LI  Y E VVK LMP+VV+ LE LD V+++    +VE ELL++D+ QL+TQYEREK  RK  EE   + EDS  +  K  +  ++ L+S  + +E++ KN  DQISR E+RE E + EY+ L  R+ E++  + + +E++K H 
Sbjct:    3 LEDGVVYQE-EPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQ 181          

HSP 3 Score: 119.398 bits (298), Expect = 2.908e-26
Identity = 65/141 (46.10%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+EN+I EN  L+ TKNALNIVK+DLI+K+DE   E ++LQ E  ++   K   + +   LE E +  + E      +AKDD + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  382 DVDEGADLL-------GMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 515          

HSP 4 Score: 95.5153 bits (236), Expect = 6.179e-19
Identity = 58/178 (32.58%), Postives = 91/178 (51.12%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVE-------DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K        +K  ++P+P+Y RPL E  + +KL       CAV +N+         + VG+S+FY      +   SK         D ++ E    Q  + NQ       E+S S VWICTS+ + ++++++DA +P   LD+F + +S + C+ SVPGA + DY
Sbjct:  632 RVQAFGWSLPQKYKQVTNGQGENKMKNLPVPVYLRPLDEKDTSMKLW------CAVGVNLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQ------EELS-SLVWICTSTHSATKVLIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDY 796          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Human
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 251.136 bits (640), Expect = 5.333e-67
Identity = 149/404 (36.88%), Postives = 228/404 (56.44%), Query Frame = 2
Query: 3329 TNQYVDDQFKSPNTNTFVSNSSQ------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPF--------VKDSRKENELDIVNDFNDVSYSMENSYLP-TFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETP---------------PNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            ++ Y D     PN    V   +Q      PT+W+G +NG L+VH +      CLH I+L DSI++I++    V V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+W+GT  G+I+S P         V  +R  + + +  D N       +   P TFIP+ +  + QL +HGHRD+VKFFV     VP  + +P               P+ +      P K+  L++SGGEGY DFR  +E   S      LP    +   +    SHLIVWQ++  N+
Sbjct:  932 SDAYKDQISVLPNEQDLVREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVIRVYGDENS------DKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVA----VPGQVISPQSSSSGTDLTGDKAGPSAQEPGSQTPLKS-MLVISGGEGYIDFRMGDEGGESELLGEDLP---LEPSVTKAERSHLIVWQVMYGNE 1312          

HSP 2 Score: 139.428 bits (350), Expect = 2.220e-32
Identity = 76/180 (42.22%), Postives = 113/180 (62.78%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHH 674
            + +G +Y   E   S  V+S+ V  LA  IY+EFE LI  Y E VVK LMP+VV+ LE LD V+++    +VE ELL++D+ QL+TQYEREK  RK  EE   + EDS  +  K  +  ++ L+S  + +E++ KN  DQISR E+RE E + EY+ L  R+ E++  + + +E++K H 
Sbjct:    3 LEDGVVYQE-EPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQ 181          

HSP 3 Score: 119.398 bits (298), Expect = 2.885e-26
Identity = 65/141 (46.10%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+EN+I EN  L+ TKNALNIVK+DLI+K+DE   E ++LQ E  ++   K   + +   LE E +  + E      +AKDD + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  382 DVDEGADLL-------GMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 515          

HSP 4 Score: 95.5153 bits (236), Expect = 6.503e-19
Identity = 58/178 (32.58%), Postives = 91/178 (51.12%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVE-------DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K        +K  ++P+P+Y RPL E  + +KL       CAV +N+         + VG+S+FY      +   SK         D ++ E    Q  + NQ       E+S S VWICTS+ + ++++++DA +P   LD+F + +S + C+ SVPGA + DY
Sbjct:  633 RVQAFGWSLPQKYKQVTNGQGENKMKNLPVPVYLRPLDEKDTSMKLW------CAVGVNLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQ------EELS-SLVWICTSTHSATKVLIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDY 797          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Human
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 251.136 bits (640), Expect = 5.464e-67
Identity = 149/404 (36.88%), Postives = 228/404 (56.44%), Query Frame = 2
Query: 3329 TNQYVDDQFKSPNTNTFVSNSSQ------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPF--------VKDSRKENELDIVNDFNDVSYSMENSYLP-TFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETP---------------PNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            ++ Y D     PN    V   +Q      PT+W+G +NG L+VH +      CLH I+L DSI++I++    V V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+W+GT  G+I+S P         V  +R  + + +  D N       +   P TFIP+ +  + QL +HGHRD+VKFFV     VP  + +P               P+ +      P K+  L++SGGEGY DFR  +E   S      LP    +   +    SHLIVWQ++  N+
Sbjct:  941 SDAYKDQISVLPNEQDLVREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVIRVYGDENS------DKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVA----VPGQVISPQSSSSGTDLTGDKAGPSAQEPGSQTPLKS-MLVISGGEGYIDFRMGDEGGESELLGEDLP---LEPSVTKAERSHLIVWQVMYGNE 1321          

HSP 2 Score: 139.428 bits (350), Expect = 2.350e-32
Identity = 76/180 (42.22%), Postives = 113/180 (62.78%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHH 674
            + +G +Y   E   S  V+S+ V  LA  IY+EFE LI  Y E VVK LMP+VV+ LE LD V+++    +VE ELL++D+ QL+TQYEREK  RK  EE   + EDS  +  K  +  ++ L+S  + +E++ KN  DQISR E+RE E + EY+ L  R+ E++  + + +E++K H 
Sbjct:    3 LEDGVVYQE-EPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQ 181          

HSP 3 Score: 119.398 bits (298), Expect = 2.873e-26
Identity = 65/141 (46.10%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+EN+I EN  L+ TKNALNIVK+DLI+K+DE   E ++LQ E  ++   K   + +   LE E +  + E      +AKDD + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  396 DVDEGADLL-------GMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 529          

HSP 4 Score: 95.5153 bits (236), Expect = 6.863e-19
Identity = 58/178 (32.58%), Postives = 91/178 (51.12%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVE-------DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K        +K  ++P+P+Y RPL E  + +KL       CAV +N+         + VG+S+FY      +   SK         D ++ E    Q  + NQ       E+S S VWICTS+ + ++++++DA +P   LD+F + +S + C+ SVPGA + DY
Sbjct:  642 RVQAFGWSLPQKYKQVTNGQGENKMKNLPVPVYLRPLDEKDTSMKLW------CAVGVNLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQ------EELS-SLVWICTSTHSATKVLIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDY 806          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Human
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 247.669 bits (631), Expect = 4.180e-66
Identity = 152/411 (36.98%), Postives = 229/411 (55.72%), Query Frame = 2
Query: 3329 TNQYVDDQFKSPNTNTFVSNSSQ------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKD---------SRKENELDIVNDFNDVS----YSMENS--YLP-TFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETP---------------PNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            ++ Y D     PN    V   +Q      PT+W+G +NG L+VH +      CLH I+L DSI++I++    V V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+W+GT  G+I+S P  +            + N+   V      S    Y  ENS    P TFIP+ +  + QL +HGHRD+VKFFV     VP  + +P               P+ +      P K+  L++SGGEGY DFR  +E   S      LP    +   +    SHLIVWQ++  N+
Sbjct:  784 SDAYKDQISVLPNEQDLVREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETVILHQGRLLGLRANKTSGVPGNRPGSVIRVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVA----VPGQVISPQSSSSGTDLTGDKAGPSAQEPGSQTPLKS-MLVISGGEGYIDFRMGDEGGESELLGEDLP---LEPSVTKAERSHLIVWQVMYGNE 1177          

HSP 2 Score: 119.013 bits (297), Expect = 3.348e-26
Identity = 65/141 (46.10%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+EN+I EN  L+ TKNALNIVK+DLI+K+DE   E ++LQ E  ++   K   + +   LE E +  + E      +AKDD + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  239 DVDEGADLL-------GMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 372          

HSP 3 Score: 95.1301 bits (235), Expect = 6.878e-19
Identity = 58/178 (32.58%), Postives = 91/178 (51.12%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVE-------DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K        +K  ++P+P+Y RPL E  + +KL       CAV +N+         + VG+S+FY      +   SK         D ++ E    Q  + NQ       E+S S VWICTS+ + ++++++DA +P   LD+F + +S + C+ SVPGA + DY
Sbjct:  485 RVQAFGWSLPQKYKQVTNGQGENKMKNLPVPVYLRPLDEKDTSMKLW------CAVGVNLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQ------EELS-SLVWICTSTHSATKVLIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDY 649          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 234.187 bits (596), Expect = 5.099e-66
Identity = 161/461 (34.92%), Postives = 255/461 (55.31%), Query Frame = 3
Query:   93 SFMNYLRDSIYFTSINEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLK-----------------SYSNERRTSNSEALDENDSKSDGCNINPPNLLT-------------------------ELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFD----DELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            S +N + DSI  ++ +E  +Y    S   +  +SD V  +A+ IY+E E++I  +GE  VK LMP+VV+ LE LD  Y E+     E E+LKED+ QL TQYEREK  RK+TE+   + ED+    +K+ +++++ L+S  +M+E++ KN+ D  SR E+RE+E++ E+DRL  RY+ LLR H D +E++K     +   EKFE ++                 S         S+ +  + ++S   ++N  N +T                          L + I T    P     +P  S++ +   +++ D     ++L  D    D   GM  E+EN+IKEN++L+  KNALNIVK+DLI+++DE NSE  IL+ EN S   +    + +I   E E K+LK +++ +    ++D   ++P++ RKRFTR EM RVLM+RN YKEKL+E+EE +
Sbjct:    6 SPVNEMADSITSSTPSE-IVYGGPGSPDEHRTMSDKVQTMASAIYRELETMIKVHGEDGVKTLMPLVVNVLEALDLAYLERDEQTAELEMLKEDNEQLQTQYEREKALRKQTEQKYIEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERYNTLLRTHVDHMERTKY----LMGSEKFELMQNMPLPNMQLRNKMGMAASVDASSIRGVSDLISAHMTQSTTMDVNLANHITNEDWQDEFSSDIEPSPRDIPQSSADALTSPITTKEPTPKREAASPKQSEEEEADETTSVDPKENNDLLGADLTVNDTFIGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILRDENLSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEED---DVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESI 458          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 241.506 bits (615), Expect = 6.244e-66
Identity = 190/643 (29.55%), Postives = 307/643 (47.74%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQND----------YIHVSIDVSSKSTVTEKTD-------HISQIQDSF-------------FPK----FKLKTVDCYQLESPATNEN---AASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIR--CLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPF---------VKDS-RKENELDIVNDFNDVSYSMENSYLPT--FIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFN-ENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            R +  GWSLP NV+ ++ S VPIP+ CRPL +N+  LK      I CA  + +    + + +  VG  I++   +++    S     +  E    +   + + + D     S   V   +S+  +S I V+DA  P   ++ F    S + C+ +V G  + +          Y+     +       + TD        + +++DS               PK    F +  V      +P   +     A+    ++    ++ D     +  +   + + PT+W+G +N  +++H A      CL  I++ D++++I++  SR+F +LANG++ +F+R     NK   G+W    Y+ L       S+R  CL S N    IW  YKN ++VLD  SL + K F AHPR D  VR M   G G+W+S+RLD+TLRL+H + Y+HLQD+++EP+V K++  S L  S +R + L  S  R+WIGT  G+I+S PF          KDS R      +V  +   S +  N       FIP+ N  + QLS+HGH+DSVKFF+     VP + +   +   ++       R LIMSGG+GY DFR   EN   +  +   P          ++ SHLI+W++
Sbjct:  228 RIEAYGWSLP-NVE-AEVSSVPIPVCCRPLLDNEPSLK------IWCATGVVLRGGRDERGQWIVGDPIYFAPASMKKTKTSNHRPELEDEIKRARNLDARESELDEWQSSSLVWV--VSSNQGKSLIAVLDANNPNNIIETFPACDSHLLCIQAVSGVMEGEPEMNEEQSKKYLSGGGKIKDLPEGLDGTDLGACEWVELRKMEDSEDGVPTYCSNDMKPSPKRTRDFSISEVAPVDSSAPVKEDPLPPPANRPGGRAALPPHIRDAMSKYDGVSGQMSGALPTVWMGGQNQYIYIHSAVTAWKQCLRRIKMPDAVLSIVHYKSRIFAALANGTIAIFHR-----NKH--GEWSDEGYHSLRVGSATSSVRSLCLVSTN----IWATYKNCVVVLDAESLQIVKVFAAHPRKDSQVRNMQWVGAGVWLSIRLDSTLRLYHAHTYEHLQDVDIEPYVTKMLGTSKLDFSYMRTTALLVSNRRLWIGTGTGVIISVPFSGQLEKKIETKDSKRPAGPGGLVRVYGATSENATNDEKTNDDFIPYCNLAHAQLSFHGHKDSVKFFLG----VPGASKNGEDESAEVT----LRRMLIMSGGDGYIDFRIGEENEPELTGQSIRP----------RDMSHLIIWEV 831          

HSP 2 Score: 111.694 bits (278), Expect = 1.585e-24
Identity = 61/125 (48.80%), Postives = 89/125 (71.20%), Query Frame = 3
Query:  963 GMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            GM  E+EN+IKEN++L+  KNALNIVK+DLI+++DE NSE  IL+ EN S   +    + +I   E E K+LK +++ +    ++D   ++P++ RKRFTR EM RVLM+RN YKEKL+E+EE +
Sbjct:   14 GMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILRDENLSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEED---DVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESI 135          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 241.506 bits (615), Expect = 7.044e-66
Identity = 190/643 (29.55%), Postives = 307/643 (47.74%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQND----------YIHVSIDVSSKSTVTEKTD-------HISQIQDSF-------------FPK----FKLKTVDCYQLESPATNEN---AASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIR--CLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPF---------VKDS-RKENELDIVNDFNDVSYSMENSYLPT--FIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFN-ENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            R +  GWSLP NV+ ++ S VPIP+ CRPL +N+  LK      I CA  + +    + + +  VG  I++   +++    S     +  E    +   + + + D     S   V   +S+  +S I V+DA  P   ++ F    S + C+ +V G  + +          Y+     +       + TD        + +++DS               PK    F +  V      +P   +     A+    ++    ++ D     +  +   + + PT+W+G +N  +++H A      CL  I++ D++++I++  SR+F +LANG++ +F+R     NK   G+W    Y+ L       S+R  CL S N    IW  YKN ++VLD  SL + K F AHPR D  VR M   G G+W+S+RLD+TLRL+H + Y+HLQD+++EP+V K++  S L  S +R + L  S  R+WIGT  G+I+S PF          KDS R      +V  +   S +  N       FIP+ N  + QLS+HGH+DSVKFF+     VP + +   +   ++       R LIMSGG+GY DFR   EN   +  +   P          ++ SHLI+W++
Sbjct:  234 RIEAYGWSLP-NVE-AEVSSVPIPVCCRPLLDNEPSLK------IWCATGVVLRGGRDERGQWIVGDPIYFAPASMKKTKTSNHRPELEDEIKRARNLDARESELDEWQSSSLVWV--VSSNQGKSLIAVLDANNPNNIIETFPACDSHLLCIQAVSGVMEGEPEMNEEQSKKYLSGGGKIKDLPEGLDGTDLGACEWVELRKMEDSEDGVPTYCSNDMKPSPKRTRDFSISEVAPVDSSAPVKEDPLPPPANRPGGRAALPPHIRDAMSKYDGVSGQMSGALPTVWMGGQNQYIYIHSAVTAWKQCLRRIKMPDAVLSIVHYKSRIFAALANGTIAIFHR-----NKH--GEWSDEGYHSLRVGSATSSVRSLCLVSTN----IWATYKNCVVVLDAESLQIVKVFAAHPRKDSQVRNMQWVGAGVWLSIRLDSTLRLYHAHTYEHLQDVDIEPYVTKMLGTSKLDFSYMRTTALLVSNRRLWIGTGTGVIISVPFSGQLEKKIETKDSKRPAGPGGLVRVYGATSENATNDEKTNDDFIPYCNLAHAQLSFHGHKDSVKFFLG----VPGASKNGEDESAEVT----LRRMLIMSGGDGYIDFRIGEENEPELTGQSIRP----------RDMSHLIIWEV 837          

HSP 2 Score: 113.235 bits (282), Expect = 5.725e-25
Identity = 62/131 (47.33%), Postives = 91/131 (69.47%), Query Frame = 3
Query:  945 FDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
             +D   GM  E+EN+IKEN++L+  KNALNIVK+DLI+++DE NSE  IL+ EN S   +    + +I   E E K+LK +++ +    ++D   ++P++ RKRFTR EM RVLM+RN YKEKL+E+EE +
Sbjct:   14 VNDTFIGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILRDENLSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEED---DVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESI 141          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 241.121 bits (614), Expect = 1.954e-65
Identity = 190/643 (29.55%), Postives = 307/643 (47.74%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQND----------YIHVSIDVSSKSTVTEKTD-------HISQIQDSF-------------FPK----FKLKTVDCYQLESPATNEN---AASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIR--CLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPF---------VKDS-RKENELDIVNDFNDVSYSMENSYLPT--FIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFN-ENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            R +  GWSLP NV+ ++ S VPIP+ CRPL +N+  LK      I CA  + +    + + +  VG  I++   +++    S     +  E    +   + + + D     S   V   +S+  +S I V+DA  P   ++ F    S + C+ +V G  + +          Y+     +       + TD        + +++DS               PK    F +  V      +P   +     A+    ++    ++ D     +  +   + + PT+W+G +N  +++H A      CL  I++ D++++I++  SR+F +LANG++ +F+R     NK   G+W    Y+ L       S+R  CL S N    IW  YKN ++VLD  SL + K F AHPR D  VR M   G G+W+S+RLD+TLRL+H + Y+HLQD+++EP+V K++  S L  S +R + L  S  R+WIGT  G+I+S PF          KDS R      +V  +   S +  N       FIP+ N  + QLS+HGH+DSVKFF+     VP + +   +   ++       R LIMSGG+GY DFR   EN   +  +   P          ++ SHLI+W++
Sbjct:  296 RIEAYGWSLP-NVE-AEVSSVPIPVCCRPLLDNEPSLK------IWCATGVVLRGGRDERGQWIVGDPIYFAPASMKKTKTSNHRPELEDEIKRARNLDARESELDEWQSSSLVWV--VSSNQGKSLIAVLDANNPNNIIETFPACDSHLLCIQAVSGVMEGEPEMNEEQSKKYLSGGGKIKDLPEGLDGTDLGACEWVELRKMEDSEDGVPTYCSNDMKPSPKRTRDFSISEVAPVDSSAPVKEDPLPPPANRPGGRAALPPHIRDAMSKYDGVSGQMSGALPTVWMGGQNQYIYIHSAVTAWKQCLRRIKMPDAVLSIVHYKSRIFAALANGTIAIFHR-----NKH--GEWSDEGYHSLRVGSATSSVRSLCLVSTN----IWATYKNCVVVLDAESLQIVKVFAAHPRKDSQVRNMQWVGAGVWLSIRLDSTLRLYHAHTYEHLQDVDIEPYVTKMLGTSKLDFSYMRTTALLVSNRRLWIGTGTGVIISVPFSGQLEKKIETKDSKRPAGPGGLVRVYGATSENATNDEKTNDDFIPYCNLAHAQLSFHGHKDSVKFFLG----VPGASKNGEDESAEVT----LRRMLIMSGGDGYIDFRIGEENEPELTGQSIRP----------RDMSHLIIWEV 899          

HSP 2 Score: 115.161 bits (287), Expect = 1.483e-25
Identity = 71/174 (40.80%), Postives = 109/174 (62.64%), Query Frame = 3
Query:  816 LGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            L + I T    P     +P  S++ +   +++ D     ++L  D  L GM  E+EN+IKEN++L+  KNALNIVK+DLI+++DE NSE  IL+ EN S   +    + +I   E E K+LK +++ +    ++D   ++P++ RKRFTR EM RVLM+RN YKEKL+E+EE +
Sbjct:   35 LTSPITTKEPTPKREAASPKQSEEEEADETTSVDPKENNDLLGAD--LTGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILRDENLSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEED---DVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESI 203          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 231.876 bits (590), Expect = 3.419e-65
Identity = 161/467 (34.48%), Postives = 256/467 (54.82%), Query Frame = 3
Query:   93 SFMNYLRDSIYFTSINEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLK-----------------SYSNERRTSNSEALDENDSKSDGCNINPPNLLT-------------------------ELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNIL----------PFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            S +N + DSI  ++ +E  +Y    S   +  +SD V  +A+ IY+E E++I  +GE  VK LMP+VV+ LE LD  Y E+     E E+LKED+ QL TQYEREK  RK+TE+   + ED+    +K+ +++++ L+S  +M+E++ KN+ D  SR E+RE+E++ E+DRL  RY+ LLR H D +E++K     +   EKFE ++                 S         S+ +  + ++S   ++N  N +T                          L + I T    P     +P  S++ +   +++ D     ++L          P +   AGM  E+EN+IKEN++L+  KNALNIVK+DLI+++DE NSE  IL+ EN S   +    + +I   E E K+LK +++ +    ++D   ++P++ RKRFTR EM RVLM+RN YKEKL+E+EE +
Sbjct:    6 SPVNEMADSITSSTPSE-IVYGGPGSPDEHRTMSDKVQTMASAIYRELETMIKVHGEDGVKTLMPLVVNVLEALDLAYLERDEQTAELEMLKEDNEQLQTQYEREKALRKQTEQKYIEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERYNTLLRTHVDHMERTKY----LMGSEKFELMQNMPLPNMQLRNKMGMAASVDASSIRGVSDLISAHMTQSTTMDVNLANHITNEDWQDEFSSDIEPSPRDIPQSSADALTSPITTKEPTPKREAASPKQSEEEEADETTSVDPKENNDLLGADLTGNLVDPAEFASAGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILRDENLSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEED---DVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESI 464          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0345912)

HSP 1 Score: 249.21 bits (635), Expect = 8.449e-67
Identity = 168/449 (37.42%), Postives = 252/449 (56.12%), Query Frame = 3
Query:  168 SETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK----NHHNEIKNI-EKFERLKSYSNE-RRTS-----------NSEALDENDSKSDGC---NINPPNLLTEL---------------------GTQINTPNDPPMDWNFTPSA----------SDDG--------DIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            +E +N V+S+ V  LA  IY+EFE +I  Y E VVKNLMP++V+ LE LD  Y      +VE ELL+ED+ QL+TQYEREK  RK++E+ L ++ED   + +K+    L+ ++S  +M+E++ KNSL+  SR E+RE + + EY++L  RY EL + H D++E++K    + H+++    E+ +  ++  N   R+S           NS  LD     S G    +  PP+L  EL                      T   +P+  P+  N   +           SD+         D   S   +I  G  + P +   +GM  E+EN+I ENN+L+ATKNALNIVKDDLI K+DE   E+EI++ E N++   +T  + RI+ LE E K  K ++  Q+   +   E ++P++QRKRFTR EM  VLMERNQYKE+L+E++E V
Sbjct:   24 TEDNNMVMSEKVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTKMLMGSTHSQMSTASERMDVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVGSQSDDSGPPSLQNELDNLSGTLERGAATDALQQQHHATSPQSPDSSPVVPNVPTNVGRSTTKKEQRSDNNLYQELSFQDNEESEENEIVTGSWVHPGEYASSGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQE---ENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAV 469          

HSP 2 Score: 223.016 bits (567), Expect = 1.573e-58
Identity = 120/313 (38.34%), Postives = 182/313 (58.15%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNEN 4336
            PT+W+G ++G L+VH +      CLH + L D+++ I++  +RV V+LAN  + VF R          GQW ++ Y+L+     N+SIRCL       +IW  ++N+I ++D VSL +    +AHPR +  VRQM   G G+WVS+RLD+TLRL++ + ++H QD+++EP+V+K++    LG S +RI+ L  SCNR+WIGT+ G+I+S P  +   K +        +D    M         P     N QLS+HGHRD+VKFFV+V       +   PN    +    ++   L+M GGEGY DFR N+N
Sbjct:  903 PTMWLGAQDGWLYVHSSVGRWHECLHRVLLPDAVLAIVHVEARVVVALANAQLAVFRRQTD-------GQWDLNSYHLVTLGDRNHSIRCL--CVAGERIWAAHRNKIFIVDPVSLNIVHSLDAHPRKESQVRQMAATGAGVWVSIRLDSTLRLYNTHTFEHKQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWIGTSNGVIISVPLAEVQPKSS--------SDPHGQM---------PLCCMANAQLSFHGHRDAVKFFVSV------PMLQQPNLNGGLTFTNKRPDMLVMCGGEGYIDFRINDN 1183          

HSP 3 Score: 80.8777 bits (198), Expect = 7.679e-15
Identity = 67/227 (29.52%), Postives = 105/227 (46.26%), Query Frame = 2
Query: 2534 NNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQIN-------------GWSLPRNVKVSKA------SDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVEN--QNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
              P ++  S    N+  MPK    + E    S   SA R  + +Q+              GWSLP N    +A        VP+P+YC PL+E    +K+       CA  +N+H  F    ++ + ++  Y  ++     +  S   D  + E    Q++  +    +P T++S S VWICTS+   S + VVDA + A  LDAF I +S + C+ SV GA ++DY
Sbjct:  551 GQPPVHPASAGLANALIMPK---DYAEEGS-SERISARRREQYRQLRAHVQKEDGRLHAYGWSLPINKASQEANPNRHSGGVPVPVYCNPLAEASPHMKVF------CAAGVNLHGGFTKNGQSLIPANSPYAPKSTLKIAEITSPTADQ-SMEALDRQMARVSLETLEPETQLS-SFVWICTSTHAASTVSVVDANQSATVLDAFPICASHLLCIASVQGAMESDY 765          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0332788)

HSP 1 Score: 249.21 bits (635), Expect = 8.449e-67
Identity = 168/449 (37.42%), Postives = 252/449 (56.12%), Query Frame = 3
Query:  168 SETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK----NHHNEIKNI-EKFERLKSYSNE-RRTS-----------NSEALDENDSKSDGC---NINPPNLLTEL---------------------GTQINTPNDPPMDWNFTPSA----------SDDG--------DIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            +E +N V+S+ V  LA  IY+EFE +I  Y E VVKNLMP++V+ LE LD  Y      +VE ELL+ED+ QL+TQYEREK  RK++E+ L ++ED   + +K+    L+ ++S  +M+E++ KNSL+  SR E+RE + + EY++L  RY EL + H D++E++K    + H+++    E+ +  ++  N   R+S           NS  LD     S G    +  PP+L  EL                      T   +P+  P+  N   +           SD+         D   S   +I  G  + P +   +GM  E+EN+I ENN+L+ATKNALNIVKDDLI K+DE   E+EI++ E N++   +T  + RI+ LE E K  K ++  Q+   +   E ++P++QRKRFTR EM  VLMERNQYKE+L+E++E V
Sbjct:   24 TEDNNMVMSEKVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTKMLMGSTHSQMSTASERMDVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVGSQSDDSGPPSLQNELDNLSGTLERGAATDALQQQHHATSPQSPDSSPVVPNVPTNVGRSTTKKEQRSDNNLYQELSFQDNEESEENEIVTGSWVHPGEYASSGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQE---ENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAV 469          

HSP 2 Score: 223.016 bits (567), Expect = 1.573e-58
Identity = 120/313 (38.34%), Postives = 182/313 (58.15%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNEN 4336
            PT+W+G ++G L+VH +      CLH + L D+++ I++  +RV V+LAN  + VF R          GQW ++ Y+L+     N+SIRCL       +IW  ++N+I ++D VSL +    +AHPR +  VRQM   G G+WVS+RLD+TLRL++ + ++H QD+++EP+V+K++    LG S +RI+ L  SCNR+WIGT+ G+I+S P  +   K +        +D    M         P     N QLS+HGHRD+VKFFV+V       +   PN    +    ++   L+M GGEGY DFR N+N
Sbjct:  903 PTMWLGAQDGWLYVHSSVGRWHECLHRVLLPDAVLAIVHVEARVVVALANAQLAVFRRQTD-------GQWDLNSYHLVTLGDRNHSIRCL--CVAGERIWAAHRNKIFIVDPVSLNIVHSLDAHPRKESQVRQMAATGAGVWVSIRLDSTLRLYNTHTFEHKQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWIGTSNGVIISVPLAEVQPKSS--------SDPHGQM---------PLCCMANAQLSFHGHRDAVKFFVSV------PMLQQPNLNGGLTFTNKRPDMLVMCGGEGYIDFRINDN 1183          

HSP 3 Score: 80.8777 bits (198), Expect = 7.679e-15
Identity = 67/227 (29.52%), Postives = 105/227 (46.26%), Query Frame = 2
Query: 2534 NNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQIN-------------GWSLPRNVKVSKA------SDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVEN--QNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
              P ++  S    N+  MPK    + E    S   SA R  + +Q+              GWSLP N    +A        VP+P+YC PL+E    +K+       CA  +N+H  F    ++ + ++  Y  ++     +  S   D  + E    Q++  +    +P T++S S VWICTS+   S + VVDA + A  LDAF I +S + C+ SV GA ++DY
Sbjct:  551 GQPPVHPASAGLANALIMPK---DYAEEGS-SERISARRREQYRQLRAHVQKEDGRLHAYGWSLPINKASQEANPNRHSGGVPVPVYCNPLAEASPHMKVF------CAAGVNLHGGFTKNGQSLIPANSPYAPKSTLKIAEITSPTADQ-SMEALDRQMARVSLETLEPETQLS-SFVWICTSTHAASTVSVVDANQSATVLDAFPICASHLLCIASVQGAMESDY 765          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0332789)

HSP 1 Score: 248.825 bits (634), Expect = 8.496e-67
Identity = 168/449 (37.42%), Postives = 252/449 (56.12%), Query Frame = 3
Query:  168 SETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK----NHHNEIKNI-EKFERLKSYSNE-RRTS-----------NSEALDENDSKSDGC---NINPPNLLTEL---------------------GTQINTPNDPPMDWNFTPSA----------SDDG--------DIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            +E +N V+S+ V  LA  IY+EFE +I  Y E VVKNLMP++V+ LE LD  Y      +VE ELL+ED+ QL+TQYEREK  RK++E+ L ++ED   + +K+    L+ ++S  +M+E++ KNSL+  SR E+RE + + EY++L  RY EL + H D++E++K    + H+++    E+ +  ++  N   R+S           NS  LD     S G    +  PP+L  EL                      T   +P+  P+  N   +           SD+         D   S   +I  G  + P +   +GM  E+EN+I ENN+L+ATKNALNIVKDDLI K+DE   E+EI++ E N++   +T  + RI+ LE E K  K ++  Q+   +   E ++P++QRKRFTR EM  VLMERNQYKE+L+E++E V
Sbjct:   24 TEDNNMVMSEKVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTKMLMGSTHSQMSTASERMDVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVGSQSDDSGPPSLQNELDNLSGTLERGAATDALQQQHHATSPQSPDSSPVVPNVPTNVGRSTTKKEQRSDNNLYQELSFQDNEESEENEIVTGSWVHPGEYASSGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQE---ENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAV 469          

HSP 2 Score: 222.246 bits (565), Expect = 2.613e-58
Identity = 127/345 (36.81%), Postives = 194/345 (56.23%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            PT+W+G ++G L+VH +      CLH + L D+++ I++  +RV V+LAN  + VF R          GQW ++ Y+L+     N+SIRCL       +IW  ++N+I ++D VSL +    +AHPR +  VRQM   G G+WVS+RLD+TLRL++ + ++H QD+++EP+V+K++    LG S +RI+ L  SCNR+WIGT+ G+I+S P  +   K +        +D    M         P     N QLS+HGHRD+VKFFV+V       +   PN    +    ++   L+M GGEGY DFR        H KF           ++ N++HLIVW++
Sbjct:  903 PTMWLGAQDGWLYVHSSVGRWHECLHRVLLPDAVLAIVHVEARVVVALANAQLAVFRRQTD-------GQWDLNSYHLVTLGDRNHSIRCLCVAG--ERIWAAHRNKIFIVDPVSLNIVHSLDAHPRKESQVRQMAATGAGVWVSIRLDSTLRLYNTHTFEHKQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWIGTSNGVIISVPLAEVQPKSS--------SDPHGQM---------PLCCMANAQLSFHGHRDAVKFFVSV------PMLQQPNLNGGLTFTNKRPDMLVMCGGEGYIDFRIR------HDKFD----------ASDNAAHLIVWKV 1199          

HSP 3 Score: 81.2629 bits (199), Expect = 6.410e-15
Identity = 67/227 (29.52%), Postives = 105/227 (46.26%), Query Frame = 2
Query: 2534 NNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQIN-------------GWSLPRNVKVSKA------SDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVEN--QNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
              P ++  S    N+  MPK    + E    S   SA R  + +Q+              GWSLP N    +A        VP+P+YC PL+E    +K+       CA  +N+H  F    ++ + ++  Y  ++     +  S   D  + E    Q++  +    +P T++S S VWICTS+   S + VVDA + A  LDAF I +S + C+ SV GA ++DY
Sbjct:  551 GQPPVHPASAGLANALIMPK---DYAEEGS-SERISARRREQYRQLRAHVQKEDGRLHAYGWSLPINKASQEANPNRHSGGVPVPVYCNPLAEASPHMKVF------CAAGVNLHGGFTKNGQSLIPANSPYAPKSTLKIAEITSPTADQ-SMEALDRQMARVSLETLEPETQLS-SFVWICTSTHAASTVSVVDANQSATVLDAFPICASHLLCIASVQGAMESDY 765          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0332787)

HSP 1 Score: 248.825 bits (634), Expect = 8.970e-67
Identity = 167/449 (37.19%), Postives = 250/449 (55.68%), Query Frame = 3
Query:  168 SETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK----NHHNEIKNI-EKFERLKSYSNERRTS------------NSEALDENDSKSDGC---NINPPNLLTEL---------------------GTQINTPNDPPMDWNFTPSA----------SDDG--------DIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            +E +N V+S+ V  LA  IY+EFE +I  Y E VVKNLMP++V+ LE LD  Y      +VE ELL+ED+ QL+TQYEREK  RK++E+ L ++ED   + +K+    L+ ++S  +M+E++ KNSL+  SR E+RE + + EY++L  RY EL + H D++E++K    + H+++    E+ +  ++  N    S            NS  LD     S G    +  PP+L  EL                      T   +P+  P+  N   +           SD+         D   S   +I  G  + P +   +GM  E+EN+I ENN+L+ATKNALNIVKDDLI K+DE   E+EI++ E N++   +T  + RI+ LE E K  K ++  Q+   +   E ++P++QRKRFTR EM  VLMERNQYKE+L+E++E V
Sbjct:   24 TEDNNMVMSEKVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTKMLMGSTHSQMSTASERMDVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVGSQSDDSGPPSLQNELDNLSGTLERGAATDALQQQHHATSPQSPDSSPVVPNVPTNVGRSTTKKEQRSDNNLYQELSFQDNEESEENEIVTGSWVHPGEYASSGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQE---ENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAV 469          

HSP 2 Score: 221.861 bits (564), Expect = 2.869e-58
Identity = 127/345 (36.81%), Postives = 194/345 (56.23%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            PT+W+G ++G L+VH +      CLH + L D+++ I++  +RV V+LAN  + VF R          GQW ++ Y+L+     N+SIRCL       +IW  ++N+I ++D VSL +    +AHPR +  VRQM   G G+WVS+RLD+TLRL++ + ++H QD+++EP+V+K++    LG S +RI+ L  SCNR+WIGT+ G+I+S P  +   K +        +D    M         P     N QLS+HGHRD+VKFFV+V       +   PN    +    ++   L+M GGEGY DFR        H KF           ++ N++HLIVW++
Sbjct:  903 PTMWLGAQDGWLYVHSSVGRWHECLHRVLLPDAVLAIVHVEARVVVALANAQLAVFRRQTD-------GQWDLNSYHLVTLGDRNHSIRCL--CVAGERIWAAHRNKIFIVDPVSLNIVHSLDAHPRKESQVRQMAATGAGVWVSIRLDSTLRLYNTHTFEHKQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWIGTSNGVIISVPLAEVQPKSS--------SDPHGQM---------PLCCMANAQLSFHGHRDAVKFFVSV------PMLQQPNLNGGLTFTNKRPDMLVMCGGEGYIDFRIR------HDKFD----------ASDNAAHLIVWKV 1199          

HSP 3 Score: 81.2629 bits (199), Expect = 6.737e-15
Identity = 67/227 (29.52%), Postives = 105/227 (46.26%), Query Frame = 2
Query: 2534 NNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQIN-------------GWSLPRNVKVSKA------SDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVEN--QNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
              P ++  S    N+  MPK    + E    S   SA R  + +Q+              GWSLP N    +A        VP+P+YC PL+E    +K+       CA  +N+H  F    ++ + ++  Y  ++     +  S   D  + E    Q++  +    +P T++S S VWICTS+   S + VVDA + A  LDAF I +S + C+ SV GA ++DY
Sbjct:  551 GQPPVHPASAGLANALIMPK---DYAEEGS-SERISARRREQYRQLRAHVQKEDGRLHAYGWSLPINKASQEANPNRHSGGVPVPVYCNPLAEASPHMKVF------CAAGVNLHGGFTKNGQSLIPANSPYAPKSTLKIAEITSPTADQ-SMEALDRQMARVSLETLEPETQLS-SFVWICTSTHAASTVSVVDANQSATVLDAFPICASHLLCIASVQGAMESDY 765          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0300413)

HSP 1 Score: 243.432 bits (620), Expect = 3.954e-65
Identity = 166/445 (37.30%), Postives = 246/445 (55.28%), Query Frame = 3
Query:  180 NTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK----NHHNEIKNI-EKFERLKSYSNE-RRTS-----------NSEALDENDSKSDGC---NINPPNLLTEL---------------------GTQINTPNDPPMDWNFTPSA----------SDDG--------DIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            N  V   V  LA  IY+EFE +I  Y E VVKNLMP++V+ LE LD  Y      +VE ELL+ED+ QL+TQYEREK  RK++E+ L ++ED   + +K+    L+ ++S  +M+E++ KNSL+  SR E+RE + + EY++L  RY EL + H D++E++K    + H+++    E+ +  ++  N   R+S           NS  LD     S G    +  PP+L  EL                      T   +P+  P+  N   +           SD+         D   S   +I  G  + P +   +GM  E+EN+I ENN+L+ATKNALNIVKDDLI K+DE   E+EI++ E N++   +T  + RI+ LE E K  K ++  Q+    +  E ++P++QRKRFTR EM  VLMERNQYKE+L+E++E V
Sbjct:    2 NEQVVSIVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTKMLMGSTHSQMSTASERMDVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVGSQSDDSGPPSLQNELDNLSGTLERGAATDALQQQHHATSPQSPDSSPVVPNVPTNVGRSTTKKEQRSDNNLYQELSFQDNEESEENEIVTGSWVHPGEYASSGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQN---TEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAV 443          

HSP 2 Score: 223.016 bits (567), Expect = 1.359e-58
Identity = 120/313 (38.34%), Postives = 182/313 (58.15%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNEN 4336
            PT+W+G ++G L+VH +      CLH + L D+++ I++  +RV V+LAN  + VF R          GQW ++ Y+L+     N+SIRCL       +IW  ++N+I ++D VSL +    +AHPR +  VRQM   G G+WVS+RLD+TLRL++ + ++H QD+++EP+V+K++    LG S +RI+ L  SCNR+WIGT+ G+I+S P  +   K +        +D    M         P     N QLS+HGHRD+VKFFV+V       +   PN    +    ++   L+M GGEGY DFR N+N
Sbjct:  877 PTMWLGAQDGWLYVHSSVGRWHECLHRVLLPDAVLAIVHVEARVVVALANAQLAVFRRQTD-------GQWDLNSYHLVTLGDRNHSIRCL--CVAGERIWAAHRNKIFIVDPVSLNIVHSLDAHPRKESQVRQMAATGAGVWVSIRLDSTLRLYNTHTFEHKQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWIGTSNGVIISVPLAEVQPKSS--------SDPHGQM---------PLCCMANAQLSFHGHRDAVKFFVSV------PMLQQPNLNGGLTFTNKRPDMLVMCGGEGYIDFRINDN 1157          

HSP 3 Score: 81.2629 bits (199), Expect = 7.297e-15
Identity = 67/227 (29.52%), Postives = 105/227 (46.26%), Query Frame = 2
Query: 2534 NNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQIN-------------GWSLPRNVKVSKA------SDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVEN--QNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
              P ++  S    N+  MPK    + E    S   SA R  + +Q+              GWSLP N    +A        VP+P+YC PL+E    +K+       CA  +N+H  F    ++ + ++  Y  ++     +  S   D  + E    Q++  +    +P T++S S VWICTS+   S + VVDA + A  LDAF I +S + C+ SV GA ++DY
Sbjct:  525 GQPPVHPASAGLANALIMPK---DYAEEGS-SERISARRREQYRQLRAHVQKEDGRLHAYGWSLPINKASQEANPNRHSGGVPVPVYCNPLAEASPHMKVF------CAAGVNLHGGFTKNGQSLIPANSPYAPKSTLKIAEITSPTADQ-SMEALDRQMARVSLETLEPETQLS-SFVWICTSTHAASTVSVVDANQSATVLDAFPICASHLLCIASVQGAMESDY 739          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Zebrafish
Match: SPAG9 (sperm associated antigen 9b [Source:NCBI gene;Acc:100333761])

HSP 1 Score: 256.914 bits (655), Expect = 3.255e-71
Identity = 136/351 (38.75%), Postives = 211/351 (60.11%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNR-FLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PT+W+G +NG ++VH +      CLH I+L DS++ I++   RV V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRLFH + +QHLQD+++EP+V+K++    LG S +RI+ L  SC+R+WIGT  G+I+S P    +  +     +  + D   S +     TF+PF +  + QL +HGHRD+VKFF  V+     S      +K+     P   +  L+MSGGEGY DFR  +      +    P  N +   +    SHLIVWQ+L  +D
Sbjct:  451 PTMWLGAQNGCVYVHSSVAQWRKCLHSIKLKDSVLGIVHVKGRVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTMVH--DKVWCGYRNKIFVVHPKAMKIEKSFDAHPRKESQVRQLAWDGDGIWVSIRLDSTLRLFHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCSRLWIGTGNGVIISIPLTDTASSKQPGTAIRVYGD--ESGDKVTTGTFVPFCSMAHAQLCFHGHRDAVKFFTAVIPSASGSGVEAIADKSSESPTPELVKSVLVMSGGEGYIDFRMGDEGGDTEN-MDDPSLNLQPFLAKAERSHLIVWQVLANHD 789          

HSP 2 Score: 62.3882 bits (150), Expect = 3.956e-9
Identity = 43/148 (29.05%), Postives = 69/148 (46.62%), Query Frame = 2
Query: 2648 RDPERQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEIS-----DSHVWICTSSDNESQIIVVD 3055
            ++  R Q  GWSLP   KV       SK  ++P+P+Y RPL E  + +KL       CA  +N+         + VG+S+FY  ++V       +     S  S + L    +   D   E+       S VWICT++ + S+++V+D
Sbjct:  114 KEDGRMQAYGWSLPPKYKVANGGQADSKIKNLPVPVYLRPLDEKDASMKLW------CAAGVNLSGGKTRDGGSIVGASVFY--KDVSGGERVPISTGKKS-GSQSSLDRLEEELKDQEKELRHQDELSSLVWICTTTHSSSKVLVID 252          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Zebrafish
Match: SPAG9 (sperm associated antigen 9b [Source:NCBI gene;Acc:100333761])

HSP 1 Score: 258.07 bits (658), Expect = 8.223e-70
Identity = 136/351 (38.75%), Postives = 211/351 (60.11%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNR-FLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PT+W+G +NG ++VH +      CLH I+L DS++ I++   RV V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRLFH + +QHLQD+++EP+V+K++    LG S +RI+ L  SC+R+WIGT  G+I+S P    +  +     +  + D   S +     TF+PF +  + QL +HGHRD+VKFF  V+     S      +K+     P   +  L+MSGGEGY DFR  +      +    P  N +   +    SHLIVWQ+L  +D
Sbjct:  799 PTMWLGAQNGCVYVHSSVAQWRKCLHSIKLKDSVLGIVHVKGRVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTMVH--DKVWCGYRNKIFVVHPKAMKIEKSFDAHPRKESQVRQLAWDGDGIWVSIRLDSTLRLFHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCSRLWIGTGNGVIISIPLTDTASSKQPGTAIRVYGD--ESGDKVTTGTFVPFCSMAHAQLCFHGHRDAVKFFTAVIPSASGSGVEAIADKSSESPTPELVKSVLVMSGGEGYIDFRMGDEGGDTEN-MDDPSLNLQPFLAKAERSHLIVWQVLANHD 1137          

HSP 2 Score: 120.168 bits (300), Expect = 9.388e-27
Identity = 63/141 (44.68%), Postives = 89/141 (63.12%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+E++I EN  L+ TKNALN+VK+DLI+++DE   E ++LQ E   L   K   + R   LE E K ++ E+       K D + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  227 DVDEGADLL-------GMGREVEHLIHENTQLLETKNALNVVKNDLIARVDELVCEKDVLQGEIEVLKQTKDKLEERNKELEDELKKVRAEMEETKVETKGDDDSDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 360          

HSP 3 Score: 61.6178 bits (148), Expect = 8.402e-9
Identity = 43/148 (29.05%), Postives = 69/148 (46.62%), Query Frame = 2
Query: 2648 RDPERQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEIS-----DSHVWICTSSDNESQIIVVD 3055
            ++  R Q  GWSLP   KV       SK  ++P+P+Y RPL E  + +KL       CA  +N+         + VG+S+FY  ++V       +     S  S + L    +   D   E+       S VWICT++ + S+++V+D
Sbjct:  462 KEDGRMQAYGWSLPPKYKVANGGQADSKIKNLPVPVYLRPLDEKDASMKLW------CAAGVNLSGGKTRDGGSIVGASVFY--KDVSGGERVPISTGKKS-GSQSSLDRLEEELKDQEKELRHQDELSSLVWICTTTHSSSKVLVID 600          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Zebrafish
Match: SPAG9 (sperm associated antigen 9b [Source:NCBI gene;Acc:100333761])

HSP 1 Score: 258.455 bits (659), Expect = 2.032e-69
Identity = 136/351 (38.75%), Postives = 211/351 (60.11%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNR-FLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PT+W+G +NG ++VH +      CLH I+L DS++ I++   RV V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRLFH + +QHLQD+++EP+V+K++    LG S +RI+ L  SC+R+WIGT  G+I+S P    +  +     +  + D   S +     TF+PF +  + QL +HGHRD+VKFF  V+     S      +K+     P   +  L+MSGGEGY DFR  +      +    P  N +   +    SHLIVWQ+L  +D
Sbjct:  964 PTMWLGAQNGCVYVHSSVAQWRKCLHSIKLKDSVLGIVHVKGRVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTMVH--DKVWCGYRNKIFVVHPKAMKIEKSFDAHPRKESQVRQLAWDGDGIWVSIRLDSTLRLFHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCSRLWIGTGNGVIISIPLTDTASSKQPGTAIRVYGD--ESGDKVTTGTFVPFCSMAHAQLCFHGHRDAVKFFTAVIPSASGSGVEAIADKSSESPTPELVKSVLVMSGGEGYIDFRMGDEGGDTEN-MDDPSLNLQPFLAKAERSHLIVWQVLANHD 1302          

HSP 2 Score: 139.043 bits (349), Expect = 1.691e-32
Identity = 77/177 (43.50%), Postives = 112/177 (63.28%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK 665
            + +G +Y   E   S+ ++S+ V  LA+ IY+EFE +I  Y E VVK LMP+VV+ LE LD V++E    EVE ELLKED+ QL+TQYEREK  RK  EE   + EDS  +  K  +  +Q L++  + +E + KN  DQI R E+RE E + EY+ L  R+ E++  + + +E+SK
Sbjct:    3 LEDGVLYQ--EDPGSSAMMSERVSGLASSIYREFERMIGRYDEDVVKELMPLVVAVLENLDSVFAENQEHEVELELLKEDNEQLVTQYEREKALRKNAEERYIEYEDSQEQDKKALQTRVQLLEAQTRQMEFKTKNCTDQIGRLEEREAELKKEYNALHQRHTEMIHSYMEHLERSK 177          

HSP 3 Score: 119.783 bits (299), Expect = 1.404e-26
Identity = 63/141 (44.68%), Postives = 89/141 (63.12%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+E++I EN  L+ TKNALN+VK+DLI+++DE   E ++LQ E   L   K   + R   LE E K ++ E+       K D + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  383 DVDEGADLL-------GMGREVEHLIHENTQLLETKNALNVVKNDLIARVDELVCEKDVLQGEIEVLKQTKDKLEERNKELEDELKKVRAEMEETKVETKGDDDSDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 516          

HSP 4 Score: 61.6178 bits (148), Expect = 7.931e-9
Identity = 43/144 (29.86%), Postives = 67/144 (46.53%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEIS-----DSHVWICTSSDNESQIIVVD 3055
            R Q  GWSLP   KV       SK  ++P+P+Y RPL E  + +KL       CA  +N+         + VG+S+FY  ++V       +     S  S + L    +   D   E+       S VWICT++ + S+++V+D
Sbjct:  622 RMQAYGWSLPPKYKVANGGQADSKIKNLPVPVYLRPLDEKDASMKLW------CAAGVNLSGGKTRDGGSIVGASVFY--KDVSGGERVPISTGKKS-GSQSSLDRLEEELKDQEKELRHQDELSSLVWICTTTHSSSKVLVID 756          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Zebrafish
Match: SPAG9 (sperm associated antigen 9b [Source:NCBI gene;Acc:100333761])

HSP 1 Score: 257.684 bits (657), Expect = 2.755e-69
Identity = 136/351 (38.75%), Postives = 211/351 (60.11%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNR-FLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PT+W+G +NG ++VH +      CLH I+L DS++ I++   RV V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRLFH + +QHLQD+++EP+V+K++    LG S +RI+ L  SC+R+WIGT  G+I+S P    +  +     +  + D   S +     TF+PF +  + QL +HGHRD+VKFF  V+     S      +K+     P   +  L+MSGGEGY DFR  +      +    P  N +   +    SHLIVWQ+L  +D
Sbjct:  938 PTMWLGAQNGCVYVHSSVAQWRKCLHSIKLKDSVLGIVHVKGRVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTMVH--DKVWCGYRNKIFVVHPKAMKIEKSFDAHPRKESQVRQLAWDGDGIWVSIRLDSTLRLFHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCSRLWIGTGNGVIISIPLTDTASSKQPGTAIRVYGD--ESGDKVTTGTFVPFCSMAHAQLCFHGHRDAVKFFTAVIPSASGSGVEAIADKSSESPTPELVKSVLVMSGGEGYIDFRMGDEGGDTEN-MDDPSLNLQPFLAKAERSHLIVWQVLANHD 1276          

HSP 2 Score: 139.428 bits (350), Expect = 1.486e-32
Identity = 77/177 (43.50%), Postives = 112/177 (63.28%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK 665
            + +G +Y   E   S+ ++S+ V  LA+ IY+EFE +I  Y E VVK LMP+VV+ LE LD V++E    EVE ELLKED+ QL+TQYEREK  RK  EE   + EDS  +  K  +  +Q L++  + +E + KN  DQI R E+RE E + EY+ L  R+ E++  + + +E+SK
Sbjct:    3 LEDGVLYQ--EDPGSSAMMSERVSGLASSIYREFERMIGRYDEDVVKELMPLVVAVLENLDSVFAENQEHEVELELLKEDNEQLVTQYEREKALRKNAEERYIEYEDSQEQDKKALQTRVQLLEAQTRQMEFKTKNCTDQIGRLEEREAELKKEYNALHQRHTEMIHSYMEHLERSK 177          

HSP 3 Score: 119.783 bits (299), Expect = 1.481e-26
Identity = 63/141 (44.68%), Postives = 89/141 (63.12%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+E++I EN  L+ TKNALN+VK+DLI+++DE   E ++LQ E   L   K   + R   LE E K ++ E+       K D + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  350 DVDEGADLL-------GMGREVEHLIHENTQLLETKNALNVVKNDLIARVDELVCEKDVLQGEIEVLKQTKDKLEERNKELEDELKKVRAEMEETKVETKGDDDSDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 483          

HSP 4 Score: 62.003 bits (149), Expect = 5.725e-9
Identity = 43/144 (29.86%), Postives = 67/144 (46.53%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEIS-----DSHVWICTSSDNESQIIVVD 3055
            R Q  GWSLP   KV       SK  ++P+P+Y RPL E  + +KL       CA  +N+         + VG+S+FY  ++V       +     S  S + L    +   D   E+       S VWICT++ + S+++V+D
Sbjct:  596 RMQAYGWSLPPKYKVANGGQADSKIKNLPVPVYLRPLDEKDASMKLW------CAAGVNLSGGKTRDGGSIVGASVFY--KDVSGGERVPISTGKKS-GSQSSLDRLEEELKDQEKELRHQDELSSLVWICTTTHSSSKVLVID 730          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Zebrafish
Match: SPAG9 (sperm associated antigen 9b [Source:NCBI gene;Acc:100333761])

HSP 1 Score: 256.914 bits (655), Expect = 4.708e-69
Identity = 137/351 (39.03%), Postives = 211/351 (60.11%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNR-FLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PT+W+G +NG ++VH +      CLH I+L DS++ I++   RV V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRLFH + +QHLQD+++EP+V+K++    LG S +RI+ L  SC+R+WIGT  G+I+S P    +  +     +  + D   S +     TF+PF +  + QL +HGHRD+VKFF      VP S      +K+     P   +  L+MSGGEGY DFR  +      +    P  N +   +    SHLIVWQ+L  +D
Sbjct:  922 PTMWLGAQNGCVYVHSSVAQWRKCLHSIKLKDSVLGIVHVKGRVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTMVH--DKVWCGYRNKIFVVHPKAMKIEKSFDAHPRKESQVRQLAWDGDGIWVSIRLDSTLRLFHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCSRLWIGTGNGVIISIPLTDTASSKQPGTAIRVYGD--ESGDKVTTGTFVPFCSMAHAQLCFHGHRDAVKFFTA----VPGSGVEAIADKSSESPTPELVKSVLVMSGGEGYIDFRMGDEGGDTEN-MDDPSLNLQPFLAKAERSHLIVWQVLANHD 1256          

HSP 2 Score: 139.428 bits (350), Expect = 1.527e-32
Identity = 77/177 (43.50%), Postives = 112/177 (63.28%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK 665
            + +G +Y   E   S+ ++S+ V  LA+ IY+EFE +I  Y E VVK LMP+VV+ LE LD V++E    EVE ELLKED+ QL+TQYEREK  RK  EE   + EDS  +  K  +  +Q L++  + +E + KN  DQI R E+RE E + EY+ L  R+ E++  + + +E+SK
Sbjct:    3 LEDGVLYQ--EDPGSSAMMSERVSGLASSIYREFERMIGRYDEDVVKELMPLVVAVLENLDSVFAENQEHEVELELLKEDNEQLVTQYEREKALRKNAEERYIEYEDSQEQDKKALQTRVQLLEAQTRQMEFKTKNCTDQIGRLEEREAELKKEYNALHQRHTEMIHSYMEHLERSK 177          

HSP 3 Score: 119.783 bits (299), Expect = 1.301e-26
Identity = 63/141 (44.68%), Postives = 89/141 (63.12%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+E++I EN  L+ TKNALN+VK+DLI+++DE   E ++LQ E   L   K   + R   LE E K ++ E+       K D + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  374 DVDEGADLL-------GMGREVEHLIHENTQLLETKNALNVVKNDLIARVDELVCEKDVLQGEIEVLKQTKDKLEERNKELEDELKKVRAEMEETKVETKGDDDSDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 507          

HSP 4 Score: 54.6842 bits (130), Expect = 1.064e-6
Identity = 41/139 (29.50%), Postives = 62/139 (44.60%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEIS-----DSHVWICTSSDNESQ 3040
            R Q  GWSLP   KV       SK  ++P+P+Y RPL E  + +KL       CA  +N+         + VG+S+FY  ++V       +     S  S + L    +   D   E+       S VWICT++ + S+
Sbjct:  613 RMQAYGWSLPPKYKVANGGQADSKIKNLPVPVYLRPLDEKDASMKLW------CAAGVNLSGGKTRDGGSIVGASVFY--KDVSGGERVPISTGKKS-GSQSSLDRLEEELKDQEKELRHQDELSSLVWICTTTHSSSK 742          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 253.447 bits (646), Expect = 6.762e-68
Identity = 145/374 (38.77%), Postives = 224/374 (59.89%), Query Frame = 2
Query: 3350 QFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFV---KDSRKENELDIVNDFNDVSYSMENS--YLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCS-----LETP---PNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            Q   PN       S+ PT+W+G +NG L+VH A  N   CLH I+L DS++++++   RV V+LA+G++ +F+R    E+K    QW +S Y+L++  + ++SIRC+  V   +++W GYKN+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + +QHLQD+++EP+V+K++    LG S +RI+ L  + NR+W+GT  G+++S P     K S    E         V YS ENS     +FIP+ +    QL +HGHRD+VKFFV+V  +V  +     L++P   P    + ++   KN  L++SGGEGY DFR  +       + S   +  K   S    SH+IVWQ+
Sbjct:  856 QETEPNQEASTGTSASPTMWLGAQNGWLYVHSAVSNWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHR---GEDK----QWDLSNYHLMDLGHTHHSIRCMAVV--YDRVWCGYKNKIHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETNKTSPTSGEGTRPGGVIHV-YSDENSDKTAGSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPSENPGTPAETEEQKLKN-VLVLSGGEGYIDFRIGDGEDDETEEHSADGNQPKPVLSKAERSHIIVWQV 1218          

HSP 2 Score: 234.958 bits (598), Expect = 4.683e-62
Identity = 169/494 (34.21%), Postives = 244/494 (49.39%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPN---------------DPPMDWNFTPSA---------------------------------SDDGDII------------------NSSTEDI---SHGVNILPFDDELA-----------------GMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEE-------NLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            I++G +Y   +   S +V+S+ V  LAN IY+EFE LI  Y E VVK LMP+VV+ LE LD V +E    EVE ELLKED+ QL+TQYEREK  RK+ EE   + ED+  +  K  + +++ L+   + +E++ KN  DQISR E+RE E + EY+ L  R+ E+++ + + IE+SK              L+  +   ++   + + E+   S           +  GT+ NTP                 PP D+  T  A                                 SD  DII                  NS T+ I   + G+N      EL+                 GM  E+ N++ EN+ L+ TKNALN+VK+DLI+KLD+   E E+L+ E  +    K   + R+  LE E K +K E I+     K++ EE       N+PI+QR+RFTR EM RVLMERNQYKE+L+E++E V
Sbjct:    5 IDDGVVYQ--DDYCSGSVMSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSK--------------LQQVAGNSQSDGGDEMSESGQSSVAATP------STTGTKSNTPTSSVPSAAVTPLHESLQPPQDYGMTGKAKRSREKRHSHNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCQDPRLERTGNSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEESSSPLQDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAV 476          

HSP 3 Score: 73.559 bits (179), Expect = 2.856e-12
Identity = 50/174 (28.74%), Postives = 82/174 (47.13%), Query Frame = 2
Query: 2651 DPERQQINGWSLPRNVK-VSKASD-----VPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSD-PATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            D  R Q  GWSLP   K V +  D     VP+P+YCRPL E    +KL       CA  +++      +  +  G         V  ++    +  V  E+ ST  S   +   +    + + S VWI TS+ + S+++++DA +P   +D F + ++ + C+ S+P AS  DY
Sbjct:  584 DDGRLQACGWSLPAKYKQVGRQEDNRMKNVPVPVYCRPLVEKDPTMKLW------CAAGVDLTGWKPFEEDSGNGV------RQVPGRDPLTCDREVEGESKSTHTSPEKKKTKELHEADATSSRVWILTSTLSTSKVVIIDANQPGTLVDQFTVCNAHVLCISSIPAASDGDY 745          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 253.447 bits (646), Expect = 9.175e-68
Identity = 145/374 (38.77%), Postives = 224/374 (59.89%), Query Frame = 2
Query: 3350 QFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFV---KDSRKENELDIVNDFNDVSYSMENS--YLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCS-----LETP---PNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            Q   PN       S+ PT+W+G +NG L+VH A  N   CLH I+L DS++++++   RV V+LA+G++ +F+R    E+K    QW +S Y+L++  + ++SIRC+  V   +++W GYKN+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + +QHLQD+++EP+V+K++    LG S +RI+ L  + NR+W+GT  G+++S P     K S    E         V YS ENS     +FIP+ +    QL +HGHRD+VKFFV+V  +V  +     L++P   P    + ++   KN  L++SGGEGY DFR  +       + S   +  K   S    SH+IVWQ+
Sbjct:  944 QETEPNQEASTGTSASPTMWLGAQNGWLYVHSAVSNWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHR---GEDK----QWDLSNYHLMDLGHTHHSIRCMAVV--YDRVWCGYKNKIHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETNKTSPTSGEGTRPGGVIHV-YSDENSDKTAGSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPSENPGTPAETEEQKLKN-VLVLSGGEGYIDFRIGDGEDDETEEHSADGNQPKPVLSKAERSHIIVWQV 1306          

HSP 2 Score: 143.28 bits (360), Expect = 1.444e-33
Identity = 80/177 (45.20%), Postives = 116/177 (65.54%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK 665
            I++G +Y   +   S +V+S+ V  LAN IY+EFE LI  Y E VVK LMP+VV+ LE LD V +E    EVE ELLKED+ QL+TQYEREK  RK+ EE   + ED+  +  K  + +++ L+   + +E++ KN  DQISR E+RE E + EY+ L  R+ E+++ + + IE+SK
Sbjct:    6 IDDGVVYQ--DDYCSGSVMSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSK 180          

HSP 3 Score: 122.094 bits (305), Expect = 4.596e-27
Identity = 66/151 (43.71%), Postives = 94/151 (62.25%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEE----------NLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+ N++ EN+ L+ TKNALN+VK+DLI+KLD+   E E+L+ E  +    K   + R+  LE E K +K E I+     K++ EE          N+PI+QR+RFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  398 DVDEGADLL-------GMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEEVGISLTCFSDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAV 541          

HSP 4 Score: 72.0182 bits (175), Expect = 9.454e-12
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 2
Query: 2651 DPERQQINGWSLPRNVKV---------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSD-PATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            D  R Q  GWSLP   K          ++  +VP+P+YCRPL E    +KL       CA  +++      +  +  G         V  ++    +  V  E+ ST  S   +   +    + + S VWI TS+ + S+++++DA +P   +D F + ++ + C+ S+P AS  DY
Sbjct:  649 DDGRLQACGWSLPAKYKQLSPNGGQEDNRMKNVPVPVYCRPLVEKDPTMKLW------CAAGVDLTGWKPFEEDSGNGV------RQVPGRDPLTCDREVEGESKSTHTSPEKKKTKELHEADATSSRVWILTSTLSTSKVVIIDANQPGTLVDQFTVCNAHVLCISSIPAASDGDY 813          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 248.44 bits (633), Expect = 3.384e-66
Identity = 145/387 (37.47%), Postives = 224/387 (57.88%), Query Frame = 2
Query: 3350 QFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFV----------------KDSRKENELDIVNDFNDVSYSMENS--YLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCS-----LETP---PNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            Q   PN       S+ PT+W+G +NG L+VH A  N   CLH I+L DS++++++   RV V+LA+G++ +F+R    E+K    QW +S Y+L++  + ++SIRC+  V   +++W GYKN+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + +QHLQD+++EP+V+K++    LG S +RI+ L  + NR+W+GT  G+++S P                  K S    E         V YS ENS     +FIP+ +    QL +HGHRD+VKFFV+V  +V  +     L++P   P    + ++   KN  L++SGGEGY DFR  +       + S   +  K   S    SH+IVWQ+
Sbjct:  923 QETEPNQEASTGTSASPTMWLGAQNGWLYVHSAVSNWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHR---GEDK----QWDLSNYHLMDLGHTHHSIRCMAVV--YDRVWCGYKNKIHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGTRPGGVIHV-YSDENSDKTAGSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPSENPGTPAETEEQKLKN-VLVLSGGEGYIDFRIGDGEDDETEEHSADGNQPKPVLSKAERSHIIVWQV 1298          

HSP 2 Score: 222.631 bits (566), Expect = 4.355e-58
Identity = 171/510 (33.53%), Postives = 243/510 (47.65%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTS-----NSEALDE-NDSKSDGCNINPPNLLTELGTQINTPN---------------DPPMDWNFTPSA---------------------------------SDDGDII------------------NSSTEDI---SHGVNILPFDDELAGMSHEIENIIKENNDLIA---------------------------TKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEE-------NLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            I++G +Y   +   S +V+S+ V  LAN IY+EFE LI  Y E VVK LMP+VV+ LE LD V +E    EVE ELLKED+ QL+TQYEREK  RK+ EE   + ED+  +  K  + +++ L+   + +E++ KN  DQISR E+RE E + EY+ L  R+ E+++ + + IE+SK       +            ER TS      ++ +DE ++S        P    +  GT+ NTP                 PP D+  T  A                                 SD  DII                  NS T+ I   + G+N      EL+    E+   + E  DL+                            TKNALN+VK+DLI+KLD+   E E+L+ E  +    K   + R+  LE E K +K E I+     K++ EE       N+PI+QR+RFTR EM RVLMERNQYKE+L+E++E V
Sbjct:    6 IDDGVVYQ--DDYCSGSVMSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSKLQQVAGNSQSDGGVTGRSRKERPTSLNVFPLADGMDEMSESGQSSVAATP----STTGTKSNTPTSSVPSAAVTPLHESLQPPQDYGMTGKAKRSREKRHSHNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCQDPRLERTGNSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEESSSPLQDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAV 509          

HSP 3 Score: 71.633 bits (174), Expect = 1.044e-11
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 2
Query: 2651 DPERQQINGWSLPRNVKV---------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSD-PATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            D  R Q  GWSLP   K          ++  +VP+P+YCRPL E    +KL       CA  +++      +  +  G         V  ++    +  V  E+ ST  S   +   +    + + S VWI TS+ + S+++++DA +P   +D F + ++ + C+ S+P AS  DY
Sbjct:  628 DDGRLQACGWSLPAKYKQLSPNGGQEDNRMKNVPVPVYCRPLVEKDPTMKLW------CAAGVDLTGWKPFEEDSGNGV------RQVPGRDPLTCDREVEGESKSTHTSPEKKKTKELHEADATSSRVWILTSTLSTSKVVIIDANQPGTLVDQFTVCNAHVLCISSIPAASDGDY 792          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 248.44 bits (633), Expect = 3.395e-66
Identity = 145/387 (37.47%), Postives = 224/387 (57.88%), Query Frame = 2
Query: 3350 QFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFV----------------KDSRKENELDIVNDFNDVSYSMENS--YLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCS-----LETP---PNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            Q   PN       S+ PT+W+G +NG L+VH A  N   CLH I+L DS++++++   RV V+LA+G++ +F+R    E+K    QW +S Y+L++  + ++SIRC+  V   +++W GYKN+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + +QHLQD+++EP+V+K++    LG S +RI+ L  + NR+W+GT  G+++S P                  K S    E         V YS ENS     +FIP+ +    QL +HGHRD+VKFFV+V  +V  +     L++P   P    + ++   KN  L++SGGEGY DFR  +       + S   +  K   S    SH+IVWQ+
Sbjct:  931 QETEPNQEASTGTSASPTMWLGAQNGWLYVHSAVSNWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHR---GEDK----QWDLSNYHLMDLGHTHHSIRCMAVV--YDRVWCGYKNKIHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGTRPGGVIHV-YSDENSDKTAGSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPSENPGTPAETEEQKLKN-VLVLSGGEGYIDFRIGDGEDDETEEHSADGNQPKPVLSKAERSHIIVWQV 1306          

HSP 2 Score: 221.476 bits (563), Expect = 9.821e-58
Identity = 171/518 (33.01%), Postives = 245/518 (47.30%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK--------NHHNEIKNIEKFERLKSYSNERRTS-----NSEALDE-NDSKSDGCNINPPNLLTELGTQINTPN---------------DPPMDWNFTPSA---------------------------------SDDGDII------------------NSSTEDI---SHGVNILPFDDELAGMSHEIENIIKENNDLIA---------------------------TKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEE-------NLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            I++G +Y   +   S +V+S+ V  LAN IY+EFE LI  Y E VVK LMP+VV+ LE LD V +E    EVE ELLKED+ QL+TQYEREK  RK+ EE   + ED+  +  K  + +++ L+   + +E++ KN  DQISR E+RE E + EY+ L  R+ E+++ + + IE+SK             +      +  +    ER TS      ++ +DE ++S        P    +  GT+ NTP                 PP D+  T  A                                 SD  DII                  NS T+ I   + G+N      EL+    E+   + E  DL+                            TKNALN+VK+DLI+KLD+   E E+L+ E  +    K   + R+  LE E K +K E I+     K++ EE       N+PI+QR+RFTR EM RVLMERNQYKE+L+E++E V
Sbjct:    6 IDDGVVYQ--DDYCSGSVMSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSKLQQVAGNSQSDGGVTGRSHRQSWRKSRKERPTSLNVFPLADGMDEMSESGQSSVAATP----STTGTKSNTPTSSVPSAAVTPLHESLQPPQDYGMTGKAKRSREKRHSHNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCQDPRLERTGNSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEESSSPLQDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAV 517          

HSP 3 Score: 72.0182 bits (175), Expect = 9.295e-12
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 2
Query: 2651 DPERQQINGWSLPRNVKV---------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSD-PATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            D  R Q  GWSLP   K          ++  +VP+P+YCRPL E    +KL       CA  +++      +  +  G         V  ++    +  V  E+ ST  S   +   +    + + S VWI TS+ + S+++++DA +P   +D F + ++ + C+ S+P AS  DY
Sbjct:  636 DDGRLQACGWSLPAKYKQLSPNGGQEDNRMKNVPVPVYCRPLVEKDPTMKLW------CAAGVDLTGWKPFEEDSGNGV------RQVPGRDPLTCDREVEGESKSTHTSPEKKKTKELHEADATSSRVWILTSTLSTSKVVIIDANQPGTLVDQFTVCNAHVLCISSIPAASDGDY 800          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 248.44 bits (633), Expect = 3.500e-66
Identity = 145/387 (37.47%), Postives = 224/387 (57.88%), Query Frame = 2
Query: 3350 QFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFV----------------KDSRKENELDIVNDFNDVSYSMENS--YLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCS-----LETP---PNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            Q   PN       S+ PT+W+G +NG L+VH A  N   CLH I+L DS++++++   RV V+LA+G++ +F+R    E+K    QW +S Y+L++  + ++SIRC+  V   +++W GYKN+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + +QHLQD+++EP+V+K++    LG S +RI+ L  + NR+W+GT  G+++S P                  K S    E         V YS ENS     +FIP+ +    QL +HGHRD+VKFFV+V  +V  +     L++P   P    + ++   KN  L++SGGEGY DFR  +       + S   +  K   S    SH+IVWQ+
Sbjct:  925 QETEPNQEASTGTSASPTMWLGAQNGWLYVHSAVSNWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHR---GEDK----QWDLSNYHLMDLGHTHHSIRCMAVV--YDRVWCGYKNKIHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGTRPGGVIHV-YSDENSDKTAGSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPSENPGTPAETEEQKLKN-VLVLSGGEGYIDFRIGDGEDDETEEHSADGNQPKPVLSKAERSHIIVWQV 1300          

HSP 2 Score: 223.787 bits (569), Expect = 1.799e-58
Identity = 171/512 (33.40%), Postives = 245/512 (47.85%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK--------NHHNEIKNIEKFERLKSYSNERRTS-----NSEALDE-NDSKSDGCNINPPNLLTELGTQINTPN---------------DPPMDWNFTPSA---------------------------------SDDGDII------------------NSSTEDI---SHGVNILPFDDELAGMSHEIENIIKENNDLIA---------------------TKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEE-------NLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            I++G +Y   +   S +V+S+ V  LAN IY+EFE LI  Y E VVK LMP+VV+ LE LD V +E    EVE ELLKED+ QL+TQYEREK  RK+ EE   + ED+  +  K  + +++ L+   + +E++ KN  DQISR E+RE E + EY+ L  R+ E+++ + + IE+SK             +      +  +    ER TS      ++ +DE ++S        P    +  GT+ NTP                 PP D+  T  A                                 SD  DII                  NS T+ I   + G+N      EL+    E+   + E  DL+                      TKNALN+VK+DLI+KLD+   E E+L+ E  +    K   + R+  LE E K +K E I+     K++ EE       N+PI+QR+RFTR EM RVLMERNQYKE+L+E++E V
Sbjct:    6 IDDGVVYQ--DDYCSGSVMSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSKLQQVAGNSQSDGGVTGRSHRQSWRKSRKERPTSLNVFPLADGMDEMSESGQSSVAATP----STTGTKSNTPTSSVPSAAVTPLHESLQPPQDYGMTGKAKRSREKRHSHNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCQDPRLERTGNSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEESSSPLQDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAV 511          

HSP 3 Score: 71.633 bits (174), Expect = 1.045e-11
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 2
Query: 2651 DPERQQINGWSLPRNVKV---------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSD-PATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            D  R Q  GWSLP   K          ++  +VP+P+YCRPL E    +KL       CA  +++      +  +  G         V  ++    +  V  E+ ST  S   +   +    + + S VWI TS+ + S+++++DA +P   +D F + ++ + C+ S+P AS  DY
Sbjct:  630 DDGRLQACGWSLPAKYKQLSPNGGQEDNRMKNVPVPVYCRPLVEKDPTMKLW------CAAGVDLTGWKPFEEDSGNGV------RQVPGRDPLTCDREVEGESKSTHTSPEKKKTKELHEADATSSRVWILTSTLSTSKVVIIDANQPGTLVDQFTVCNAHVLCISSIPAASDGDY 794          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Mouse
Match: Spag9 (sperm associated antigen 9 [Source:MGI Symbol;Acc:MGI:1918084])

HSP 1 Score: 249.595 bits (636), Expect = 6.494e-67
Identity = 145/388 (37.37%), Postives = 220/388 (56.70%), Query Frame = 2
Query: 3362 PNTNTFVSNSSQ------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENS--YLP-TFIPFINHENLQLSYHGHRDSVKFFVTV----------------LVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PN        +Q      PT+W+G +NG L+VH +      CLH I+L DSI++I++    V V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+W+GT  G+I+S P  + ++               Y  ENS    P TFIP+ +  + QL +HGHRD+VKFFV V                  D   S    P+++T ++        L++SGGEGY DFR  +E   S      LP    +   +    SHLIVWQ++  N+
Sbjct:  800 PNEQDLAREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGTPGNRPGSVIRVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSGGADLTADKAGSSAQEPSSQTPLKS------MLVISGGEGYIDFRMGDEGGESELLGEDLP---LEPSVTKAERSHLIVWQVMCGNE 1169          

HSP 2 Score: 123.635 bits (309), Expect = 1.011e-27
Identity = 64/141 (45.39%), Postives = 92/141 (65.25%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L   +   GM  E+EN+I EN  L+ TKNALN+VK+DLI+K+DE   E ++LQ E  ++   K   + +   LE E +  + E      +AKDD + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  239 DVDEGADLL---EHYIGMGREVENLILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEDKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 376          

HSP 3 Score: 95.9005 bits (237), Expect = 2.927e-19
Identity = 58/178 (32.58%), Postives = 95/178 (53.37%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFY------NHENVENQNNSKVE-DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K        +K  ++P+P+Y RPL E  + +K     ++ CAV +N+         + VG+S+FY      + E  + ++ S+   D ++ E    Q    NQ       E+S S VWICTS+ + +++I++DA +P   LD+F + +S + C+ SVPGA + DY
Sbjct:  489 RVQAFGWSLPQKYKQVANGQGETKMKNLPVPVYLRPLDEKDASMK-----KLWCAVGVNLSGGKTRDGGSVVGASVFYKDIAGLDTEGSKQRSASQSSLDKLDQELKEQQKEFKNQ------EELS-SQVWICTSTHSTTKVIIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDY 654          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Mouse
Match: Spag9 (sperm associated antigen 9 [Source:MGI Symbol;Acc:MGI:1918084])

HSP 1 Score: 249.595 bits (636), Expect = 6.880e-67
Identity = 145/388 (37.37%), Postives = 220/388 (56.70%), Query Frame = 2
Query: 3362 PNTNTFVSNSSQ------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENS--YLP-TFIPFINHENLQLSYHGHRDSVKFFVTV----------------LVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PN        +Q      PT+W+G +NG L+VH +      CLH I+L DSI++I++    V V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+W+GT  G+I+S P  + ++               Y  ENS    P TFIP+ +  + QL +HGHRD+VKFFV V                  D   S    P+++T ++        L++SGGEGY DFR  +E   S      LP    +   +    SHLIVWQ++  N+
Sbjct:  795 PNEQDLAREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGTPGNRPGSVIRVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSGGADLTADKAGSSAQEPSSQTPLKS------MLVISGGEGYIDFRMGDEGGESELLGEDLP---LEPSVTKAERSHLIVWQVMCGNE 1164          

HSP 2 Score: 123.25 bits (308), Expect = 1.154e-27
Identity = 64/141 (45.39%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+EN+I EN  L+ TKNALN+VK+DLI+K+DE   E ++LQ E  ++   K   + +   LE E +  + E      +AKDD + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  239 DVDEGADLL-------GMGREVENLILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEDKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 372          

HSP 3 Score: 97.0561 bits (240), Expect = 1.508e-19
Identity = 59/178 (33.15%), Postives = 94/178 (52.81%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFY------NHENVENQNNSKVE-DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K        +K  ++P+P+Y RPL E  + +KL       CAV +N+         + VG+S+FY      + E  + ++ S+   D ++ E    Q    NQ       E+S S VWICTS+ + +++I++DA +P   LD+F + +S + C+ SVPGA + DY
Sbjct:  485 RVQAFGWSLPQKYKQVANGQGETKMKNLPVPVYLRPLDEKDASMKLW------CAVGVNLSGGKTRDGGSVVGASVFYKDIAGLDTEGSKQRSASQSSLDKLDQELKEQQKEFKNQ------EELS-SQVWICTSTHSTTKVIIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDY 649          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Mouse
Match: Spag9 (sperm associated antigen 9 [Source:MGI Symbol;Acc:MGI:1918084])

HSP 1 Score: 249.595 bits (636), Expect = 7.240e-67
Identity = 145/388 (37.37%), Postives = 220/388 (56.70%), Query Frame = 2
Query: 3362 PNTNTFVSNSSQ------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENS--YLP-TFIPFINHENLQLSYHGHRDSVKFFVTV----------------LVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PN        +Q      PT+W+G +NG L+VH +      CLH I+L DSI++I++    V V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+W+GT  G+I+S P  + ++               Y  ENS    P TFIP+ +  + QL +HGHRD+VKFFV V                  D   S    P+++T ++        L++SGGEGY DFR  +E   S      LP    +   +    SHLIVWQ++  N+
Sbjct:  799 PNEQDLAREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGTPGNRPGSVIRVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSGGADLTADKAGSSAQEPSSQTPLKS------MLVISGGEGYIDFRMGDEGGESELLGEDLP---LEPSVTKAERSHLIVWQVMCGNE 1168          

HSP 2 Score: 125.946 bits (315), Expect = 1.740e-28
Identity = 65/141 (46.10%), Postives = 93/141 (65.96%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L    E +GM  E+EN+I EN  L+ TKNALN+VK+DLI+K+DE   E ++LQ E  ++   K   + +   LE E +  + E      +AKDD + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  239 DVDEGADLL---GEYSGMGREVENLILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEDKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 376          

HSP 3 Score: 97.0561 bits (240), Expect = 1.485e-19
Identity = 59/178 (33.15%), Postives = 94/178 (52.81%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFY------NHENVENQNNSKVE-DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K        +K  ++P+P+Y RPL E  + +KL       CAV +N+         + VG+S+FY      + E  + ++ S+   D ++ E    Q    NQ       E+S S VWICTS+ + +++I++DA +P   LD+F + +S + C+ SVPGA + DY
Sbjct:  489 RVQAFGWSLPQKYKQVANGQGETKMKNLPVPVYLRPLDEKDASMKLW------CAVGVNLSGGKTRDGGSVVGASVFYKDIAGLDTEGSKQRSASQSSLDKLDQELKEQQKEFKNQ------EELS-SQVWICTSTHSTTKVIIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDY 653          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Mouse
Match: Spag9 (sperm associated antigen 9 [Source:MGI Symbol;Acc:MGI:1918084])

HSP 1 Score: 249.21 bits (635), Expect = 8.390e-67
Identity = 145/388 (37.37%), Postives = 220/388 (56.70%), Query Frame = 2
Query: 3362 PNTNTFVSNSSQ------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENS--YLP-TFIPFINHENLQLSYHGHRDSVKFFVTV----------------LVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PN        +Q      PT+W+G +NG L+VH +      CLH I+L DSI++I++    V V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+W+GT  G+I+S P  + ++               Y  ENS    P TFIP+ +  + QL +HGHRD+VKFFV V                  D   S    P+++T ++        L++SGGEGY DFR  +E   S      LP    +   +    SHLIVWQ++  N+
Sbjct:  800 PNEQDLAREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGTPGNRPGSVIRVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSGGADLTADKAGSSAQEPSSQTPLKS------MLVISGGEGYIDFRMGDEGGESELLGEDLP---LEPSVTKAERSHLIVWQVMCGNE 1169          

HSP 2 Score: 124.79 bits (312), Expect = 4.473e-28
Identity = 65/141 (46.10%), Postives = 92/141 (65.25%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L  D    GM  E+EN+I EN  L+ TKNALN+VK+DLI+K+DE   E ++LQ E  ++   K   + +   LE E +  + E      +AKDD + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  239 DVDEGADLL--DHNFFGMGREVENLILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEDKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 377          

HSP 3 Score: 97.0561 bits (240), Expect = 1.436e-19
Identity = 59/178 (33.15%), Postives = 94/178 (52.81%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFY------NHENVENQNNSKVE-DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K        +K  ++P+P+Y RPL E  + +KL       CAV +N+         + VG+S+FY      + E  + ++ S+   D ++ E    Q    NQ       E+S S VWICTS+ + +++I++DA +P   LD+F + +S + C+ SVPGA + DY
Sbjct:  490 RVQAFGWSLPQKYKQVANGQGETKMKNLPVPVYLRPLDEKDASMKLW------CAVGVNLSGGKTRDGGSVVGASVFYKDIAGLDTEGSKQRSASQSSLDKLDQELKEQQKEFKNQ------EELS-SQVWICTSTHSTTKVIIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDY 654          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Mouse
Match: Spag9 (sperm associated antigen 9 [Source:MGI Symbol;Acc:MGI:1918084])

HSP 1 Score: 249.595 bits (636), Expect = 1.146e-66
Identity = 145/388 (37.37%), Postives = 220/388 (56.70%), Query Frame = 2
Query: 3362 PNTNTFVSNSSQ------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENS--YLP-TFIPFINHENLQLSYHGHRDSVKFFVTV----------------LVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PN        +Q      PT+W+G +NG L+VH +      CLH I+L DSI++I++    V V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+W+GT  G+I+S P  + ++               Y  ENS    P TFIP+ +  + QL +HGHRD+VKFFV V                  D   S    P+++T ++        L++SGGEGY DFR  +E   S      LP    +   +    SHLIVWQ++  N+
Sbjct:  938 PNEQDLAREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGTPGNRPGSVIRVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSGGADLTADKAGSSAQEPSSQTPLKS------MLVISGGEGYIDFRMGDEGGESELLGEDLP---LEPSVTKAERSHLIVWQVMCGNE 1307          

HSP 2 Score: 139.428 bits (350), Expect = 1.682e-32
Identity = 76/180 (42.22%), Postives = 113/180 (62.78%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHH 674
            + +G +Y   E   S  V+S+ V  LA  IY+EFE LI  Y E VVK LMP+VV+ LE LD V+++    +VE ELL++D+ QL+TQYEREK  RK  EE   + EDS  +  K  +  ++ L+S  + +E++ KN  DQISR E+RE E + EY+ L  R+ E++  + + +E++K H 
Sbjct:    3 LEDGVVYQE-EPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQ 181          

HSP 3 Score: 124.02 bits (310), Expect = 9.330e-28
Identity = 64/141 (45.39%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+EN+I EN  L+ TKNALN+VK+DLI+K+DE   E ++LQ E  ++   K   + +   LE E +  + E      +AKDD + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  382 DVDEGADLL-------GMGREVENLILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEDKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 515          

HSP 4 Score: 97.0561 bits (240), Expect = 1.274e-19
Identity = 59/178 (33.15%), Postives = 94/178 (52.81%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFY------NHENVENQNNSKVE-DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K        +K  ++P+P+Y RPL E  + +KL       CAV +N+         + VG+S+FY      + E  + ++ S+   D ++ E    Q    NQ       E+S S VWICTS+ + +++I++DA +P   LD+F + +S + C+ SVPGA + DY
Sbjct:  628 RVQAFGWSLPQKYKQVANGQGETKMKNLPVPVYLRPLDEKDASMKLW------CAVGVNLSGGKTRDGGSVVGASVFYKDIAGLDTEGSKQRSASQSSLDKLDQELKEQQKEFKNQ------EELS-SQVWICTSTHSTTKVIIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDY 792          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. UniProt/SwissProt
Match: sp|O60271|JIP4_HUMAN (C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4)

HSP 1 Score: 251.136 bits (640), Expect = 2.624e-66
Identity = 149/404 (36.88%), Postives = 228/404 (56.44%), Query Frame = 2
Query: 3329 TNQYVDDQFKSPNTNTFVSNSSQ------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPF--------VKDSRKENELDIVNDFNDVSYSMENSYLP-TFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETP---------------PNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            ++ Y D     PN    V   +Q      PT+W+G +NG L+VH +      CLH I+L DSI++I++    V V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+W+GT  G+I+S P         V  +R  + + +  D N       +   P TFIP+ +  + QL +HGHRD+VKFFV     VP  + +P               P+ +      P K+  L++SGGEGY DFR  +E   S      LP    +   +    SHLIVWQ++  N+
Sbjct:  941 SDAYKDQISVLPNEQDLVREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVIRVYGDENS------DKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVA----VPGQVISPQSSSSGTDLTGDKAGPSAQEPGSQTPLKS-MLVISGGEGYIDFRMGDEGGESELLGEDLP---LEPSVTKAERSHLIVWQVMYGNE 1321          

HSP 2 Score: 139.428 bits (350), Expect = 1.129e-31
Identity = 76/180 (42.22%), Postives = 113/180 (62.78%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHH 674
            + +G +Y   E   S  V+S+ V  LA  IY+EFE LI  Y E VVK LMP+VV+ LE LD V+++    +VE ELL++D+ QL+TQYEREK  RK  EE   + EDS  +  K  +  ++ L+S  + +E++ KN  DQISR E+RE E + EY+ L  R+ E++  + + +E++K H 
Sbjct:    3 LEDGVVYQE-EPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQ 181          

HSP 3 Score: 119.398 bits (298), Expect = 1.380e-25
Identity = 65/141 (46.10%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+EN+I EN  L+ TKNALNIVK+DLI+K+DE   E ++LQ E  ++   K   + +   LE E +  + E      +AKDD + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  396 DVDEGADLL-------GMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 529          

HSP 4 Score: 95.5153 bits (236), Expect = 3.296e-18
Identity = 58/178 (32.58%), Postives = 91/178 (51.12%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVE-------DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K        +K  ++P+P+Y RPL E  + +KL       CAV +N+         + VG+S+FY      +   SK         D ++ E    Q  + NQ       E+S S VWICTS+ + ++++++DA +P   LD+F + +S + C+ SVPGA + DY
Sbjct:  642 RVQAFGWSLPQKYKQVTNGQGENKMKNLPVPVYLRPLDEKDTSMKLW------CAVGVNLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQ------EELS-SLVWICTSTHSATKVLIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDY 806          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. UniProt/SwissProt
Match: sp|E9PSK7|JIP3_RAT (C-Jun-amino-terminal kinase-interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Mapk8ip3 PE=1 SV=2)

HSP 1 Score: 250.366 bits (638), Expect = 4.847e-66
Identity = 199/700 (28.43%), Postives = 323/700 (46.14%), Query Frame = 2
Query: 2651 DPERQQINGWSLPRNVKV---------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSD-PATEISDSHVWICTSSDNESQII---------VVDAFR------------PAK----------YLDAFI------------------------IRSSPIQCLGSVP--GASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLES-----PATNENAASSLSNKSHT---NQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFV----------------KDSRKENEL----DIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTV-----------LVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            D  R Q  GWSLP   K          ++  +VP+P+YCRPL E     KL   A +N +      E  +   K   G          E             E  ST  S   +   + P  + + S VWI TS+   S+++         VVD F             PA           +LD+ +                        +  S     G  P     Q D    +    + S  TE+    +++ D    + +  TV    L       PA  +++++  ++++ +      V  Q +    ++  ++S+ PT+W+G +NG L+VH A  N   CLH I+L DS++++++   RV V+LA+G++ +F+R    E+    GQW +S Y+L++  + ++SIRC+  V+  +++W GYKN++ V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + +QHLQD+++EP+V+K++    LG S +RI+ L  + NR+W+GT  G+++S P                  K S    E      I++ + D S     S   +FIP+ +    QL +HGHRD+VKFFV+V           ++D P     P       +    KN  L++SGGEGY DFR  +       + +   +  K   S    SH+IVWQ+
Sbjct:  643 DDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPSTKLWCAAGVNLSGWKPNEEDSSNGPKPAPGRDPLTCDREGEG------------EPKSTHPSPEKKKAKEVPEADATSSRVWILTSTLTTSKVVIIDANQPGTVVDQFTVCNAHVLCISSIPAASDSDYPPGDMFLDSDVNPEDSGADGVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGDVAATANGKVNPSQSTEEATEATEVPDPGPSESEATTVRPGPLTEHVFTDPAPTQSSSTQPASENGSESDGSIVQPQVEPSGESSATTSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHR---GED----GQWDLSNYHLMDLGHPHHSIRCMAVVD--DRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGTRPGGIIHVYGDDSSDKTAS---SFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPSEGPGPAAPAADAEGQKLKN-ALVLSGGEGYIDFRIGDGEDDETEEGTGDVNQTKPSLSKAERSHIIVWQV 1317          

HSP 2 Score: 138.658 bits (348), Expect = 1.864e-31
Identity = 75/163 (46.01%), Postives = 108/163 (66.26%), Query Frame = 3
Query:  177 SNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK 665
            S +V+S+ V  LA  IY+EFE LI  Y E VVK LMP+VV+ LE LD V SE    EVE ELL+ED+ QL+TQYEREK  RK+ EE   + ED+  +  K+ + +++  +   + +E++ KN  DQISR E+RE E + EY+ L  R+ E+++ + + IE+SK
Sbjct:   21 SGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSK 183          

HSP 3 Score: 122.479 bits (306), Expect = 1.616e-26
Identity = 62/142 (43.66%), Postives = 96/142 (67.61%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEEN-LPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L    E +GM  E+ N++ EN+ L+ TKNALN+VK+DLI+K+D+ + E E+L+ E  +    K   + RI  LE E K +K E +      +++ E++ +P++QR+RFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  397 DVDEGADLL---GEFSGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELKRVKSEAVTARREPREEVEDDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAV 535          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. UniProt/SwissProt
Match: sp|Q58A65|JIP4_MOUSE (C-Jun-amino-terminal kinase-interacting protein 4 OS=Mus musculus OX=10090 GN=Spag9 PE=1 SV=2)

HSP 1 Score: 249.595 bits (636), Expect = 9.611e-66
Identity = 145/388 (37.37%), Postives = 220/388 (56.70%), Query Frame = 2
Query: 3362 PNTNTFVSNSSQ------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENS--YLP-TFIPFINHENLQLSYHGHRDSVKFFVTV----------------LVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PN        +Q      PT+W+G +NG L+VH +      CLH I+L DSI++I++    V V+LA+G++ +F+R +        GQW +S Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+W+GT  G+I+S P  + ++               Y  ENS    P TFIP+ +  + QL +HGHRD+VKFFV V                  D   S    P+++T ++        L++SGGEGY DFR  +E   S      LP    +   +    SHLIVWQ++  N+
Sbjct:  952 PNEQDLAREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVD-------GQWDLSNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGTPGNRPGSVIRVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSGGADLTADKAGSSAQEPSSQTPLKS------MLVISGGEGYIDFRMGDEGGESELLGEDLP---LEPSVTKAERSHLIVWQVMCGNE 1321          

HSP 2 Score: 139.043 bits (349), Expect = 1.372e-31
Identity = 76/180 (42.22%), Postives = 113/180 (62.78%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHH 674
            + +G +Y   E   S  V+S+ V  LA  IY+EFE LI  Y E VVK LMP+VV+ LE LD V+++    +VE ELL++D+ QL+TQYEREK  RK  EE   + EDS  +  K  +  ++ L+S  + +E++ KN  DQISR E+RE E + EY+ L  R+ E++  + + +E++K H 
Sbjct:    3 LEDGVVYQE-EPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQ 181          

HSP 3 Score: 123.635 bits (309), Expect = 6.978e-27
Identity = 64/141 (45.39%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L       GM  E+EN+I EN  L+ TKNALN+VK+DLI+K+DE   E ++LQ E  ++   K   + +   LE E +  + E      +AKDD + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  396 DVDEGADLL-------GMGREVENLILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEDKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 529          

HSP 4 Score: 97.0561 bits (240), Expect = 9.581e-19
Identity = 59/178 (33.15%), Postives = 94/178 (52.81%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKV-------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFY------NHENVENQNNSKVE-DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K        +K  ++P+P+Y RPL E  + +KL       CAV +N+         + VG+S+FY      + E  + ++ S+   D ++ E    Q    NQ       E+S S VWICTS+ + +++I++DA +P   LD+F + +S + C+ SVPGA + DY
Sbjct:  642 RVQAFGWSLPQKYKQVANGQGETKMKNLPVPVYLRPLDEKDASMKLW------CAVGVNLSGGKTRDGGSVVGASVFYKDIAGLDTEGSKQRSASQSSLDKLDQELKEQQKEFKNQ------EELS-SQVWICTSTHSTTKVIIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDY 806          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. UniProt/SwissProt
Match: sp|Q29EP6|JIP3_DROPS (JNK-interacting protein 3 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=syd PE=3 SV=2)

HSP 1 Score: 243.817 bits (621), Expect = 3.858e-64
Identity = 171/477 (35.85%), Postives = 259/477 (54.30%), Query Frame = 3
Query:  114 DSIYFTSINEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK----NHHNEIKNI-EKFERLKSYSNE-RRTS-----------NSEALDENDSKSDGC---NINPPNLLTELGT-------------------QINTPNDPPMDWNFTPSASDDGDIINSSTE------------------------DISHGVNILP------FDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            +++Y T  N     + + SE ++ VVS  V  LA  IY+EFE +I  Y E VVKNLMP++V+ LE LD  Y      +VE ELL+ED+ QL+TQYEREK  RK++E+ L ++ED   + +K+    L+ ++S  +M+E++ KNSL+  SR E+RE + + EY++L  RY EL + H D++E++K    + H+++    ++ E  ++  N   R+S           NS  LD     S G    +  PP+L  EL                     Q  +P  PP      P+     ++  S+T+                        +I  G  + P       +D   GM  E+EN+I ENN+L+ATKNALNIVKDDLI K+DE   E+EI++ E +++   +T  + RI+ LE E K  K ++  Q+   +   E ++P++QRKRFTR EM  VLMERNQYKE+L+E++E V
Sbjct:   19 ETVYGTEDN-----NMVMSEKNDQVVS-IVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVELELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEERETDLKKEYNKLHERYTELFKNHVDYMERTKMLMGSTHSQMSTASDRMEVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVGSQSDDSGPPSLQNELDMSLPSTAERGAATDSLQQQHQATSPQSPPDTSPVVPNVP-PANVGRSTTKKEQRSDNNLYQELSFQDNEESEENEIVTGCWVHPGEYASSANDNYFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELSAMQQSRTKLRQRISELEEELKKTKEQVKQQNTEQE---ENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAV 485          

HSP 2 Score: 225.328 bits (573), Expect = 3.196e-58
Identity = 120/313 (38.34%), Postives = 183/313 (58.47%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNEN 4336
            PT+W+G ++G L+VH        CLH + L D+++ I++  +RV V+LAN  + VF R          GQW ++ Y+L+     N+SIRCL       +IW  ++N+I ++D +SL +    +AHPR +  VRQM   G G+WVS+RLD+TLRL++ + ++H QD+++EP+V+K++    LG S +RI+ L  SCNR+WIGT+ G+I+S P  +  +K +        +D    M         P     N QLS+HGHRD+VKFFV+V       +   PN    +  V ++   L+M GGEGY DFR N+N
Sbjct:  924 PTMWMGAQDGWLYVHSGVGRWHECLHRVLLPDAVLAIVHVEARVVVALANAQLAVFRRQTD-------GQWDLNSYHLVTLGDRNHSIRCL--CVAGERIWAAHRNKIFIVDPISLNIVHSLDAHPRKESQVRQMAATGAGVWVSIRLDSTLRLYNTHTFEHKQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWIGTSNGVIISVPLAEVQQKTS--------SDPHGQM---------PLCCMANAQLSFHGHRDAVKFFVSV------PMLQQPNLNGGLTFVNKRPDMLVMCGGEGYIDFRINDN 1204          

HSP 3 Score: 84.7297 bits (208), Expect = 5.257e-15
Identity = 66/222 (29.73%), Postives = 104/222 (46.85%), Query Frame = 2
Query: 2540 PSLNEKSVAEVNSTDMPKRTSSFIENTELSSN---------CSASRDPERQQINGWSLPRNVKVSKA------SDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHEN---VENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            P ++  S    N+  MPK  S    +  +S+              ++  R    GWSLP N    +A        VP+P+YC PL+E    +K+       CA  +N+H  F    ++ + +   Y  ++   +    +   E SV  E    Q++ ++    +P T++S S VWICTS+   S + VVDA + A  LDAF I SS + C+ SV GA ++DY
Sbjct:  567 PPMHPASAGLANALVMPKDYSEDGGSERISARRREQYRQLRAHVQKEDGRLHAYGWSLPINKANQEANPSRHSGGVPVPVYCNPLAEASPHMKVF------CAAGVNLHGGFTKDGQSLIPADSPYAPKSTLKITEITSPTAEQSV--EALDRQIARASLETLEPETQLS-SFVWICTSTHAASTVSVVDANQSATVLDAFPICSSHLLCIASVQGAMESDY 779          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. UniProt/SwissProt
Match: sp|Q9UPT6|JIP3_HUMAN (C-Jun-amino-terminal kinase-interacting protein 3 OS=Homo sapiens OX=9606 GN=MAPK8IP3 PE=1 SV=3)

HSP 1 Score: 241.121 bits (614), Expect = 3.880e-63
Identity = 137/384 (35.68%), Postives = 222/384 (57.81%), Query Frame = 2
Query: 3374 TFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFV----------------KDSRKENEL----DIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTV-----------LVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            T   +S+ PT+W+G +NG L+VH A  N   CLH I+L DS++++++   RV V+LA+G++ +F+R    E+    GQW +S Y+L++  + ++SIRC+  V   +++W GYKN++ V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + +QHLQD+++EP+V+K++    LG S +RI+ L  + +R+W+GT  G+++S P                  K S    E      I++ + D S     S   +FIP+ +    QL +HGHRD+VKFFV+V           ++D P     P    ++++    +N  L++SGGEGY DFR  +       + +   S  K   S    SH+IVWQ+
Sbjct:  961 TGAGSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHR---GED----GQWDLSNYHLMDLGHPHHSIRCMAVV--YDRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLVAGSRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGARPGGIIHVYGDDSSDRAAS---SFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPAEGPGPAAPASEVEGQKLRN-VLVLSGGEGYIDFRIGDGEDDETEEGAGDMSQVKPVLSKAERSHIIVWQV 1331          

HSP 2 Score: 137.502 bits (345), Expect = 4.287e-31
Identity = 74/163 (45.40%), Postives = 108/163 (66.26%), Query Frame = 3
Query:  177 SNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK 665
            S +V+S+ V  LA  IY+EFE LI  Y E VVK LMP+VV+ LE LD V SE    EVE ELL+ED+ QL+TQYEREK  R++ EE   + ED+  +  K+ + +++  +   + +E++ KN  DQISR E+RE E + EY+ L  R+ E+++ + + IE+SK
Sbjct:   21 SGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSK 183          

HSP 3 Score: 120.553 bits (301), Expect = 7.238e-26
Identity = 64/154 (41.56%), Postives = 96/154 (62.34%), Query Frame = 3
Query:  915 DISHGVNIL---PFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGE----------ENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L      D+  GM  E+ N++ EN+ L+ TKNALN+VK+DLI+K+D+ + E E+L+ E  +    K   + RI  LE E K +K E I+     K++ E          + +P++QR+RFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  396 DVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAV 549          

HSP 4 Score: 71.633 bits (174), Expect = 6.380e-11
Identity = 48/177 (27.12%), Postives = 83/177 (46.89%), Query Frame = 2
Query: 2651 DPERQQINGWSLPRNVKV---------SKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSD-PATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            D  R Q  GWSLP   K          ++  +VP+P+YCRPL E    +KL       CA  +N+       N+   G+ +    +    ++    +   + E  S   S   +   + P  + + S VWI TS+   S+++++DA +P   +D F + ++ + C+ S+P AS +DY
Sbjct:  657 DDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLW------CAAGVNL--SGWRPNEDDAGNGV----KPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTLTTSKVVIIDANQPGTVVDQFTVCNAHVLCISSIPAASDSDY 821          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. TrEMBL
Match: A0A232EYH2 (Uncharacterized protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_005132 PE=4 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 3.804e-90
Identity = 210/638 (32.92%), Postives = 325/638 (50.94%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVE--DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQ------NDYIHVSIDVSSKSTVTEKTDH--------ISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHT-------------------NQYVDDQFKSPNTNTFVSNSS--QPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIV------NDFNDVS---YSMENSYLP-TFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            R Q  GWSLP          VP+P+YCRPL E + G+K      I C   +N+         + VG S+FY  E  E  ++ K E  D+V   +   Q S   + +++   +   SHVWICTS+   S++ V+DA  PA+ L+ F +  S + C+ SVPGA +      NDY+ V  ++ +++ +    ++        I +I  S     + KT    ++ S  +      SL   + T                       DD  K+   +  +   S  QPT+W+G +NG +FVH A    S+CLH +QL D+ + I++   RV V+LA+G+V +F R +        GQW +S+Y+++      +SIRC+ SV L   +W GY+N+I V+D +SL+L    +AHPR +  VRQ+   G+G+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  S NR+WIGT  G+I+S P  + +     +  V       D   V    ++ ++   P +F+P+ +  + QLS+HGHRD+VK FV V          P +          +   L++SGGEGY DFR  +   +             N E     SHLIVWQ+
Sbjct:  635 RLQAYGWSLPGKPSAPTRQPVPVPVYCRPLQETEPGMK------IWCGAGVNMSGGKTRDGGSMVGGSVFYAAEAREINSDLKAEPEDAVEHLDKELQESEQRRLEAERQEQQLTSHVWICTSTQKMSKVTVIDANNPAEILEVFNVCESHLLCIASVPGAKESDYGDINDYVQVDKEIDNQAEIALSEENQAETGEPKIVEITKSGNTSPEEKTEQPREVGSDPSLATEPPSLEVDAETVNLGKVRFVKTPPESISLPETTKDDDEKADEGDAPIEKMSSIQPTMWLGAQNGAVFVHSAVAKWSVCLHTVQLQDAALAIVHIQGRVLVALADGTVAIFRRGVD-------GQWDLSQYHVITLGSPQHSIRCM-SVVLGKTVWCGYRNKIHVIDPISLSLECTVDAHPRRESQVRQLAWLGEGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLISSNRLWIGTGNGVIISVPLSESAGGSMAVSRVQTGSGKGDAPGVGVRVFASDHGVTPGSFVPYCSMAHAQLSFHGHRDAVKMFVAV----------PGHGGQSAASDNSQPAMLVLSGGEGYIDFRVGDGEDAEEGIDRATVQAVSNTEEQGEQSHLIVWQV 1248          

HSP 2 Score: 124.79 bits (312), Expect = 8.532e-25
Identity = 74/199 (37.19%), Postives = 111/199 (55.78%), Query Frame = 3
Query:  171 ETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQ----------------------------------ISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK 665
            E S+ V+S+ V +LA  IY+EFE +I  Y E VVK LMP++V+ LE LD  Y++    EVE ELL+ED+ QL+TQYEREK  RK +++ L + ED+  +  K+   ++  L+S  +M+E++ KNS D                                   + R E++E E + EY RL  RY EL + H D++E++K
Sbjct:   16 EDSHVVMSEKVQSLAGSIYQEFERMIARYDEDVVKELMPLLVNVLECLDIAYTQNQEHEVELELLREDNEQLVTQYEREKQLRKTSDQKLLELEDAAEDERKELVSKIDSLESIVRMLELKTKNSHDHGTNVNVNSSQRKTPHSRVDVRGTYSFCKIILLILVVRLEEKESELKREYSRLHDRYTELFKTHVDYMERTK 214          

HSP 3 Score: 121.709 bits (304), Expect = 8.155e-24
Identity = 68/131 (51.91%), Postives = 88/131 (67.18%), Query Frame = 3
Query:  945 FDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
             +D   GM  E+EN+I ENN+L+ATKNALNIVKDDLI K+DE   E E+L+ E   L+  +   + R+  LE E K +K E        K D EE +P++QRKRFTR EM RVLMERNQYKE+ +E++E V
Sbjct:  393 VNDNFFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEQEVLREEIRGLHQARDRLRQRVLALEEELKKVKEEAETAAKATKSDDEEEVPLAQRKRFTRAEMARVLMERNQYKERFMELQEAV 523          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. TrEMBL
Match: A0A1Y1LUY3 (RH2 domain-containing protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 5.447e-90
Identity = 213/622 (34.24%), Postives = 328/622 (52.73%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKVSKASD--------VPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHE-NVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKT-DHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPN-------------TNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLP-TFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVP------RKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLL 4435
            R Q  GWSLP     +  S         VP+P+YCRPL+E   G+K      I CA  +N+   +       VG S+FY  E  VE      VE      N++ + ++         T++S S+VWI TS+ + S + V+DA  PA+ L++F + S+ + C+ SVPGAS NDY++      +  ++ EK+ D  S I DS  PK   + VD   +    +      ++ NK    +  D +    N             TN  + +S   T+W+G +NG LF+H A  N + CLH ++LSD++++I++ +  V V+LANG+V VF R I        G+W +S+Y+L++     +SIRCL  V   +K+W GY+N++ VLD   L +    EAHPR +  V+Q+   G+G+WVS+RLD+TLRL+H + YQHLQD++++P+V+K++    +G S +RI+ L  S NR+WIGT  G+I+S P   +S       +          +  + +P ++IP+ +  + QLS+HGHRD VKFFV+V  +   S  + P+  T     P           L+MSGG+GY DFR  E+ +      S                HL+VWQLL
Sbjct:  226 RLQAYGWSLPGKTSSASKSTHSSSGGVPVPVPVYCRPLAETSPGMK------IWCAAGVNLMGGYTRDGGLMVGGSVFYYEEPEVEKAPTDDVESLDKELNANREAALLE-------TKLS-SYVWIGTSTHSASIVTVIDANNPAEILNSFGVCSNHLLCIASVPGASCNDYVYNKNSTKANISLDEKSLDDDSGIGDSN-PKNS-EEVDPELVVGKVSFVEYNDTVKNKKDKRKPADQEVAGENATESPPVENSDESTNHKLMSSVLATMWLGAQNGMLFIHSAVANWNQCLHSVKLSDAVLSIVHVDGSVVVALANGTVAVFYRDIE-------GEWDLSQYHLVQLGLPQHSIRCLSVVG--DKVWCGYRNKVHVLDPRDLKVVHTLEAHPRKESQVKQLAWLGEGVWVSIRLDSTLRLYHAHTYQHLQDVDIDPYVSKMLGTGKVGFSFVRITALLISSNRLWIGTGNGVIISVPL-SESGGSCAAIVPRGTILPGAGVRVTPIPGSYIPYCSMAHAQLSFHGHRDPVKFFVSVPGNGGMSAASTPSEATSAAVTPINGPMKTPAAMLVMSGGDGYIDFRIEEDANEPKDVAS----------------HLLVWQLL 805          

HSP 2 Score: 125.176 bits (313), Expect = 4.800e-25
Identity = 66/124 (53.23%), Postives = 89/124 (71.77%), Query Frame = 3
Query:  966 MSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            M  E+EN+I ENN+L+ATKNALN+VKDDLI K+DE   E+E+L+ E  SLN  +   + R+ +LE E K L+ E       A +D E ++P++QRKRFTR EM RVLMERNQYKE+ +E++E V
Sbjct:    1 MGKEVENLIMENNELLATKNALNVVKDDLIVKVDELTGEVEMLREEILSLNMSRDKLRNRVTDLEDELKKLR-EANENKLEANED-EADIPMAQRKRFTRTEMARVLMERNQYKERFMELQEAV 122          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. TrEMBL
Match: T1IY26 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 7.546e-90
Identity = 230/683 (33.67%), Postives = 357/683 (52.27%), Query Frame = 2
Query: 2648 RDPERQQINGWSLPRNVK--VSKASD-------------VPIPIYCRPLSENQ-------SGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY-IHVSIDVSSKSTVTEKTDHI--SQIQDSFFPKFKLKTV---DCYQLE-----SPATNENAASSLSNKSHTNQYVDD----QFKSPN-----------------------TNTFVSNSSQ------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFV-KDSRKENELDIVNDFNDVS-----YSMENSYLP--TFIPFINHENLQLSYHGHRDSVKFFVTVL----------VDVPCSLETPPNNKTQIQDVP--RKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXX--XXXXXXXXXHLIVWQL 4432
            +D  R Q  GWSLP      VSK S+             VP+P+YCRPL E Q          K    +EI CA  +N+         + VG+SIFY++ + +   + +V+  V   N   +    ++ +S+   +   S VWICTS+ ++S++ V+DA  PA  LDAF + +S + C+ SVPGA +NDY +   I++  ++  + +++ +  S+  D+   + K+ +V    C   E     SP   + +   + N+  +N+   +    Q   P+                       TN  V    +      PTIW+G ++G+LFVH A     LCLH I+L DSI+++ +   RV V++A+G++ VF R          GQW ++ Y+LL+    ++SIRC+  V+  N IW GY+N+I V+D  +L L K F+AHPR +  VRQM   GDG+WVS+RLD+TLRL+H + YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+W+GT  G+I+S P   KD+++     +++           Y+  N  L   +FIP+ +    QLS+HGHRD+VKFFV+V              P SLE   NN +   D    +    L++SGGEGY DFR  +     +   +  + + K  +  S    SHLIVWQ+
Sbjct:  588 KDDGRMQAYGWSLPAKTSSLVSKPSNLDVTSTKSNSHVPVPVPVYCRPLMEKQRESFADEKDDKNFEISEIWCATGVNLTGGRTRDGGSIVGASIFYSNSSEKEDKSHEVKSEVEQLNQELKDQERDRIESEELEKSLSSLVWICTSTHSKSKVSVIDANNPADILDAFDVCTSHLLCIASVPGAKENDYSLDYDINLCVRNEYSNESEEVDKSRGDDASGTESKIGSVTFVSCLSEENKSSSSPTPGKGSTEEIGNEPRSNEGESEVEVAQMAHPDNRERRMTNESSDAIKDGISEINRTNEVVYEEMEKMSSVLPTIWLGSQSGNLFVHSAVAQWRLCLHSIKLKDSILSVAHVKGRVLVAMADGTLAVFRRGKD-------GQWDLNNYHLLDLGRPHHSIRCVAVVH--NVIWCGYRNKIHVVDPKTLKLEKSFDAHPRKESQVRQMAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALHISCNRLWMGTGNGVIISVPLSDKDAKQSCSSSMISGGKTPGGVVRVYANPNDKLTPGSFIPYCSMAQAQLSFHGHRDAVKFFVSVPGSGGMSAASNSSRPQSLE---NNSSLESDEAFNKAKSMLVLSGGEGYIDFRIGDGEDEENEALATREISEKPPHTLSKVERSHLIVWQV 1258          

HSP 2 Score: 136.732 bits (343), Expect = 2.321e-28
Identity = 70/127 (55.12%), Postives = 92/127 (72.44%), Query Frame = 3
Query:  957 LAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            L GM  E+EN+I+ENN+L+A KNALN+VKDDLI++LD+  SE EIL  E +SL  +K   + RI +LE E K +K E        K D EE++P++QRKRFTR EM RVLMERNQYKE+ +E++E V
Sbjct:  355 LDGMGKEVENLIQENNELLAMKNALNVVKDDLIAQLDDITSEHEILVQEVHSLKAVKEKMRQRILDLEDELKKIKEEAEKNTKTPKSDDEEDVPMAQRKRFTRVEMARVLMERNQYKERFMELQEAV 481          

HSP 3 Score: 134.806 bits (338), Expect = 9.431e-28
Identity = 71/165 (43.03%), Postives = 114/165 (69.09%), Query Frame = 3
Query:  171 ETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK 665
            E  + V+S+ V + A+ IY+EFE +I  Y + VVK+LMP+VV+ LE+LD  +++    EVE EL ++D+ QLMTQYEREK  RK  E+   + ED+  E +K+ + +++ L+S  +M+E++ KNS D ++R E++E E + EY++L  RY EL + H D+IE++K
Sbjct:   13 EDPHAVMSEKVQSWASSIYQEFERMITKYDQDVVKDLMPLVVTVLESLDISFTQSQEHEVELELQRDDNEQLMTQYEREKQLRKAAEQKCLEMEDAIEEETKEFQSKIESLESIVRMLELKSKNSTDHVTRLEEKEGEMKKEYNKLHDRYTELFKTHMDYIERTK 177          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. TrEMBL
Match: A0A3Q2XQX8 (Sperm associated antigen 9 OS=Hippocampus comes OX=109280 GN=SPAG9 PE=4 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 6.448e-89
Identity = 207/655 (31.60%), Postives = 329/655 (50.23%), Query Frame = 2
Query: 2660 RQQINGWSLPR----NVKVSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY-IHVSIDVSSKSTVTEKT-----DHISQIQDSFFPKFKL------------KTVDCYQLES---PATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQ--------------------PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVS------------YSMENS---YLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKN---RFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLL 4435
            R Q  GWSLP+    N    K  D+P+P++ RPL E  + +KL       CA  +++         + VG+S+FY++ +       K     + E    +L    Q +     E+S S VWICTS+ + ++ +V+DA +P   LD+FI+  + + C+ SVPGA + DY     + +SS++   EK         +   D       +            +T D    E+     T E+  S+     ++     D      T    + SSQ                    PT+W+G +NG ++VH +    + CLH ++L DS++ I++   RV V L++G++ +F+R          GQW ++ Y+LL+    +YSIRC+  V+  +K+W G++N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRLFH + +QHLQD+++EP+V+K++    LG S +RI+ L  SCNR+WIGT  G+I+S P V+ +R    L  +                   Y  E+S      TF+P+ +  + QL +HGHRD+VKFF  V      S  +  ++KT   D P ++     L+MSGGEGY DFR  +           P    ++  S    SHLIVWQ++
Sbjct:  120 RLQAYGWSLPKKHKNNGGQEKMKDLPVPVFLRPLDEKDASMKLW------CAAGVHLSGGKTRDGGSIVGASVFYSNVSGPESPKKKTGSQSSLEKLDQELK-EQQKELRQHDELS-SLVWICTSTQSTTKAVVIDANQPGIILDSFIVCDAHVLCITSVPGARETDYPAGEELTLSSETAPVEKACLSNSSSSTASSDGVLGGITVVGCTAEGATAVPQTADGAGKENGEMETTEESGGSARQRGVYSEYAFTDPLGLQQTAEASTKSSQSADSEQDLMREEAQKMSSVLPTMWLGAQNGCVYVHSSVSQWTKCLHSVKLKDSVLGIVHVKGRVLVGLSDGTLAIFHRGAD-------GQWDLTNYHLLDLGKPHYSIRCMTVVH--DKVWCGFRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWDGDGIWVSIRLDSTLRLFHAHTFQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWIGTGNGVIISIPLVETNRGSGNLVFIFAAKPTKGTGNHPGSEIRIYGDESSDKVAAGTFVPYCSMAHAQLCFHGHRDAVKFFTAVPGHALPSTSSCGDDKT--SDAPSQDGNKSMLVMSGGEGYIDFRMGDEEVEAAEVEDAP-MKLQSPLSIAERSHLIVWQVV 754          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. TrEMBL
Match: A0A1Y1LPD0 (RH2 domain-containing protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 3.411e-88
Identity = 213/630 (33.81%), Postives = 333/630 (52.86%), Query Frame = 2
Query: 2648 RDPERQQINGWSLPRNVKVSKASD--------VPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHE-NVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKT-DHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPN-------------TNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLP-TFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVP------RKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXX---XXXHLIVWQLLL 4438
            ++  R Q  GWSLP     +  S         VP+P+YCRPL+E   G+K      I CA  +N+   +       VG S+FY  E  VE      VE      N++ + ++         T++S S+VWI TS+ + S + V+DA  PA+ L++F + S+ + C+ SVPGAS NDY++      +  ++ EK+ D  S I DS  PK   + VD   +    +      ++ NK    +  D +    N             TN  + +S   T+W+G +NG LF+H A  N + CLH ++LSD++++I++ +  V V+LANG+V VF R I        G+W +S+Y+L++     +SIRCL  V   +K+W GY+N++ VLD   L +    EAHPR +  V+Q+   G+G+WVS+RLD+TLRL+H + YQHLQD++++P+V+K++    +G S +RI+ L  S NR+WIGT  G+I+S P   +S       +          +  + +P ++IP+ +  + QLS+HGHRD VKFFV+V  +   S  + P+  T     P           L+MSGG+GY DFR  +           P ++ +     +     SHLIVWQ+ L
Sbjct:  222 KEDGRLQAYGWSLPGKTSSASKSTHSSSGGVPVPVPVYCRPLAETSPGMK------IWCAAGVNLMGGYTRDGGLMVGGSVFYYEEPEVEKAPTDDVESLDKELNANREAALLE-------TKLS-SYVWIGTSTHSASIVTVIDANNPAEILNSFGVCSNHLLCIASVPGASCNDYVYNKNSTKANISLDEKSLDDDSGIGDSN-PKNS-EEVDPELVVGKVSFVEYNDTVKNKKDKRKPADQEVAGENATESPPVENSDESTNHKLMSSVLATMWLGAQNGMLFIHSAVANWNQCLHSVKLSDAVLSIVHVDGSVVVALANGTVAVFYRDIE-------GEWDLSQYHLVQLGLPQHSIRCLSVVG--DKVWCGYRNKVHVLDPRDLKVVHTLEAHPRKESQVKQLAWLGEGVWVSIRLDSTLRLYHAHTYQHLQDVDIDPYVSKMLGTGKVGFSFVRITALLISSNRLWIGTGNGVIISVPL-SESGGSCAAIVPRGTILPGAGVRVTPIPGSYIPYCSMAHAQLSFHGHRDPVKFFVSVPGNGGMSAASTPSEATSAAVTPINGPMKTPAAMLVMSGGDGYIDFRIGDGEMEESVTEEPPVTDLEAITQGENKDVKSHLIVWQVSL 825          

HSP 2 Score: 125.176 bits (313), Expect = 4.738e-25
Identity = 66/124 (53.23%), Postives = 89/124 (71.77%), Query Frame = 3
Query:  966 MSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            M  E+EN+I ENN+L+ATKNALN+VKDDLI K+DE   E+E+L+ E  SLN  +   + R+ +LE E K L+ E       A +D E ++P++QRKRFTR EM RVLMERNQYKE+ +E++E V
Sbjct:    1 MGKEVENLIMENNELLATKNALNVVKDDLIVKVDELTGEVEMLREEILSLNMSRDKLRNRVTDLEDELKKLR-EANENKLEANED-EADIPMAQRKRFTRTEMARVLMERNQYKERFMELQEAV 122          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 263.462 bits (672), Expect = 2.760e-71
Identity = 189/658 (28.72%), Postives = 318/658 (48.33%), Query Frame = 2
Query: 2648 RDPERQQINGWSLPRNVKVS------KASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY--IHVSIDVSSKSTVTEKTDHI----------------SQIQDSFFPKFKLKTVD------CYQLESPATNENAASSLSNKSHTNQYVDDQFKSPN----TNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKD---------SRKENEL------DIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSL--------------ETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            RD    Q  GWS+P   K +      +  +VP+P+YCRPL E     KL   A ++       +++  +K        +    E  EN    K E S   +    +L           T+   S VWI TS+ + S+++++DA +P   +D F + ++ + C+ SVP AS++DY    + ++       +E T  +                S ++ +   +     +D      C +L    + E A  ++     T      +  +P+     + F  NS +           L+VH A  N   CLH I+L DS++++++   RV V+LA+G++ +F+R          G W ++ Y+L++    ++SIRC+  V+  +K+W GYKN+I V+   S+ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H   +QHLQD+++EP+V+K++    LG S +RI+ L    NR+W+GT  G+++S P  +            + N++       +++ + D S S + +   +FIP+ +    QL +HGHRD+VKFFV+V  +V  +L                P   +++ Q V      L++SGGEGY DFR  +       +        K   S    SH+IVWQ+
Sbjct:  597 RDDGLMQACGWSVPPRFKQANEKEDTRMKNVPVPVYCRPLVEKDPNRKLWCAAGVDLTGWRTSNQEPAVKLPANGTDPLTGEEEGGEN----KSEHSSPEKKKPKELH---------ETDSMSSRVWILTSTHSASKVVIIDANQPGSLVDQFNVCNAHVLCISSVPAASESDYPAGEIFLEQQGDGGTSEDTGRVEGMLAGITLVGCATNCSVVRSNCSSRTDTPVLDKGQAPVCSRLAVSQSAEEATEAMEVSEETGPSEGGENSAPSGPFTEHVFTDNSHR-----------LYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRAED-------GLWDLTNYHLMDLGRPHHSIRCMAVVH--DKVWCGYKNKIHVIQPKSMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHALTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIGGNRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKVSPTSAGGVIHVYADDSSSEKGN--GSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPSESQGSSAPTETQSEAQCV---QNVLVLSGGEGYIDFRIGDGEDDETEEPDSEAPQIKPALSKAERSHIIVWQV 1216          

HSP 2 Score: 139.043 bits (349), Expect = 1.596e-32
Identity = 77/163 (47.24%), Postives = 107/163 (65.64%), Query Frame = 3
Query:  177 SNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK 665
            S +V+S+ V  LAN IY+EFE LI  Y E VVK LMP+VV+ LE LD V +E    EVE ELLKED+ QL+TQYEREK  RK+ EE   + ED+     K  + ++  L+   K +E++ KN  DQISR E+RE + + EY+ L  R+ E+++ + + IE+SK
Sbjct:   17 SVSVMSERVSGLANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQSQVDFLELQGKQLELKTKNYADQISRLEEREGDMKKEYNALHQRHTEMIQTYVEHIERSK 179          

HSP 3 Score: 114.39 bits (285), Expect = 5.259e-25
Identity = 63/136 (46.32%), Postives = 89/136 (65.44%), Query Frame = 3
Query:  954 ELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEE--------NLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            EL GM  E+EN++ EN  L+ TKNALNIVK+DLI+K+DE + E E+L+ E  ++   K     R+  LE E K  + E +     +KD+G E        ++ ++QR+RFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  359 ELLGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVKQSKNKVDSRVKELEEELK--RAEALGASQDSKDEGGEDYSSTLQDDVAMTQRRRFTRVEMARVLMERNQYKERLMELQEAV 492          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Cavefish
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 259.996 bits (663), Expect = 2.395e-70
Identity = 146/360 (40.56%), Postives = 214/360 (59.44%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVS-YSMENS--YLP-TFIPFINHENLQLSYHGHRDSVKFFVTVLVDV-PCSLETPPNNKTQ-IQDVPRKNRF----LIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PT+W+G +NG ++VH +      CLH I+L DSI+ I++   RV V+LA+G++ +F+R +        GQW ++ Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRLFH + YQHLQD+++EP+V+K++    LG S +RI+ L+ SCNR+WIGT  G+I+S P   D++K  +       N V  Y  ENS    P TF+PF +  + QL +HGHRD+VKFF  V   V P S         +   D P    F    L+MSGGEGY DFR  +                +   +    SHLIVWQ++L  D
Sbjct:  842 PTMWLGAQNGCVYVHSSVAQWRKCLHSIKLKDSILGIVHVKGRVLVALADGTLAIFHRGVD-------GQWDLTNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVIQPKAMKIEKSFDAHPRKESQVRQLAWDGDGIWVSIRLDSTLRLFHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALTVSCNRLWIGTGNGVIISIPLT-DTKKATQGASNRPGNVVRVYGDENSDKVTPGTFVPFCSMAHAQLCFHGHRDAVKFFTAVPGQVIPTSGSGGEAGADKPAADSPTPTEFSKSVLVMSGGEGYIDFRMGDEAGE-GEDLEEATLKLQPFLAKAERSHLIVWQVMLNGD 1190          

HSP 2 Score: 116.701 bits (291), Expect = 9.535e-26
Identity = 64/142 (45.07%), Postives = 93/142 (65.49%), Query Frame = 3
Query:  921 SHGVNILPFDDE---LAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            S G +++   DE   L GM  E+E++I+EN  L+ TKNALN+VK+DLI ++DE   E ++LQ E   +   K   + +   LE E K ++ E+     + K+D E ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  260 SAGTDLIGDVDEGADLLGMGREVEHLIQENTQLLETKNALNVVKNDLIGRVDELTCEKDVLQGEMEVIRQAKDKLEEKNKELEEEIKRVRAELETTKLKVKEDDESDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 401          

HSP 3 Score: 90.1225 bits (222), Expect = 1.308e-17
Identity = 59/174 (33.91%), Postives = 91/174 (52.30%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKVS-------KASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNH-ENVENQNNSKVE--DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K S       K  ++P+P+Y RPL E  + +KL       CA  +N+         + VG+S+FY     VE+ + S V+   S +S +   Q     + +     E+S S VWICTS+   S+++V+DA +P   L+ F + +S + C+ SVPGA + DY
Sbjct:  516 RVQAYGWSLPQKYKASNGAQADSKMKNLPVPVYLRPLDEKDTSMKLW------CAAGVNLSGGKTRDGGSIVGASVFYRDVSGVESGSLSPVQRKGSQSSLDKLEQELKEQEKELRHQDELS-SLVWICTSTQATSKVVVIDANQPGNILENFFVCNSHVLCIASVPGARETDY 682          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Cavefish
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 260.766 bits (665), Expect = 3.243e-70
Identity = 146/360 (40.56%), Postives = 214/360 (59.44%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVS-YSMENS--YLP-TFIPFINHENLQLSYHGHRDSVKFFVTVLVDV-PCSLETPPNNKTQ-IQDVPRKNRF----LIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PT+W+G +NG ++VH +      CLH I+L DSI+ I++   RV V+LA+G++ +F+R +        GQW ++ Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRLFH + YQHLQD+++EP+V+K++    LG S +RI+ L+ SCNR+WIGT  G+I+S P   D++K  +       N V  Y  ENS    P TF+PF +  + QL +HGHRD+VKFF  V   V P S         +   D P    F    L+MSGGEGY DFR  +                +   +    SHLIVWQ++L  D
Sbjct:  963 PTMWLGAQNGCVYVHSSVAQWRKCLHSIKLKDSILGIVHVKGRVLVALADGTLAIFHRGVD-------GQWDLTNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVIQPKAMKIEKSFDAHPRKESQVRQLAWDGDGIWVSIRLDSTLRLFHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALTVSCNRLWIGTGNGVIISIPLT-DTKKATQGASNRPGNVVRVYGDENSDKVTPGTFVPFCSMAHAQLCFHGHRDAVKFFTAVPGQVIPTSGSGGEAGADKPAADSPTPTEFSKSVLVMSGGEGYIDFRMGDEAGE-GEDLEEATLKLQPFLAKAERSHLIVWQVMLNGD 1311          

HSP 2 Score: 135.191 bits (339), Expect = 2.480e-31
Identity = 73/182 (40.11%), Postives = 114/182 (62.64%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNE 680
            + +G +Y   E    + ++S+ V  LA+ IY+EFE +I  Y E VVK LMP+VV+ LE LD V++E    EVE ELLKED+ QL+TQYEREK  RK  EE   + ED+  +  K+ + ++  L++  + +E++ KN  DQI R E+RE E + EY+ L  R+ E++  + + +E++K    +
Sbjct:    3 LEDGVLYQ--EDTGGSAMMSERVSGLASSIYQEFERMIGKYDEDVVKQLMPLVVAVLENLDAVFAENQEHEVELELLKEDNEQLVTQYEREKALRKGVEERYIEYEDAQEQDRKELQSKVVLLEAQTRQMELKTKNYADQIGRLEEREAELKKEYNALHQRHTEMIHSYMEHLERTKTQQQQ 182          

HSP 3 Score: 117.087 bits (292), Expect = 9.219e-26
Identity = 63/141 (44.68%), Postives = 92/141 (65.25%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L  D    GM  E+E++I+EN  L+ TKNALN+VK+DLI ++DE   E ++LQ E   +   K   + +   LE E K ++ E+     + K+D E ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  384 DVDEGADLL--DLNFFGMGREVEHLIQENTQLLETKNALNVVKNDLIGRVDELTCEKDVLQGEMEVIRQAKDKLEEKNKELEEEIKRVRAELETTKLKVKEDDESDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 522          

HSP 4 Score: 90.5077 bits (223), Expect = 1.245e-17
Identity = 59/174 (33.91%), Postives = 91/174 (52.30%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKVS-------KASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNH-ENVENQNNSKVE--DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K S       K  ++P+P+Y RPL E  + +KL       CA  +N+         + VG+S+FY     VE+ + S V+   S +S +   Q     + +     E+S S VWICTS+   S+++V+DA +P   L+ F + +S + C+ SVPGA + DY
Sbjct:  637 RVQAYGWSLPQKYKASNGAQADSKMKNLPVPVYLRPLDEKDTSMKLW------CAAGVNLSGGKTRDGGSIVGASVFYRDVSGVESGSLSPVQRKGSQSSLDKLEQELKEQEKELRHQDELS-SLVWICTSTQATSKVVVIDANQPGNILENFFVCNSHVLCIASVPGARETDY 803          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Cavefish
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 260.381 bits (664), Expect = 4.219e-70
Identity = 146/360 (40.56%), Postives = 214/360 (59.44%), Query Frame = 2
Query: 3398 PTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVS-YSMENS--YLP-TFIPFINHENLQLSYHGHRDSVKFFVTVLVDV-PCSLETPPNNKTQ-IQDVPRKNRF----LIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            PT+W+G +NG ++VH +      CLH I+L DSI+ I++   RV V+LA+G++ +F+R +        GQW ++ Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRLFH + YQHLQD+++EP+V+K++    LG S +RI+ L+ SCNR+WIGT  G+I+S P   D++K  +       N V  Y  ENS    P TF+PF +  + QL +HGHRD+VKFF  V   V P S         +   D P    F    L+MSGGEGY DFR  +                +   +    SHLIVWQ++L  D
Sbjct:  991 PTMWLGAQNGCVYVHSSVAQWRKCLHSIKLKDSILGIVHVKGRVLVALADGTLAIFHRGVD-------GQWDLTNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVIQPKAMKIEKSFDAHPRKESQVRQLAWDGDGIWVSIRLDSTLRLFHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALTVSCNRLWIGTGNGVIISIPLT-DTKKATQGASNRPGNVVRVYGDENSDKVTPGTFVPFCSMAHAQLCFHGHRDAVKFFTAVPGQVIPTSGSGGEAGADKPAADSPTPTEFSKSVLVMSGGEGYIDFRMGDEAGE-GEDLEEATLKLQPFLAKAERSHLIVWQVMLNGD 1339          

HSP 2 Score: 135.576 bits (340), Expect = 2.148e-31
Identity = 73/182 (40.11%), Postives = 114/182 (62.64%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNE 680
            + +G +Y   E    + ++S+ V  LA+ IY+EFE +I  Y E VVK LMP+VV+ LE LD V++E    EVE ELLKED+ QL+TQYEREK  RK  EE   + ED+  +  K+ + ++  L++  + +E++ KN  DQI R E+RE E + EY+ L  R+ E++  + + +E++K    +
Sbjct:    3 LEDGVLYQ--EDTGGSAMMSERVSGLASSIYQEFERMIGKYDEDVVKQLMPLVVAVLENLDAVFAENQEHEVELELLKEDNEQLVTQYEREKALRKGVEERYIEYEDAQEQDRKELQSKVVLLEAQTRQMELKTKNYADQIGRLEEREAELKKEYNALHQRHTEMIHSYMEHLERTKTQQQQ 182          

HSP 3 Score: 117.087 bits (292), Expect = 8.806e-26
Identity = 63/141 (44.68%), Postives = 92/141 (65.25%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L  D    GM  E+E++I+EN  L+ TKNALN+VK+DLI ++DE   E ++LQ E   +   K   + +   LE E K ++ E+     + K+D E ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  412 DVDEGADLL--DLNFFGMGREVEHLIQENTQLLETKNALNVVKNDLIGRVDELTCEKDVLQGEMEVIRQAKDKLEEKNKELEEEIKRVRAELETTKLKVKEDDESDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 550          

HSP 4 Score: 90.5077 bits (223), Expect = 1.278e-17
Identity = 59/174 (33.91%), Postives = 91/174 (52.30%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKVS-------KASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNH-ENVENQNNSKVE--DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K S       K  ++P+P+Y RPL E  + +KL       CA  +N+         + VG+S+FY     VE+ + S V+   S +S +   Q     + +     E+S S VWICTS+   S+++V+DA +P   L+ F + +S + C+ SVPGA + DY
Sbjct:  665 RVQAYGWSLPQKYKASNGAQADSKMKNLPVPVYLRPLDEKDTSMKLW------CAAGVNLSGGKTRDGGSIVGASVFYRDVSGVESGSLSPVQRKGSQSSLDKLEQELKEQEKELRHQDELS-SLVWICTSTQATSKVVVIDANQPGNILENFFVCNSHVLCIASVPGARETDY 831          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Cavefish
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 243.432 bits (620), Expect = 6.636e-65
Identity = 140/349 (40.11%), Postives = 205/349 (58.74%), Query Frame = 2
Query: 3431 LFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVS-YSMENS--YLP-TFIPFINHENLQLSYHGHRDSVKFFVTVLVDV-PCSLETPPNNKTQ-IQDVPRKNRF----LIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            ++VH +      CLH I+L DSI+ I++   RV V+LA+G++ +F+R +        GQW ++ Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRLFH + YQHLQD+++EP+V+K++    LG S +RI+ L+ SCNR+WIGT  G+I+S P   D++K  +       N V  Y  ENS    P TF+PF +  + QL +HGHRD+VKFF  V   V P S         +   D P    F    L+MSGGEGY DFR  +                +   +    SHLIVWQ++L  D
Sbjct:  929 VYVHSSVAQWRKCLHSIKLKDSILGIVHVKGRVLVALADGTLAIFHRGVD-------GQWDLTNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVIQPKAMKIEKSFDAHPRKESQVRQLAWDGDGIWVSIRLDSTLRLFHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALTVSCNRLWIGTGNGVIISIPLT-DTKKATQGASNRPGNVVRVYGDENSDKVTPGTFVPFCSMAHAQLCFHGHRDAVKFFTAVPGQVIPTSGSGGEAGADKPAADSPTPTEFSKSVLVMSGGEGYIDFRMGDEAGE-GEDLEEATLKLQPFLAKAERSHLIVWQVMLNGD 1266          

HSP 2 Score: 135.576 bits (340), Expect = 1.978e-31
Identity = 75/192 (39.06%), Postives = 116/192 (60.42%), Query Frame = 3
Query:  135 INEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERL 710
            + +G +Y   E    + ++S+ V  LA+ IY+EFE +I  Y E VVK LMP+VV+ LE LD V++E    EVE ELLKED+ QL+TQYEREK  RK  EE   + ED+  +  K+ + ++  L++  + +E++ KN  DQI R E+RE E + EY+ L  R+ E++  + + +E++K    +    E    L
Sbjct:    3 LEDGVLYQ--EDTGGSAMMSERVSGLASSIYQEFERMIGKYDEDVVKQLMPLVVAVLENLDAVFAENQEHEVELELLKEDNEQLVTQYEREKALRKGVEERYIEYEDAQEQDRKELQSKVVLLEAQTRQMELKTKNYADQIGRLEEREAELKKEYNALHQRHTEMIHSYMEHLERTKTQQQQHAGGEHLNHL 192          

HSP 3 Score: 114.775 bits (286), Expect = 3.807e-25
Identity = 63/140 (45.00%), Postives = 92/140 (65.71%), Query Frame = 3
Query:  921 SHGVNILPFDDE---LAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEE 1331
            S G +++   DE   L GM  E+E++I+EN  L+ TKNALN+VK+DLI ++DE   E ++LQ E   +   K   + +   LE E K ++ E+     + K+D E ++P +QRKRFTR EM RVLMERNQYKE+L+E++E
Sbjct:  372 SAGTDLIGDVDEGADLLGMGREVEHLIQENTQLLETKNALNVVKNDLIGRVDELTCEKDVLQGEMEVIRQAKDKLEEKNKELEEEIKRVRAELETTKLKVKEDDESDVPTAQRKRFTRVEMARVLMERNQYKERLMELQE 511          

HSP 4 Score: 90.5077 bits (223), Expect = 1.248e-17
Identity = 59/174 (33.91%), Postives = 91/174 (52.30%), Query Frame = 2
Query: 2660 RQQINGWSLPRNVKVS-------KASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNH-ENVENQNNSKVE--DSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            R Q  GWSLP+  K S       K  ++P+P+Y RPL E  + +KL       CA  +N+         + VG+S+FY     VE+ + S V+   S +S +   Q     + +     E+S S VWICTS+   S+++V+DA +P   L+ F + +S + C+ SVPGA + DY
Sbjct:  592 RVQAYGWSLPQKYKASNGAQADSKMKNLPVPVYLRPLDEKDTSMKLW------CAAGVNLSGGKTRDGGSIVGASVFYRDVSGVESGSLSPVQRKGSQSSLDKLEQELKEQEKELRHQDELS-SLVWICTSTQATSKVVVIDANQPGNILENFFVCNSHVLCIASVPGARETDY 758          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Sea Lamprey
Match: ARHGEF17 (Rho guanine nucleotide exchange factor 17 [Source:HGNC Symbol;Acc:HGNC:21726])

HSP 1 Score: 79.337 bits (194), Expect = 4.919e-15
Identity = 76/346 (21.97%), Postives = 145/346 (41.91%), Query Frame = 2
Query: 3401 TIWVGCRNGDLFVHPANDN-----RSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRI----------WIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLET---------------------PPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFN 4330
            ++W+G  +G + V+ ++DN      SL + H     +++ I+Y +++VFVSL NG ++V+ R    E       W     + L        +   +  ++  ++W   +N I+V++  +L     F     +  AV  +  +G G+WVS++   ++RL+H      L +++V P V+K++     G +   I    A+C R+          W+GT+ G++++ P      +   L                 L   +P         S HGH   V+F  ++ + +    ET                         +      P + R L++SGG+GY+DFR +
Sbjct:  711 SMWLGTEDGCIHVYQSSDNIRNRKNSLKMQH---PAAVMCILYLDNKVFVSLLNGDLIVYQR----EAGCF---WDSQHSHTLTVGSPGNPV--TKMAHVAGRLWCSCQNIIVVINTANLVPEHTFTVGSDASRAVSCLVASGLGVWVSVQSSASVRLYHAQTRDCLAEIDVAPAVHKML----AGGADAIIRQHKAACLRVTALLACKDMLWVGTSAGVLLTLPLPHIRIQGPPL-----------------LAQLLPMG-------STHGHTGHVRFLTSIELPLDAVAETGPPPAPPHHQQQQQQHTWARQGSARRRAQAAAPPRTRTLVISGGDGYEDFRLS 1016          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Nematostella
Match: EDO47039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNC5])

HSP 1 Score: 284.263 bits (726), Expect = 6.727e-79
Identity = 196/617 (31.77%), Postives = 323/617 (52.35%), Query Frame = 2
Query: 2615 NTELSSNCSASRDPERQQINGWSLPRNVKVSKASD------VPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFY----NHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNEN-ISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            NT+LS          R Q  GWSLP       A        VP+P+YCRPL+ +  G+K      I CA  +++   +       +G+S+FY      E+VE +          ++ S+T +     GD    T +        +S+ + S+I ++DA  P   LD F++ +S + C+ +VPGAS  DY   S+   ++ +        S  QDS       +T D   +    T  + ++S S++      VD   +S +      +S  PT+W+G ++G ++VH A      C+  I+L DS+++I++   RV V+LA+G+V +F+R          GQW  + Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL++   Y HLQD+++EP+V+K++    LG S +RI+ L  + +R+W+GT  G+I+S P V      ++ D            E     +F+P+ +  N QLS+HGHRDSVKFFV     V   ++   +++++ QD+      L++SGGEGY DFR  +   +++        S     +ST   SH++VWQ+
Sbjct:  561 NTDLSEG--------RMQAYGWSLPAKYSSEVAEGGKSLVSVPVPVYCRPLNLSDPGMK------IWCAAGVDLSGGYTSDGGAAIGASVFYADSPGGEDVEIKE---------AKPSTTWI-----GDLFQLTPVLTPLCISGSSTHSCSKITIIDANYPQNILDCFVVCTSHLLCITAVPGASPGDYDAASVGDGARVS--------SAPQDS-------QTCDKQPVSDSPTVTDVSTSESDR------VD--ARSADGEGTKMSSVLPTMWLGAQSGCVYVHSAISQWRTCIQSIRLKDSVLSIVHVKGRVLVALADGTVAIFHRSSD-------GQWNFNNYHLLDLGRPHHSIRCMAMVH--DKVWCGYRNKIQVIHPRTMRVEKTFDAHPRHESQVRQLAWIGDGVWVSIRLDSTLRLYNAQTYHHLQDIDIEPYVSKMLGTGKLGFSFVRITSLLLTNDRLWVGTGNGVILSVPLVAARPARDDGDQQLAVTSSPAKGEGVLSSSFMPYCSMVNAQLSFHGHRDSVKFFVA----VQGFMKRVSSSQSRNQDM-----MLVLSGGEGYVDFRLGDGEEAAVEDSAGDLISVTLKGQSTSERSHIMVWQV 1108          

HSP 2 Score: 196.823 bits (499), Expect = 6.452e-51
Identity = 147/458 (32.10%), Postives = 228/458 (49.78%), Query Frame = 3
Query:  150 MYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFER-LKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWN-----FTPSASD--------DGDIINSSTEDISHGVNI------------------------LP------------------------FDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            +Y S E E   TV+S+ V NLAN IY EFE +I  Y + VV  LMP++VS LE LD  Y + +   VE E+L +D+ QL+TQYEREK  RK  E    + ED      +  E++++ L+ D + +E R K+  D + R E+R  E + EY  L  R+ E+++++ + IE+++     I + E  ++ L  Y +  + S+S  L+    KS G N++  ++     +  +  N P +         TP +SD        D   I +ST ++S G N+                        LP                           ++  M  E+EN++KEN +L+  KN L   K+DL+ +L+E +++ E++  E  SL  +K    +R+   E E K  KHE        K   E ++  + RKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:   11 VYSSGE-EGGTTVMSERVSNLANSIYSEFERMIQKYDQDVVSGLMPLMVSVLEQLDSAYGDNNEQLVELEILSDDNEQLITQYEREKQLRKLAENRYLEIEDQIEAEKRNAEKDIESLEHDNRGLEARIKSYQDHVERLEERISEMKREYGSLHQRHSEVVQHYMERIERAEKR--SIASTETPQKGLNRYLHMLKLSSSTGLE----KSQGANVDGLDVNNSTCSISDVDNLPIVSAREAANMLTPGSSDVSLTGISKDAAAILASTPELS-GSNVVTEVARREKGSSSANRPVSLDLENLPEGVAASSLFAELSSEEPDVIGQMDTGADIIAMGRELENVMKENKELVTVKNKLETQKNDLLKRLEELSNDKEVMTEELKSLQEVKQRMNIRVTECEHELKRTKHEAEKATVALK---EASVSAAHRKRFTRVEMARVLMERNQYKERLMELQEAV 457          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Nematostella
Match: EDO44521 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVX0])

HSP 1 Score: 100.138 bits (248), Expect = 3.710e-21
Identity = 93/397 (23.43%), Postives = 162/397 (40.81%), Query Frame = 2
Query: 3401 TIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTK----------------CFEAHPR---------SDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRI----------WIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVP----CSLETPPNNKTQIQDVPR--------------KNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            T+W+G  +G ++V+P  D +      IQ + ++  I+Y +++VFV+L NG + V+ R            W++S   ++ P      + C+ +V+   ++W G +   I+++  +L +                  C    P           + AV ++  +G G+W+SL+   T+RLFH   Y+ L D++V P V+K++       S   I    A+C R+          WIGT+ G++++ P                    + S+ NS            +   SYHGH   V+F   V V  P     +L+   NN       P                   LI+SGG+GY+DF+ +    S     S              ++HL+VWQ+
Sbjct:  663 TVWLGTEDGSIYVYPVQDIQQKKKMRIQHNAAVHCILYVDNQVFVALGNGDLCVYRRQPGCP-------WEVSSPIIV-PVGSGAPVTCMTAVH--GRLWCGCQCNAIIVNTTTLKIEVRIVNRFKDLRSRAPLICSRILPNYITFNCSLDKERAVYRLVSSGMGVWLSLQSSATVRLFHATKYECLADVDVGPPVHKML-----AGSDAIIRQHKAACLRVTSLLTCRDLLWIGTSAGVVLTLPL-------------PTITVTTSSLRNS-----------PSASASYHGHTGHVRFLTAVEVPKPGDQDTTLDKERNNSVTSSSTPDPPLTPGEPGVVNGPSRHILIISGGDGYEDFKTSSTSESAGRDDS--------------TNHLLVWQV 1006          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Nematostella
Match: EDO39686 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9D5])

HSP 1 Score: 53.1434 bits (126), Expect = 5.350e-7
Identity = 30/84 (35.71%), Postives = 52/84 (61.90%), Query Frame = 3
Query:  201 VHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSE 452
            V+  A+ I ++ E +I  YG   V +LMP VV  LE L+ + SE+ N ++EF  LK ++ +L  + ++E  QR+K +E L+ ++
Sbjct:   10 VYEQASVIGQDIEKIIDQYGHEAVLDLMPKVVRVLEELEILVSERENEKLEFAELKMENERLYLEIKKEASQRRKLDEELYSTQ 93          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Medaka
Match: spag9a (sperm associated antigen 9a [Source:ZFIN;Acc:ZDB-GENE-070820-7])

HSP 1 Score: 249.595 bits (636), Expect = 1.219e-71
Identity = 140/382 (36.65%), Postives = 223/382 (58.38%), Query Frame = 2
Query: 3347 DQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAP------FVKDSRKENEL------DIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVD-VPC--SLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            +   S    T   +S+ PT+W+G +NG L+VH +      CLH I+L DSI++I++   RV V+LA+G++ +F+R I +       QW ++ Y+LL+    ++SIRC+  V+  +K+W GY+N+I V+   ++ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRLFH + YQHLQD+++EP+V+K++    LG S +RI+ L  SC+R+W+GT  G+I+S P       +K + K   +        V  + D   S + +    F+P+ +  + QL +HGHR++VKFFVTV  +   C  S    P +++          +L+MSGGEGY DFR  +    +    S    + +   +    SHLIVWQ+   +D
Sbjct:  121 EDLDSSEAETLRMSSALPTMWLGAQNGCLYVHSSVARWRKCLHAIKLKDSILSIVHVKGRVLVALADGTLAIFHRGIDD-------QWDLTNYHLLDLGRPHHSIRCMTVVH--DKVWCGYRNKIYVIQPKAMRIEKSFDAHPRKESQVRQLAWVGDGIWVSIRLDSTLRLFHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALVMSCSRLWVGTGNGVIISIPLSEGMVLLKHANKTTGIVPNRPGAAVRVYGD--ESSDCAAPGGFVPYCSMAHAQLCFHGHREAVKFFVTVPGEKTSCADSGSDDPASESSEITSSEPKTYLVMSGGEGYIDFRIGDEGGEL-DGLSESTGSQQLAPTKAEQSHLIVWQVTTSHD 490          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Medaka
Match: ENSORLT00000044024.1 (C-Jun-amino-terminal kinase-interacting protein 4 [Source:NCBI gene;Acc:101157681])

HSP 1 Score: 245.358 bits (625), Expect = 1.854e-65
Identity = 138/364 (37.91%), Postives = 210/364 (57.69%), Query Frame = 2
Query: 3386 NSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENEL------DIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTV---LVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            +S QPT+W+G ++G L+VH +  +    LH I+L +S+  I++   RV VS+++G++ +F R          GQW + RY+LL+     +SIRC+  V+  + +W GY+N+I V+   ++ + K F+AHPR D  VRQ+   GDG+WVS+RLD+TLRLFH   YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+WIGT  G+I+S P  + + K ++        +V  + D   S +     T IP+ +    QL +HGHRD+VKFF  V    V    S       K+           L+MSGGEGY DFR  +E+  +  +  +L     +   +    SHLIVWQ+LL  +
Sbjct:  957 SSVQPTMWLGAQDGHLYVHSSVAHWRRRLHSIKLKESVFCIVHVKGRVLVSMSDGTIAIFRRGAD-------GQWDLGRYHLLDLGRPAHSIRCMTVVH--DAVWCGYRNKIYVVKPKAMRVEKSFDAHPRQDSQVRQLAWHGDGIWVSIRLDSTLRLFHARTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMMSCNRLWIGTGNGVIISIPLTETASKASKAAGNLPGAVVRLYGD--DSGDRVTAGTVIPYCSMAQAQLCFHGHRDAVKFFAAVPGHAVPPSSSGGEAAGEKSDASCQEGMKSVLVMSGGEGYIDFRIGDEDGEAQEADAAL--LKLQASPAKAERSHLIVWQVLLSGE 1307          

HSP 2 Score: 136.732 bits (343), Expect = 8.576e-32
Identity = 77/164 (46.95%), Postives = 105/164 (64.02%), Query Frame = 3
Query:  177 SNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKN 668
            S+ V+S+ V  LA+ IY+EFE LI  Y E VVK LMP+VV+ LE LD V++     EVE ELLKED+ QL+TQYEREK  RK  EE     EDS     K  +  L  L+S  + +E++ KN  DQI RFE+RE E + EY+ L  R+ E++  + + +E+SK+
Sbjct:   15 SSAVMSERVSGLASSIYREFERLIEKYDEDVVKELMPLVVAVLENLDSVFAVNQEHEVELELLKEDNEQLVTQYEREKALRKHAEERFIALEDSQDGEKKDLQARLVTLQSVVRQMELKTKNYADQIGRFEEREAELKKEYNALHHRHTEMIHSYMEHLERSKH 178          

HSP 3 Score: 109.768 bits (273), Expect = 1.452e-23
Identity = 61/143 (42.66%), Postives = 97/143 (67.83%), Query Frame = 3
Query:  915 DISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEI--ILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L  D    GM  E+E++I EN  L+ TKNALN+VK+DLI+++D+   E E+L+ E +++   KT  + +   LE E K+++ E+    Q  + +++ + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  419 DMDDGADLL--DGSYLGMGREVEHLIHENAQLLETKNALNVVKNDLIAQVDDLACEKEVLRGELDAVIQAKTKLEEKNKELEEELKTVRAELEDAKQKVKNENEDDSDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 559          

HSP 4 Score: 96.6709 bits (239), Expect = 1.325e-19
Identity = 61/207 (29.47%), Postives = 106/207 (51.21%), Query Frame = 2
Query: 2546 LNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVK-----VSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            LNE++ AE   T   ++ + + +           ++  R Q  GWSLP+ +K       K  ++P+P++ RPL E ++ +KL       CA  +N+ E         VG+S+FY H+   ++   K   S +S     Q     Q +      +S S VWICTS+ + S+++V+DA +P   L++F++ ++ + C+ SVPGA + DY
Sbjct:  644 LNEEAPAESVVTRREQKRAQYQQ-----VKAHVQKEDGRVQAYGWSLPKKLKGNGAQAEKMKNLPVPVFLRPLDEKEASMKLW------CAAGVNLSEGKTRDGGLLVGASVFY-HDLSGSEGPQKKAGSQSSLEKLDQELQEQQKELQHHDRLS-SLVWICTSTQSASKVVVIDANQPGNILESFVVCNAHVLCITSVPGARETDY 837          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Medaka
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:101157621])

HSP 1 Score: 245.358 bits (625), Expect = 1.868e-65
Identity = 143/389 (36.76%), Postives = 231/389 (59.38%), Query Frame = 2
Query: 3305 SSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSR-KENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCS-----LETPPNNKTQIQDVPRKNR------FLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQL 4432
            S+  +K  ++Q  D +  S     + S +  PT+W+G +NG L+VH A  N   CLH I+L DS++++++   RV V+LA+G++ +F+R   +E+    GQW +S Y+L++    ++SIRC+  V+  +K+W GYKN+I V+   S+ + K F+AHPR +  VRQ+   GDG+WVS+RLD+TLRL+H + +QHLQD+++EP+V+K++    LG S +RI+ L    NR+W+GT  G+I+S P  + ++       +++ + D      +    +FIP+ +    QL +HGHRD+VKFFV+V  +V  +     L++P  ++ Q    P +N        L++SGGEGY DFR  +          S   S  K   S    SH+IVWQ+
Sbjct:  915 STGQSKEESSQPTDSEDGSQEAKNYTSVA--PTMWLGAQNGWLYVHSAVGNWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHR---SED----GQWDLSNYHLMDLGRPHHSIRCMAVVH--DKVWCGYKNKIHVIQPKSMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIGGNRLWVGTGNGVIISIPLTETNKVSPTSGGVIHVYGDDGSEKSSG---SFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSP--SEGQSSTAPTENEAQSVQNVLVLSGGEGYIDFRIGDGEDDETEEGESGSASQMKPALSKAERSHIIVWQV 1287          

HSP 2 Score: 170.244 bits (430), Expect = 4.130e-42
Identity = 153/491 (31.16%), Postives = 231/491 (47.05%), Query Frame = 3
Query:  177 SNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSK------NHHNEIKNI--EKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWNFTPS-----ASDDGDIINSS--------------------TEDISHGVN----------ILPFDDEL-----AGMSHEIENIIKENNDLIATKNALNIVKD---DLISKLDEA----------NSEIEILQHEN-------NSLNTMKTSFKLRINNLEIENKSLKHEI-------------------ILQHFRA---------KDDGEE--------NLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            S TV+S+ V  +AN IY+EFE LI  Y E VVK LMP+VV+ LE LD V  E    EVE ELLKED+ QL+TQYEREK  RK+ EE   + ED+     K  + +++ L+   K +E++ KN  DQI+R E+RE + + EY+ L  R+ E+++ + + IE+SK      N  +E       K ER  S S      + E + E+ S+SD     P    +  G++ NTP         TP         D D++ +                     T ++S G+           I+    EL      G +   + I+ E    I T +  + +KD   D+I  +D              E+E L  EN       N+LN +K     +++ L  E + L+ E+                    ++  +A         KD+G++        ++ ++QR+RFTR EM RVLMERNQYKE+L+E++E V
Sbjct:   15 SGTVMSERVSGMANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLIENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQMQVEFLELQGKQLELKTKNYSDQITRLEERESDLKKEYNALHQRHTEMIQTYVEHIERSKLQQAGSNSQSEGTGCGRTKAERPPSLS---LYPSGEGM-EDGSESDSVAATP----SSTGSKSNTPTSSVPSATVTPINEGFLLQSDFDMVPAGNRRKSGKRLSRNMEVQVSQETRNVSIGMGSSDEWSEFQEIIDSTPELEHSVYGGGNSPCQGIVNEAFG-INTDSLYHEIKDAKSDIIGDVDAGAELLGEFSGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVRQSKNKVDARIKELEEEIKRLKAEALGASRDSKDEGDDFSSPIQDGDMTMTQRRRFTRVEMARVLMERNQYKERLMELQEAV 496          

HSP 3 Score: 64.3142 bits (155), Expect = 1.048e-9
Identity = 49/193 (25.39%), Postives = 85/193 (44.04%), Query Frame = 2
Query: 2648 RDPERQQINGWSLPRNVKVS------------------------KASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKT-FVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            RD    Q  GWS+P  +K +                        +  +VP+P+YCRPL E     KL       CA  +++      +  T  +GS+   +      Q   +  D  N+  S  +       ++D      +S VWI TS+ + S+++++DA +P   +D F + ++ + C+ SVP AS++DY
Sbjct:  614 RDDGIMQACGWSVPSRLKQTGGQMDSAQDSPLKRQQTTNDKEDNRMKNVPVPVYCRPLVEKDPNRKLW------CAAGVDL---TGWRASTPGMGSAKSLSGSGDPLQAEEEGSDKKNNHTSPEKKKTKELQETDSM----NSRVWILTSTHSASKVVIIDANQPGSLVDQFNVCNAHVLCISSVPAASESDY 793          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Medaka
Match: ENSORLT00000025700.2 (C-Jun-amino-terminal kinase-interacting protein 4 [Source:NCBI gene;Acc:101157681])

HSP 1 Score: 245.358 bits (625), Expect = 1.903e-65
Identity = 138/364 (37.91%), Postives = 210/364 (57.69%), Query Frame = 2
Query: 3386 NSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENEL------DIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTV---LVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            +S QPT+W+G ++G L+VH +  +    LH I+L +S+  I++   RV VS+++G++ +F R          GQW + RY+LL+     +SIRC+  V+  + +W GY+N+I V+   ++ + K F+AHPR D  VRQ+   GDG+WVS+RLD+TLRLFH   YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+WIGT  G+I+S P  + + K ++        +V  + D   S +     T IP+ +    QL +HGHRD+VKFF  V    V    S       K+           L+MSGGEGY DFR  +E+  +  +  +L     +   +    SHLIVWQ+LL  +
Sbjct:  952 SSVQPTMWLGAQDGHLYVHSSVAHWRRRLHSIKLKESVFCIVHVKGRVLVSMSDGTIAIFRRGAD-------GQWDLGRYHLLDLGRPAHSIRCMTVVH--DAVWCGYRNKIYVVKPKAMRVEKSFDAHPRQDSQVRQLAWHGDGIWVSIRLDSTLRLFHARTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMMSCNRLWIGTGNGVIISIPLTETASKASKAAGNLPGAVVRLYGD--DSGDRVTAGTVIPYCSMAQAQLCFHGHRDAVKFFAAVPGHAVPPSSSGGEAAGEKSDASCQEGMKSVLVMSGGEGYIDFRIGDEDGEAQEADAAL--LKLQASPAKAERSHLIVWQVLLSGE 1302          

HSP 2 Score: 136.732 bits (343), Expect = 8.620e-32
Identity = 77/164 (46.95%), Postives = 105/164 (64.02%), Query Frame = 3
Query:  177 SNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKN 668
            S+ V+S+ V  LA+ IY+EFE LI  Y E VVK LMP+VV+ LE LD V++     EVE ELLKED+ QL+TQYEREK  RK  EE     EDS     K  +  L  L+S  + +E++ KN  DQI RFE+RE E + EY+ L  R+ E++  + + +E+SK+
Sbjct:   15 SSAVMSERVSGLASSIYREFERLIEKYDEDVVKELMPLVVAVLENLDSVFAVNQEHEVELELLKEDNEQLVTQYEREKALRKHAEERFIALEDSQDGEKKDLQARLVTLQSVVRQMELKTKNYADQIGRFEEREAELKKEYNALHHRHTEMIHSYMEHLERSKH 178          

HSP 3 Score: 107.842 bits (268), Expect = 6.114e-23
Identity = 58/130 (44.62%), Postives = 92/130 (70.77%), Query Frame = 3
Query:  954 ELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEI--ILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            +L GM  E+E++I EN  L+ TKNALN+VK+DLI+++D+   E E+L+ E +++   KT  + +   LE E K+++ E+    Q  + +++ + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  425 DLLGMGREVEHLIHENAQLLETKNALNVVKNDLIAQVDDLACEKEVLRGELDAVIQAKTKLEEKNKELEEELKTVRAELEDAKQKVKNENEDDSDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 554          

HSP 4 Score: 96.6709 bits (239), Expect = 1.464e-19
Identity = 61/207 (29.47%), Postives = 106/207 (51.21%), Query Frame = 2
Query: 2546 LNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVK-----VSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            LNE++ AE   T   ++ + + +           ++  R Q  GWSLP+ +K       K  ++P+P++ RPL E ++ +KL       CA  +N+ E         VG+S+FY H+   ++   K   S +S     Q     Q +      +S S VWICTS+ + S+++V+DA +P   L++F++ ++ + C+ SVPGA + DY
Sbjct:  639 LNEEAPAESVVTRREQKRAQYQQ-----VKAHVQKEDGRVQAYGWSLPKKLKGNGAQAEKMKNLPVPVFLRPLDEKEASMKLW------CAAGVNLSEGKTRDGGLLVGASVFY-HDLSGSEGPQKKAGSQSSLEKLDQELQEQQKELQHHDRLS-SLVWICTSTQSASKVVVIDANQPGNILESFVVCNAHVLCITSVPGARETDY 832          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Medaka
Match: ENSORLT00000028950.1 (C-Jun-amino-terminal kinase-interacting protein 4 [Source:NCBI gene;Acc:101157681])

HSP 1 Score: 245.358 bits (625), Expect = 1.964e-65
Identity = 138/364 (37.91%), Postives = 210/364 (57.69%), Query Frame = 2
Query: 3386 NSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENEL------DIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTV---LVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRF-NENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKND 4447
            +S QPT+W+G ++G L+VH +  +    LH I+L +S+  I++   RV VS+++G++ +F R          GQW + RY+LL+     +SIRC+  V+  + +W GY+N+I V+   ++ + K F+AHPR D  VRQ+   GDG+WVS+RLD+TLRLFH   YQHLQD+++EP+V+K++    LG S +RI+ L  SCNR+WIGT  G+I+S P  + + K ++        +V  + D   S +     T IP+ +    QL +HGHRD+VKFF  V    V    S       K+           L+MSGGEGY DFR  +E+  +  +  +L     +   +    SHLIVWQ+LL  +
Sbjct:  961 SSVQPTMWLGAQDGHLYVHSSVAHWRRRLHSIKLKESVFCIVHVKGRVLVSMSDGTIAIFRRGAD-------GQWDLGRYHLLDLGRPAHSIRCMTVVH--DAVWCGYRNKIYVVKPKAMRVEKSFDAHPRQDSQVRQLAWHGDGIWVSIRLDSTLRLFHARTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMMSCNRLWIGTGNGVIISIPLTETASKASKAAGNLPGAVVRLYGD--DSGDRVTAGTVIPYCSMAQAQLCFHGHRDAVKFFAAVPGHAVPPSSSGGEAAGEKSDASCQEGMKSVLVMSGGEGYIDFRIGDEDGEAQEADAAL--LKLQASPAKAERSHLIVWQVLLSGE 1311          

HSP 2 Score: 136.732 bits (343), Expect = 8.672e-32
Identity = 77/164 (46.95%), Postives = 105/164 (64.02%), Query Frame = 3
Query:  177 SNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKN 668
            S+ V+S+ V  LA+ IY+EFE LI  Y E VVK LMP+VV+ LE LD V++     EVE ELLKED+ QL+TQYEREK  RK  EE     EDS     K  +  L  L+S  + +E++ KN  DQI RFE+RE E + EY+ L  R+ E++  + + +E+SK+
Sbjct:   15 SSAVMSERVSGLASSIYREFERLIEKYDEDVVKELMPLVVAVLENLDSVFAVNQEHEVELELLKEDNEQLVTQYEREKALRKHAEERFIALEDSQDGEKKDLQARLVTLQSVVRQMELKTKNYADQIGRFEEREAELKKEYNALHHRHTEMIHSYMEHLERSKH 178          

HSP 3 Score: 107.842 bits (268), Expect = 5.181e-23
Identity = 61/145 (42.07%), Postives = 97/145 (66.90%), Query Frame = 3
Query:  915 DISHGVNILP--FDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEI--ILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            D+  G ++L    D    GM  E+E++I EN  L+ TKNALN+VK+DLI+++D+   E E+L+ E +++   KT  + +   LE E K+++ E+    Q  + +++ + ++P +QRKRFTR EM RVLMERNQYKE+L+E++E V
Sbjct:  419 DMDDGADLLDEFSDGSYLGMGREVEHLIHENAQLLETKNALNVVKNDLIAQVDDLACEKEVLRGELDAVIQAKTKLEEKNKELEEELKTVRAELEDAKQKVKNENEDDSDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAV 563          

HSP 4 Score: 96.6709 bits (239), Expect = 1.482e-19
Identity = 61/207 (29.47%), Postives = 106/207 (51.21%), Query Frame = 2
Query: 2546 LNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVK-----VSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDY 3151
            LNE++ AE   T   ++ + + +           ++  R Q  GWSLP+ +K       K  ++P+P++ RPL E ++ +KL       CA  +N+ E         VG+S+FY H+   ++   K   S +S     Q     Q +      +S S VWICTS+ + S+++V+DA +P   L++F++ ++ + C+ SVPGA + DY
Sbjct:  648 LNEEAPAESVVTRREQKRAQYQQ-----VKAHVQKEDGRVQAYGWSLPKKLKGNGAQAEKMKNLPVPVFLRPLDEKEASMKLW------CAAGVNLSEGKTRDGGLLVGASVFY-HDLSGSEGPQKKAGSQSSLEKLDQELQEQQKELQHHDRLS-SLVWICTSTQSASKVVVIDANQPGNILESFVVCNAHVLCITSVPGARETDY 841          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Planmine SMEST
Match: SMESG000060963.1 (SMESG000060963.1)

HSP 1 Score: 1273.07 bits (3293), Expect = 0.000e+0
Identity = 646/647 (99.85%), Postives = 647/647 (100.00%), Query Frame = 2
Query: 2510 KFSRLFKINNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKNDL 4450
            +FSRLFKINNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPSLLGLSLLRISCLSASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPKSNNKNEESTKNSSHLIVWQLLLKNDL
Sbjct:  430 RFSRLFKINNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPSLLGLSLLRISCLSASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPKSNNKNEESTKNSSHLIVWQLLLKNDL 1076          

HSP 2 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 413/413 (100.00%), Postives = 413/413 (100.00%), Query Frame = 3
Query:   99 MNYLRDSIYFTSINEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            MNYLRDSIYFTSINEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV
Sbjct:    1 MNYLRDSIYFTSINEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 413          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Planmine SMEST
Match: SMESG000060963.1 (SMESG000060963.1)

HSP 1 Score: 1273.07 bits (3293), Expect = 0.000e+0
Identity = 646/647 (99.85%), Postives = 647/647 (100.00%), Query Frame = 2
Query: 2510 KFSRLFKINNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKNDL 4450
            +FSRLFKINNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPSLLGLSLLRISCLSASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPKSNNKNEESTKNSSHLIVWQLLLKNDL
Sbjct:  413 RFSRLFKINNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPSLLGLSLLRISCLSASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPKSNNKNEESTKNSSHLIVWQLLLKNDL 1059          

HSP 2 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 396/396 (100.00%), Postives = 396/396 (100.00%), Query Frame = 3
Query:  150 MYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            MYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV
Sbjct:    1 MYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 396          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Planmine SMEST
Match: SMESG000060963.1 (SMESG000060963.1)

HSP 1 Score: 1255.35 bits (3247), Expect = 0.000e+0
Identity = 640/647 (98.92%), Postives = 641/647 (99.07%), Query Frame = 2
Query: 2510 KFSRLFKINNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKNDL 4450
            +FSRLFKINNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLK      INCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPSLLGLSLLRISCLSASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPKSNNKNEESTKNSSHLIVWQLLLKNDL
Sbjct:  430 RFSRLFKINNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLK------INCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPSLLGLSLLRISCLSASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPKSNNKNEESTKNSSHLIVWQLLLKNDL 1070          

HSP 2 Score: 831.247 bits (2146), Expect = 0.000e+0
Identity = 413/413 (100.00%), Postives = 413/413 (100.00%), Query Frame = 3
Query:   99 MNYLRDSIYFTSINEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            MNYLRDSIYFTSINEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV
Sbjct:    1 MNYLRDSIYFTSINEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 413          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Planmine SMEST
Match: SMESG000060963.1 (SMESG000060963.1)

HSP 1 Score: 1254.58 bits (3245), Expect = 0.000e+0
Identity = 640/647 (98.92%), Postives = 641/647 (99.07%), Query Frame = 2
Query: 2510 KFSRLFKINNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPXXXXXXXXXXXXXXASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPXXXXXXXXXXXXXXHLIVWQLLLKNDL 4450
            +FSRLFKINNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLK      INCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPSLLGLSLLRISCLSASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPKSNNKNEESTKNSSHLIVWQLLLKNDL
Sbjct:  413 RFSRLFKINNPSLNEKSVAEVNSTDMPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVKVSKASDVPIPIYCRPLSENQSGLK------INCAVTINVHEKFNLKNKTFVGSSIFYNHENVENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNESQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKSTVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTNQYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQLSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLLEPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSDYAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPSLLGLSLLRISCLSASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFNDVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLETPPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPKSNNKNEESTKNSSHLIVWQLLLKNDL 1053          

HSP 2 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 396/396 (100.00%), Postives = 396/396 (100.00%), Query Frame = 3
Query:  150 MYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 1337
            MYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV
Sbjct:    1 MYDSIESETSNTVVSDYVHNLANGIYKEFESLILHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQYEREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSLDQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEKFERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDPPMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKENNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRINNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERNQYKEKLLEMEEYV 396          
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Planmine SMEST
Match: SMESG000031010.1 (SMESG000031010.1)

HSP 1 Score: 211.46 bits (537), Expect = 5.062e-62
Identity = 111/176 (63.07%), Postives = 125/176 (71.02%), Query Frame = -3
Query: 1976 LPRIPKIVKSAPVSEQISVMSPLEKEYRAVHAKYDRINVSWSPSEKTKELHQKIHRLFYCRNDLIVESRAQ*VLISRLTKLVRRAFTEAELQLLLANHDWAQEIDIVPSQQVPRDGPSGSLKFTNMPLEPIPIPVNIPLLRNRN--HKPTMNXXXXXXXRAEHSLLLAHLKQANNL 2497
            LPRIP+IVK APV E +S+M+PLE+EYR + AKY+ + VSW P EKTKELHQKIHRL  C NDL VE RAQ V ISR   LVRRAFTE +LQ LL NHDWAQEIDIVPSQ  PRDG SGSLKF+NMPL+PIP P NI L R RN  HK +         RA HS   A   +A + 
Sbjct:    4 LPRIPQIVKCAPVGEPVSIMTPLEEEYRVLPAKYNILKVSWFPPEKTKELHQKIHRLSRCGNDLTVEIRAQRVQISRFKTLVRRAFTEVKLQFLLHNHDWAQEIDIVPSQHAPRDGSSGSLKFSNMPLDPIPFPANIQLSRIRNPKHKHSTECEFPGEIRASHSCRPAATTEAGSY 179          

HSP 2 Score: 70.8626 bits (172), Expect = 3.139e-13
Identity = 35/46 (76.09%), Postives = 39/46 (84.78%), Query Frame = -2
Query: 1704 KCEFP*EIQARHSCRPAATTEAGSYRSHRTSRSNNSIRKSAYKSND 1841
            +CEFP EI+A HSCRPAATTEAGSYRS  TSRSNNSI +S YKS +
Sbjct:  155 ECEFPGEIRASHSCRPAATTEAGSYRSQCTSRSNNSISQSVYKSGN 200          
The following BLAST results are available for this feature:
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPAG95.234e-6736.88sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
SPAG95.314e-6736.88sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
SPAG95.333e-6736.88sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
SPAG95.464e-6736.88sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
SPAG94.180e-6636.98sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-165.099e-6634.92JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-166.244e-6629.55JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-167.044e-6629.55JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-161.954e-6529.55JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-163.419e-6534.48JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syd8.449e-6737.42gene:FBgn0024187 transcript:FBtr0345912[more]
syd8.449e-6737.42gene:FBgn0024187 transcript:FBtr0332788[more]
syd8.496e-6737.42gene:FBgn0024187 transcript:FBtr0332789[more]
syd8.970e-6737.19gene:FBgn0024187 transcript:FBtr0332787[more]
syd3.954e-6537.30gene:FBgn0024187 transcript:FBtr0300413[more]
back to top
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPAG93.255e-7138.75sperm associated antigen 9b [Source:NCBI gene;Acc:... [more]
SPAG98.223e-7038.75sperm associated antigen 9b [Source:NCBI gene;Acc:... [more]
SPAG92.032e-6938.75sperm associated antigen 9b [Source:NCBI gene;Acc:... [more]
SPAG92.755e-6938.75sperm associated antigen 9b [Source:NCBI gene;Acc:... [more]
SPAG94.708e-6939.03sperm associated antigen 9b [Source:NCBI gene;Acc:... [more]
back to top
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cldn26.762e-6838.77claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn29.175e-6838.77claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn23.384e-6637.47claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn23.395e-6637.47claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn23.500e-6637.47claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
back to top
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spag96.494e-6737.37sperm associated antigen 9 [Source:MGI Symbol;Acc:... [more]
Spag96.880e-6737.37sperm associated antigen 9 [Source:MGI Symbol;Acc:... [more]
Spag97.240e-6737.37sperm associated antigen 9 [Source:MGI Symbol;Acc:... [more]
Spag98.390e-6737.37sperm associated antigen 9 [Source:MGI Symbol;Acc:... [more]
Spag91.146e-6637.37sperm associated antigen 9 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60271|JIP4_HUMAN2.624e-6636.88C-Jun-amino-terminal kinase-interacting protein 4 ... [more]
sp|E9PSK7|JIP3_RAT4.847e-6628.43C-Jun-amino-terminal kinase-interacting protein 3 ... [more]
sp|Q58A65|JIP4_MOUSE9.611e-6637.37C-Jun-amino-terminal kinase-interacting protein 4 ... [more]
sp|Q29EP6|JIP3_DROPS3.858e-6435.85JNK-interacting protein 3 OS=Drosophila pseudoobsc... [more]
sp|Q9UPT6|JIP3_HUMAN3.880e-6335.68C-Jun-amino-terminal kinase-interacting protein 3 ... [more]
back to top
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A232EYH23.804e-9032.92Uncharacterized protein OS=Trichomalopsis sarcopha... [more]
A0A1Y1LUY35.447e-9034.24RH2 domain-containing protein OS=Photinus pyralis ... [more]
T1IY267.546e-9033.67Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A3Q2XQX86.448e-8931.60Sperm associated antigen 9 OS=Hippocampus comes OX... [more]
A0A1Y1LPD03.411e-8833.81RH2 domain-containing protein OS=Photinus pyralis ... [more]
back to top
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk8ip32.760e-7128.72mitogen-activated protein kinase 8 interacting pro... [more]
SPAG92.395e-7040.56sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
SPAG93.243e-7040.56sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
SPAG94.219e-7040.56sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
SPAG96.636e-6540.11sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ARHGEF174.919e-1521.97Rho guanine nucleotide exchange factor 17 [Source:... [more]
back to top
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO470396.727e-7931.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445213.710e-2123.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396865.350e-735.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spag9a1.219e-7136.65sperm associated antigen 9a [Source:ZFIN;Acc:ZDB-G... [more]
ENSORLT00000044024.11.854e-6537.91C-Jun-amino-terminal kinase-interacting protein 4 ... [more]
mapk8ip31.868e-6536.76mitogen-activated protein kinase 8 interacting pro... [more]
ENSORLT00000025700.21.903e-6537.91C-Jun-amino-terminal kinase-interacting protein 4 ... [more]
ENSORLT00000028950.11.964e-6537.91C-Jun-amino-terminal kinase-interacting protein 4 ... [more]
back to top
BLAST of C-jun-amino-terminal kinase-interacting protein, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060963.10.000e+099.85SMESG000060963.1[more]
SMESG000060963.10.000e+099.85SMESG000060963.1[more]
SMESG000060963.10.000e+098.92SMESG000060963.1[more]
SMESG000060963.10.000e+098.92SMESG000060963.1[more]
SMESG000031010.15.062e-6263.07SMESG000031010.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035356 ID=SMED30035356|Name=C-jun-amino-terminal kinase-interacting protein, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=4542bp
GATATTATTTTAATATATTTCTAATTTACAAAAAGTACTAAAATTTTTCT
GATTTGTTATTTCATCATTAAAAATTATTAACAATATAACAATCATTCAT
GAATTATCTAAGAGACTCTATATATTTTACTTCAATTAATGAAGGGCATA
TGTATGATTCAATAGAATCTGAAACTTCAAATACTGTCGTTTCGGATTAT
GTTCATAATTTGGCTAATGGAATATACAAAGAATTTGAGTCTTTAATTTT
ACATTATGGGGAAAGCGTTGTTAAAAATTTGATGCCAATGGTAGTTTCTT
GCTTAGAAACTTTAGATAGAGTTTATTCTGAAAAACATAACATTGAAGTT
GAATTTGAATTATTAAAAGAAGATAGCGGGCAATTAATGACACAATATGA
GCGTGAAAAGCTCCAACGTAAAAAGACTGAAGAAAGTTTATTTAAAAGCG
AAGACAGCTTTTCTGAGGCTTCTAAGAAGCACGAAGAAGAATTGCAAAAG
CTGAAATCTGACCAAAAAATGATTGAGATAAGATTTAAAAATTCATTAGA
TCAAATATCAAGATTTGAAAAACGAGAAATTGAAAAACAATCAGAATATG
ATAGATTATTGTCACGATATCACGAACTTCTCAGATACCACAAGGATTTT
ATTGAAAAATCGAAAAATCACCATAATGAAATTAAGAATATTGAAAAATT
TGAAAGATTAAAATCGTATTCCAATGAAAGAAGAACCAGTAATTCTGAGG
CATTAGATGAGAATGATTCAAAGTCGGATGGATGTAACATTAATCCGCCC
AATTTGTTAACTGAACTCGGCACACAAATCAATACCCCTAATGATCCCCC
AATGGATTGGAACTTCACACCATCTGCGTCGGATGATGGAGATATTATTA
ATAGTTCCACAGAGGACATATCACACGGAGTCAATATATTGCCATTTGAT
GATGAATTAGCAGGAATGAGTCATGAGATCGAAAACATAATCAAAGAAAA
TAACGACCTAATTGCTACGAAAAACGCATTGAACATTGTTAAAGATGATC
TGATTTCTAAACTCGACGAAGCTAATAGTGAGATTGAAATCCTTCAACAC
GAAAACAACTCGCTAAACACCATGAAAACCAGTTTTAAGCTACGAATTAA
TAATCTGGAGATTGAAAACAAAAGTTTGAAGCATGAAATTATTTTACAGC
ATTTCAGAGCTAAAGACGATGGCGAAGAAAATCTTCCTATATCTCAGCGT
AAAAGATTTACTCGTTTTGAAATGACAAGAGTCCTAATGGAAAGAAATCA
ATATAAAGAAAAACTTTTAGAAATGGAAGAATATGTAAAATGGATGAAAA
TGTTGAAAAAGGAAAAGAAATTATCTATCTGGGAACGAATTATTTGATTT
ATTATCTGGGTGTGAATTACACCATTTTCGGAAAAAACATCATTTGCTCA
TCTGGGTTATTTTCACAATAACTCATCCAAAAACTCACGTTTCCCTATTC
TCGCTTTACTATCGCTACTATTGCAGCTAATCAAATTTGCGAACAGGAAG
ATGAGGAATAAATCAAATGAAAATCAAGTTATATTTAAGACAAAATCAAG
TTATTTTTTCCATATAAAGATATTTCAATGGTTGATTTATACTCGTCGAT
GTCGACTGGGAAATATCTACGTCTCGGAGATTGACGCATTCTATCTTCGT
CCCGTCATTAGATTTGTATGCGGACTTTCTGATGGAATTGTTAGACCGGG
AAGTTCGATGAGATCGATAACTTCCGGCCTCTGTTGTCGCCGCTGGCCTA
CAGCTATGCCTAGCTTGAATTTCTCAGGGAAATTCACATTTACCTGGTCT
ACTGTCAGTCTAATGTTTAATGCCATATCGTCATGGGTAGTTAGTGCAAT
TATGGGGTTTGGATCTTCCCATGTCGGCGAGCGAGTGTTTTCCAAGGTGG
AAATCGAGGGAACTGGTGCCATGGTTAAGTTATTGGCTTGTTTCAGATGG
GCTAATAGCAGAGAGTGTTCCGCCCGTTGCCGTTCGCGCCGCCGGCGATT
CATGGTGGGCTTGTGATTCCTGTTCCTCAGTAACGGAATGTTGACCGGGA
TTGGAATCGGCTCCAAGGGCATGTTGGTGAATTTCAATGATCCCGACGGG
CCATCTCGTGGAACTTGTTGACTCGGCACGATGTCAATTTCTTGTGCCCA
ATCGTGGTTGGCTAGTAATAATTGCAGTTCGGCTTCGGTGAAAGCCCTTC
GCACCAACTTTGTGAGACGGGAAATTAGCACTCATTGTGCTCGACTTTCC
ACTATTAAGTCGTTACGGCAATAAAAAAGACGGTGGATCTTCTGGTGTAA
TTCCTTGGTCTTCTCAGATGGGGACCACGACACATTTATTCTATCGTATT
TCGCGTGTACGGCGCGATATTCTTTCTCCAATGGAGACATGACGGAAATT
TGCTCGCTTACAGGGGCGCTTTTAACGATTTTTGGAATCCTCGGAAGTTT
ATACATCTAAAATTTTCAAGACTTTTTAAAATAAATAATCCAAGTTTGAA
CGAGAAAAGTGTTGCCGAAGTAAATTCGACAGACATGCCTAAAAGGACTA
GTAGTTTCATCGAAAACACTGAATTGTCAAGTAATTGCTCAGCGTCGAGA
GATCCTGAAAGACAGCAAATAAATGGATGGTCTTTACCTCGAAATGTAAA
AGTTTCAAAAGCTTCTGATGTCCCTATACCTATCTACTGTAGGCCGCTGT
CAGAAAATCAAAGTGGATTAAAATTAATTTCACCAGCTGAGATAAATTGC
GCTGTTACAATTAATGTTCATGAAAAATTTAACTTAAAAAATAAAACTTT
TGTTGGTTCGAGTATTTTTTATAATCATGAAAACGTGGAAAACCAGAATA
ATTCCAAAGTTGAAGACAGTGTCAATTCAGAAAATAGCTCCACTCAATTA
TCAGTATCAAATCAAGGTGATTCTGACCCAGCTACAGAAATCTCTGACAG
CCATGTATGGATATGTACATCATCGGATAATGAAAGCCAAATTATCGTCG
TTGATGCTTTTAGACCAGCTAAATATCTGGATGCCTTTATAATACGCAGT
TCACCCATTCAATGTTTAGGCAGTGTGCCAGGAGCTAGTCAAAACGATTA
TATTCATGTGAGTATTGATGTTTCATCTAAATCCACAGTAACAGAAAAAA
CCGATCACATATCACAAATACAAGACAGTTTTTTCCCTAAATTCAAATTG
AAAACCGTCGATTGCTATCAACTTGAGTCGCCTGCTACCAATGAGAATGC
AGCCTCTTCGTTGTCTAATAAATCTCATACAAATCAATATGTTGATGATC
AGTTCAAATCACCAAATACGAATACCTTTGTATCAAATAGTTCACAGCCA
ACAATATGGGTAGGCTGCCGAAATGGAGATCTATTTGTTCATCCTGCTAA
TGACAATAGATCTCTTTGTCTACATCATATTCAACTATCTGATTCAATCA
TAAATATAATCTATCAAAACTCTAGGGTATTTGTTTCACTAGCTAACGGT
TCTGTGGTCGTTTTTAATCGTTACATATCAAATGAAAATAAAATTCTGAT
TGGCCAATGGCAAATGTCAAGATATTATTTGCTAGAACCTGAATACTTTA
ATTATTCGATTCGCTGTTTAGAAAGTGTAAATTTGACAAATAAAATTTGG
ATGGGGTACAAAAATCAGATCATTGTATTAGATGGAGTTTCTCTTACACT
TACAAAATGTTTTGAAGCTCATCCTCGTAGCGATTATGCTGTGCGTCAAA
TGTGCTGTGCCGGAGATGGAATGTGGGTATCTTTAAGGTTGGATACAACA
CTTCGATTATTTCACATTTATAACTATCAGCACTTACAAGATTTGAATGT
GGAACCTCATGTCAACAAGTTAATTGAGCCATCATTATTAGGTCTTTCTT
TATTACGAATATCATGTTTATCAGCATCATGCAATCGCATATGGATAGGA
ACTAATAAAGGAATTATTGTCTCAGCTCCGTTTGTTAAGGATTCAAGAAA
AGAAAATGAACTTGATATCGTTAATGACTTTAATGATGTATCCTATTCTA
TGGAAAATTCATATTTACCGACATTTATTCCTTTCATTAATCATGAAAAC
TTACAATTAAGCTATCACGGTCATCGTGATTCAGTTAAATTTTTCGTTAC
TGTTCTTGTTGATGTTCCATGTTCCCTGGAAACTCCACCAAATAATAAAA
CACAGATTCAAGATGTTCCACGAAAAAATAGATTTCTTATTATGTCTGGT
GGAGAAGGTTATAAGGATTTTCGTTTTAATGAAAATATTTCGTCAATACA
CTCGAAATTCTCTCTTCCAAAATCCAATAACAAGAATGAAGAAAGCACAA
AGAACAGCAGTCATTTAATTGTATGGCAATTATTATTAAAAAATGATTTA
TAATGCCATTCACATTTTTATACATGCTTTTTGATATCACAATAATTCTT
AAATATTTTATTTTTTGTTGATTATATTTATTACTAACAGAG
back to top

protein sequence of SMED30035356-orf-1

>SMED30035356-orf-1 ID=SMED30035356-orf-1|Name=SMED30035356-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=433bp
MNYLRDSIYFTSINEGHMYDSIESETSNTVVSDYVHNLANGIYKEFESLI
LHYGESVVKNLMPMVVSCLETLDRVYSEKHNIEVEFELLKEDSGQLMTQY
EREKLQRKKTEESLFKSEDSFSEASKKHEEELQKLKSDQKMIEIRFKNSL
DQISRFEKREIEKQSEYDRLLSRYHELLRYHKDFIEKSKNHHNEIKNIEK
FERLKSYSNERRTSNSEALDENDSKSDGCNINPPNLLTELGTQINTPNDP
PMDWNFTPSASDDGDIINSSTEDISHGVNILPFDDELAGMSHEIENIIKE
NNDLIATKNALNIVKDDLISKLDEANSEIEILQHENNSLNTMKTSFKLRI
NNLEIENKSLKHEIILQHFRAKDDGEENLPISQRKRFTRFEMTRVLMERN
QYKEKLLEMEEYVKWMKMLKKEKKLSIWERII*
back to top

protein sequence of SMED30035356-orf-2

>SMED30035356-orf-2 ID=SMED30035356-orf-2|Name=SMED30035356-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=623bp
MPKRTSSFIENTELSSNCSASRDPERQQINGWSLPRNVKVSKASDVPIPI
YCRPLSENQSGLKLISPAEINCAVTINVHEKFNLKNKTFVGSSIFYNHEN
VENQNNSKVEDSVNSENSSTQLSVSNQGDSDPATEISDSHVWICTSSDNE
SQIIVVDAFRPAKYLDAFIIRSSPIQCLGSVPGASQNDYIHVSIDVSSKS
TVTEKTDHISQIQDSFFPKFKLKTVDCYQLESPATNENAASSLSNKSHTN
QYVDDQFKSPNTNTFVSNSSQPTIWVGCRNGDLFVHPANDNRSLCLHHIQ
LSDSIINIIYQNSRVFVSLANGSVVVFNRYISNENKILIGQWQMSRYYLL
EPEYFNYSIRCLESVNLTNKIWMGYKNQIIVLDGVSLTLTKCFEAHPRSD
YAVRQMCCAGDGMWVSLRLDTTLRLFHIYNYQHLQDLNVEPHVNKLIEPS
LLGLSLLRISCLSASCNRIWIGTNKGIIVSAPFVKDSRKENELDIVNDFN
DVSYSMENSYLPTFIPFINHENLQLSYHGHRDSVKFFVTVLVDVPCSLET
PPNNKTQIQDVPRKNRFLIMSGGEGYKDFRFNENISSIHSKFSLPKSNNK
NEESTKNSSHLIVWQLLLKNDL*
back to top

protein sequence of SMED30035356-orf-3

>SMED30035356-orf-3 ID=SMED30035356-orf-3|Name=SMED30035356-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=172bp
MRNKSNENQVIFKTKSSYFFHIKIFQWLIYTRRCRLGNIYVSEIDAFYLR
PVIRFVCGLSDGIVRPGSSMRSITSGLCCRRWPTAMPSLNFSGKFTFTWS
TVSLMFNAISSWVVSAIMGFGSSHVGERVFSKVEIEGTGAMVKLLACFRW
ANSRECSARCRSRRRRFMVGL*
back to top

protein sequence of SMED30035356-orf-4

>SMED30035356-orf-4 ID=SMED30035356-orf-4|Name=SMED30035356-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
MPLEPIPIPVNIPLLRNRNHKPTMNRRRRERQRAEHSLLLAHLKQANNLT
MAPVPSISTLENTRSPTWEDPNPIIALTTHDDMALNIRLTVDQVNVNFPE
KFKLGIAVGQRRQQRPEVIDLIELPGLTIPSESPHTNLMTGRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005078MAP-kinase scaffold activity
GO:0005515protein binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0043410positive regulation of MAPK cascade
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR017986WD40_repeat_dom
IPR019143JNK/Rab-associated_protein-1_N
IPR032486JIP_LZII