RIMS binding protein 2

Overview
NameRIMS binding protein 2
Smed IDSMED30035339
Length (bp)5610
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RIMS binding protein 2 (SMED30035339) t-SNE clustered cells

Violin plots show distribution of expression levels for RIMS binding protein 2 (SMED30035339) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RIMS binding protein 2 (SMED30035339) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RIMS binding protein 2 (SMED30035339) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035339

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035339h1SMcG0002980 SmedASXL_018502SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30035339h1SMcG0002980 Contig38547newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035339h1SMcG0002980 Contig38547uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035339h1SMcG0002980 Contig4976GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30035339h1SMcG0002980 dd_Smed_v4_9824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035339h1SMcG0002980 dd_Smed_v4_9824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035339h1SMcG0002980 dd_Smed_v4_9824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035339h1SMcG0002980 dd_Smed_v4_9824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30035339h1SMcG0002980 dd_Smed_v4_9824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30035339h1SMcG0002980 dd_Smed_v4_9824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035339h1SMcG0002980 dd_Smed_v4_9824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035339h1SMcG0016143 Contig4976GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30035339h1SMcG0002980 dd_Smed_v6_9824_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035339h1SMcG0002980 OX_Smed_1.0.14905ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035339h1SMcG0002980 dd_Smed_v4_9824_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30035339h1SMcG0002980 dd_Smed_v4_9824_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RIMS binding protein 2 vs. Ensembl Human
Match: TSPOAP1 (TSPO associated protein 1 [Source:HGNC Symbol;Acc:HGNC:16831])

HSP 1 Score: 134.035 bits (336), Expect = 1.710e-30
Identity = 95/242 (39.26%), Postives = 124/242 (51.24%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKSTFKPIDNSEITFQERIIGSIDRNKDSTISRSLQGKLNIDQYPIVSQSDYQNNPNQYSYNDYPMIHRKSTDSAVSYAASDPNSYQRS-QVDTYMPRQPSAGNSR-NPTEYRK----MLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFL 4682
            +R FVALFDYDP +MSPN  A  EELPF+ GQ +KVFG  D DGFY GE  GR G +P NMV+E+ V S                       +   + R   G L+ D    +      N P  YS                ++    P   +RS + ++  P QP  G  +  P+   K    M+A +DY+PQ  SPN+D +AEL F+  D+I + G +D+DGFY G  NGQRGLVPSNFL
Sbjct: 1627 VRIFVALFDYDPVSMSPNPDAGEEELPFREGQILKVFGDKDADGFYQGEGGGRTGYIPCNMVAEVAVDSPA--------------------GRQQLLQR---GYLSPD----ILLEGSGNGPFVYS---------------TAHTTGPPPKPRRSKKAESEGPAQPCPGPPKLVPSADLKAPHSMVAAFDYNPQESSPNMDVEAELPFRAGDVITVFGGMDDDGFYYGELNGQRGLVPSNFL 1826          

HSP 2 Score: 110.153 bits (274), Expect = 3.238e-23
Identity = 73/261 (27.97%), Postives = 120/261 (45.98%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDL-KRPHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPN----SNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALV 2792
            +P P ++ +   L    + V+ W+ P   V +       FHI V+G   +A+       AVL NLDL   P  I+V+++ S+G S   +C + +G+   + PS L+ +++T  SA+I+W+P NSN  H +++NG +     P  Y      L+P    + QV   +       P         A L F TL            P    D P DV+++ G  PG  ++ W+ P  +    TS  +++ GY+I  + Q I  V
Sbjct:  791 VPYPRRLVVLKQLAH--SVVLAWEPPPEQVELH-----GFHICVNGELRQALGPGAPPKAVLENLDLWAGPLHISVQALTSRGSSDPLRCCLAVGARAGVVPSQLRVHRLTATSAEITWVPGNSNLAHAIYLNGEECPPASPSTYWATFCHLRPGTPYQAQVEAQLPPQGPWEPGWERLEQRAATLQFTTL------------PAGPPDAPLDVQIEPGPSPGILIISWL-PVTIDAAGTSNGVRVTGYAIYADGQKIMEV 1031          

HSP 3 Score: 60.077 bits (144), Expect = 4.945e-8
Identity = 32/82 (39.02%), Postives = 48/82 (58.54%), Query Frame = 3
Query: 3960 KSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI---DVKSTFKP 4193
            +    I+ F+A + Y+P    PN      ELP  +G+ I ++G +DEDGF+ GE  +GRRGLVPSN V  +   D+ ++  P
Sbjct:  650 RGGARIQVFLARYSYNPFE-GPNENP-EAELPLTAGEYIYIYGNMDEDGFFEGELMDGRRGLVPSNFVERVSDDDLLTSLPP 729          
BLAST of RIMS binding protein 2 vs. Ensembl Human
Match: TSPOAP1 (TSPO associated protein 1 [Source:HGNC Symbol;Acc:HGNC:16831])

HSP 1 Score: 134.035 bits (336), Expect = 1.847e-30
Identity = 95/242 (39.26%), Postives = 124/242 (51.24%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKSTFKPIDNSEITFQERIIGSIDRNKDSTISRSLQGKLNIDQYPIVSQSDYQNNPNQYSYNDYPMIHRKSTDSAVSYAASDPNSYQRS-QVDTYMPRQPSAGNSR-NPTEYRK----MLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFL 4682
            +R FVALFDYDP +MSPN  A  EELPF+ GQ +KVFG  D DGFY GE  GR G +P NMV+E+ V S                       +   + R   G L+ D    +      N P  YS                ++    P   +RS + ++  P QP  G  +  P+   K    M+A +DY+PQ  SPN+D +AEL F+  D+I + G +D+DGFY G  NGQRGLVPSNFL
Sbjct: 1567 VRIFVALFDYDPVSMSPNPDAGEEELPFREGQILKVFGDKDADGFYQGEGGGRTGYIPCNMVAEVAVDSPA--------------------GRQQLLQR---GYLSPD----ILLEGSGNGPFVYS---------------TAHTTGPPPKPRRSKKAESEGPAQPCPGPPKLVPSADLKAPHSMVAAFDYNPQESSPNMDVEAELPFRAGDVITVFGGMDDDGFYYGELNGQRGLVPSNFL 1766          

HSP 2 Score: 110.153 bits (274), Expect = 3.016e-23
Identity = 73/261 (27.97%), Postives = 120/261 (45.98%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDL-KRPHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPN----SNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALV 2792
            +P P ++ +   L    + V+ W+ P   V +       FHI V+G   +A+       AVL NLDL   P  I+V+++ S+G S   +C + +G+   + PS L+ +++T  SA+I+W+P NSN  H +++NG +     P  Y      L+P    + QV   +       P         A L F TL            P    D P DV+++ G  PG  ++ W+ P  +    TS  +++ GY+I  + Q I  V
Sbjct:  731 VPYPRRLVVLKQLAH--SVVLAWEPPPEQVELH-----GFHICVNGELRQALGPGAPPKAVLENLDLWAGPLHISVQALTSRGSSDPLRCCLAVGARAGVVPSQLRVHRLTATSAEITWVPGNSNLAHAIYLNGEECPPASPSTYWATFCHLRPGTPYQAQVEAQLPPQGPWEPGWERLEQRAATLQFTTL------------PAGPPDAPLDVQIEPGPSPGILIISWL-PVTIDAAGTSNGVRVTGYAIYADGQKIMEV 971          

HSP 3 Score: 60.077 bits (144), Expect = 5.677e-8
Identity = 32/82 (39.02%), Postives = 48/82 (58.54%), Query Frame = 3
Query: 3960 KSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI---DVKSTFKP 4193
            +    I+ F+A + Y+P    PN      ELP  +G+ I ++G +DEDGF+ GE  +GRRGLVPSN V  +   D+ ++  P
Sbjct:  590 RGGARIQVFLARYSYNPFE-GPNENP-EAELPLTAGEYIYIYGNMDEDGFFEGELMDGRRGLVPSNFVERVSDDDLLTSLPP 669          
BLAST of RIMS binding protein 2 vs. Ensembl Human
Match: RIMBP2 (RIMS binding protein 2 [Source:HGNC Symbol;Acc:HGNC:30339])

HSP 1 Score: 105.145 bits (261), Expect = 8.770e-22
Identity = 91/343 (26.53%), Postives = 157/343 (45.77%), Query Frame = 3
Query: 1956 NSACNKDYGETPNNELGFNTNLESQRKHI-PAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVT 2957
            +S  + D G T N+    + N++   + I P P +I +   L +  + +V W+ P +        ++++++ VD      +++     A++  L++    +RI+V+ V S+G S + QCT+ +G    +APSHL+ + IT  SAQ+SW+P+NSN+ H +++N  ++       YK     L+P+   KV+V     +     P        AF++F TLP       G   P      P DV ++ G  P    V W  P L     S    + GY +    Q +A V     D  ++ L+ LR++                  +TVRT++   +S  DSAV 
Sbjct:  268 HSPTHIDAGITDNSAGTLDVNIDDIGEDIVPYPRKITLIKQLAK--SVIVGWEPPAVPPGWG--TVSSYNVLVDKETRMNLTLGSRTKALIEKLNMAACTYRISVQCVTSRGSSDELQCTLLVGKDVVVAPSHLRVDNITQISAQLSWLPTNSNYSHVIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVEFSTLPA------GPPAP------PQDVTVQAGVTPATIRVSWRPPVLTPTGLSNGANVTGYGVYAKGQRVAEVIFPTADSTAVELVRLRSLEAK--------------GVTVRTLSAQGES-VDSAVA 579          

HSP 2 Score: 98.5969 bits (244), Expect = 7.467e-20
Identity = 46/64 (71.88%), Postives = 48/64 (75.00%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R FVALFDYDP TMSPN  A  EELPFK GQ IKV+G  D DGFY GET  R GL+P NMVSEI
Sbjct:  851 RIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEI 914          

HSP 3 Score: 77.411 bits (189), Expect = 2.323e-13
Identity = 36/64 (56.25%), Postives = 45/64 (70.31%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R  VAL+DYDP   SPN   +  EL F +G  I VFG++DEDGFY GE NG++GLVPSN + E+
Sbjct:  955 RRMVALYDYDPRESSPNVD-VEAELTFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEV 1017          

HSP 4 Score: 73.9442 bits (180), Expect = 2.657e-12
Identity = 46/77 (59.74%), Postives = 57/77 (74.03%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPSY 4733
            R+M+ALYDYDP+  SPNVD +AEL F   DII + GEIDEDGFY G  NGQ+GLVPSNFL ++P  +E  +   PS+
Sbjct:  955 RRMVALYDYDPRESSPNVDVEAELTFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEVPDDVEVYLSDAPSH 1031          

HSP 5 Score: 56.225 bits (134), Expect = 7.418e-7
Identity = 31/71 (43.66%), Postives = 43/71 (60.56%), Query Frame = 3
Query: 3951 SHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMV 4160
            S Q+ +  +   VA + Y+P    PN      ELP  +G+ + V+G +DEDGFY GE  +G+RGLVPSN V
Sbjct:  161 SKQRYSGKVHLCVARYSYNPFD-GPNENP-EAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFV 229          
BLAST of RIMS binding protein 2 vs. Ensembl Human
Match: RIMBP2 (RIMS binding protein 2 [Source:HGNC Symbol;Acc:HGNC:30339])

HSP 1 Score: 103.605 bits (257), Expect = 2.082e-21
Identity = 91/343 (26.53%), Postives = 157/343 (45.77%), Query Frame = 3
Query: 1956 NSACNKDYGETPNNELGFNTNLESQRKHI-PAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVT 2957
            +S  + D G T N+    + N++   + I P P +I +   L +  + +V W+ P +        ++++++ VD      +++     A++  L++    +RI+V+ V S+G S + QCT+ +G    +APSHL+ + IT  SAQ+SW+P+NSN+ H +++N  ++       YK     L+P+   KV+V     +     P        AF++F TLP       G   P      P DV ++ G  P    V W  P L     S    + GY +    Q +A V     D  ++ L+ LR++                  +TVRT++   +S  DSAV 
Sbjct:  292 HSPTHIDAGITDNSAGTLDVNIDDIGEDIVPYPRKITLIKQLAK--SVIVGWEPPAVPPGWG--TVSSYNVLVDKETRMNLTLGSRTKALIEKLNMAACTYRISVQCVTSRGSSDELQCTLLVGKDVVVAPSHLRVDNITQISAQLSWLPTNSNYSHVIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVEFSTLPA------GPPAP------PQDVTVQAGVTPATIRVSWRPPVLTPTGLSNGANVTGYGVYAKGQRVAEVIFPTADSTAVELVRLRSLE--------------AKGVTVRTLSAQGES-VDSAVA 603          

HSP 2 Score: 56.225 bits (134), Expect = 6.819e-7
Identity = 31/71 (43.66%), Postives = 43/71 (60.56%), Query Frame = 3
Query: 3951 SHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMV 4160
            S Q+ +  +   VA + Y+P    PN      ELP  +G+ + V+G +DEDGFY GE  +G+RGLVPSN V
Sbjct:  185 SKQRYSGKVHLCVARYSYNPFD-GPNENP-EAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFV 253          
BLAST of RIMS binding protein 2 vs. Ensembl Human
Match: RIMBP2 (RIMS binding protein 2 [Source:HGNC Symbol;Acc:HGNC:30339])

HSP 1 Score: 103.99 bits (258), Expect = 2.101e-21
Identity = 91/343 (26.53%), Postives = 157/343 (45.77%), Query Frame = 3
Query: 1956 NSACNKDYGETPNNELGFNTNLESQRKHI-PAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVT 2957
            +S  + D G T N+    + N++   + I P P +I +   L +  + +V W+ P +        ++++++ VD      +++     A++  L++    +RI+V+ V S+G S + QCT+ +G    +APSHL+ + IT  SAQ+SW+P+NSN+ H +++N  ++       YK     L+P+   KV+V     +     P        AF++F TLP       G   P      P DV ++ G  P    V W  P L     S    + GY +    Q +A V     D  ++ L+ LR++                  +TVRT++   +S  DSAV 
Sbjct:  285 HSPTHIDAGITDNSAGTLDVNIDDIGEDIVPYPRKITLIKQLAK--SVIVGWEPPAVPPGWG--TVSSYNVLVDKETRMNLTLGSRTKALIEKLNMAACTYRISVQCVTSRGSSDELQCTLLVGKDVVVAPSHLRVDNITQISAQLSWLPTNSNYSHVIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVEFSTLPA------GPPAP------PQDVTVQAGVTPATIRVSWRPPVLTPTGLSNGANVTGYGVYAKGQRVAEVIFPTADSTAVELVRLRSLE--------------AKGVTVRTLSAQGES-VDSAVA 596          

HSP 2 Score: 98.2117 bits (243), Expect = 1.265e-19
Identity = 46/64 (71.88%), Postives = 48/64 (75.00%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R FVALFDYDP TMSPN  A  EELPFK GQ IKV+G  D DGFY GET  R GL+P NMVSEI
Sbjct: 1107 RIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEI 1170          

HSP 3 Score: 77.0258 bits (188), Expect = 3.875e-13
Identity = 36/64 (56.25%), Postives = 45/64 (70.31%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R  VAL+DYDP   SPN   +  EL F +G  I VFG++DEDGFY GE NG++GLVPSN + E+
Sbjct: 1211 RRMVALYDYDPRESSPNV-DVEAELTFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEV 1273          

HSP 4 Score: 73.559 bits (179), Expect = 4.329e-12
Identity = 46/77 (59.74%), Postives = 57/77 (74.03%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPSY 4733
            R+M+ALYDYDP+  SPNVD +AEL F   DII + GEIDEDGFY G  NGQ+GLVPSNFL ++P  +E  +   PS+
Sbjct: 1211 RRMVALYDYDPRESSPNVDVEAELTFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEVPDDVEVYLSDAPSH 1287          

HSP 5 Score: 55.8398 bits (133), Expect = 1.122e-6
Identity = 31/71 (43.66%), Postives = 43/71 (60.56%), Query Frame = 3
Query: 3951 SHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMV 4160
            S Q+ +  +   VA + Y+P    PN      ELP  +G+ + V+G +DEDGFY GE  +G+RGLVPSN V
Sbjct:  178 SKQRYSGKVHLCVARYSYNPFD-GPNENP-EAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFV 246          
BLAST of RIMS binding protein 2 vs. Ensembl Celegans
Match: rimb-1 (RIM Binding protein [Source:UniProtKB/TrEMBL;Acc:Q9N415])

HSP 1 Score: 118.242 bits (295), Expect = 3.718e-26
Identity = 81/276 (29.35%), Postives = 136/276 (49.28%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFS-LAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKW--VCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPV 2858
            IP P ++ +E  L++ +  +V W  P+         ++ +H+ VDG     V  +    A++ ++ L+    ++VR+V   G S DA CTI IG+ + +AP  ++  ++T  SA + W PSNSN  H V +N  K   C P ++++ + GLQP  + +V V     K V        C  +DF+TLP       G+  P      P++V+++ G++PG  +V W  V  Q        +  Y +  + + IA V  A  D   + L DL + +PPV
Sbjct:  192 IPCPRELIVEKKLSRSA--LVSWSSPEESF----VAVSQYHVCVDGTVRAIVPGSYKCRALVEDIPLESSVNLSVRAVTEHGHSPDACCTIAIGNEAQVAPQQVRVWQVTPVSAYVRWYPSNSNAEHVVSLNAVKVGVCPPTVFQVQLHGLQPSTIYRVSVRTKHPKAVLEQRPVERC--VDFKTLPKI-----GLPDP------PSNVQVEGGAQPGTLLVSWIPVTNQPKPPSRAAVASYLVYADGKNIAQVPQATADHVVLRLADL-SDDPPV 447          

HSP 2 Score: 76.2554 bits (186), Expect = 2.112e-13
Identity = 40/68 (58.82%), Postives = 45/68 (66.18%), Query Frame = 3
Query: 3966 AENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            ++  R+FVALFDY  A MSPN  A  EEL F+  Q IKV+G  D DGFY G    R GLVPSNMV EI
Sbjct:  758 SDECRWFVALFDYT-AAMSPNPNAEFEELQFRKHQLIKVYGGQDIDGFYHGAIGQRVGLVPSNMVIEI 824          

HSP 3 Score: 70.4774 bits (171), Expect = 1.333e-11
Identity = 34/59 (57.63%), Postives = 38/59 (64.41%), Query Frame = 3
Query: 3984 FVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMV 4160
             VA FDYD   +SPN  A   EL F+ G  I V G +DEDGFY GE NG RGLVPSN +
Sbjct: 1100 MVAKFDYDSRQLSPNVDAEQVELSFRQGDIIIVLGDMDEDGFYMGELNGLRGLVPSNFL 1158          

HSP 4 Score: 60.8474 bits (146), Expect = 1.057e-8
Identity = 42/76 (55.26%), Postives = 57/76 (75.00%), Query Frame = 3
Query: 4506 KMLALYDYDPQTLSPNVDSD-AELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPS 4730
            +M+A +DYD + LSPNVD++  EL+F+  DII ++G++DEDGFYMG  NG RGLVPSNFL   P PL   + +QP+
Sbjct: 1099 RMVAKFDYDSRQLSPNVDAEQVELSFRQGDIIIVLGDMDEDGFYMGELNGLRGLVPSNFLQ--PQPLNNLLPSQPT 1172          

HSP 5 Score: 59.3066 bits (142), Expect = 3.059e-8
Identity = 34/71 (47.89%), Postives = 42/71 (59.15%), Query Frame = 3
Query: 3960 KSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGET-NGRRGLVPSNMVSEI 4169
            +S  N R F ALF Y P   SPN      EL  + G  + V G++D DGFY GET +GR+GLVPSN V  +
Sbjct:   56 RSRPNSRVFRALFQYLPLRDSPNENP-QLELSLQPGDVVLVKGEMDSDGFYCGETLDGRQGLVPSNYVERV 125          
BLAST of RIMS binding protein 2 vs. Ensembl Fly
Match: Rbp (gene:FBgn0262483 transcript:FBtr0433497)

HSP 1 Score: 130.183 bits (326), Expect = 1.168e-29
Identity = 89/291 (30.58%), Postives = 143/291 (49.14%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQ-IDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQ-SKDAQCTIEIG--SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHP----VIDKFVDNSPNSNNC----------AFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLVTSPNIK--IVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINP 2852
            +PAP  + +E  LN+  + ++ W  P+ +  N+    I ++H+YVDG     V  NE   A++  +D  RPHRI+VRSV    Q S+DA CT+ IG  +  L PS ++A+ IT +SA ISW+P+NSN +H V VN  +     PG+Y+  + GL P    +V V       + +   N   +             A+ DF+TL      ++G+  P      P +++L+ G + G  +V W   Q V  P     + GY++  + + +  +N    D   I +  L   NP
Sbjct:  679 VPAPKHLTLERQLNK--SVLIGWSPPEPVGYNL----IDSYHVYVDGVLKVTVKANERTRALIEGVDSTRPHRISVRSVTQNRQTSRDAACTMIIGRDTAHLGPSAVRASHITCSSAVISWLPANSNHQHVVCVNNVEVRTVKPGMYRHTITGLAPSTQYRVTVRAKHLRAVGQHAANVGQTGGAGRPGQEEAPGAYADFRTL------TKGLPDP------PQEIQLEAGPQDGTILVTW---QPVNRPTSTGPVTGYAVYADGKKVTDINSPTGDHALIDIGKLGVFNP 948          

HSP 2 Score: 99.7525 bits (247), Expect = 2.092e-20
Identity = 44/65 (67.69%), Postives = 49/65 (75.38%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEID 4172
            RYFVA+FDYDP+TMSPN     EELPF+ G  IKVFG  D DGFY GE  GRRG VP NMVSE++
Sbjct: 1223 RYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGELRGRRGYVPHNMVSEVE 1287          

HSP 3 Score: 78.1814 bits (191), Expect = 8.387e-14
Identity = 34/64 (53.12%), Postives = 47/64 (73.44%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSE 4166
            ++  +AL+DYDP  +SPN  A   EL FK+G+ I V+G +DEDGFY GE +G RGLVPSN +++
Sbjct: 1349 VKRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLAD 1412          

HSP 4 Score: 72.7886 bits (177), Expect = 3.258e-12
Identity = 42/65 (64.62%), Postives = 52/65 (80.00%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSD-AELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLP 4694
            ++M+ALYDYDPQ LSPNVD++  EL FK  +II + G++DEDGFYMG  +G RGLVPSNFL D P
Sbjct: 1350 KRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLADAP 1414          
BLAST of RIMS binding protein 2 vs. Ensembl Fly
Match: Rbp (gene:FBgn0262483 transcript:FBtr0433495)

HSP 1 Score: 130.183 bits (326), Expect = 1.231e-29
Identity = 89/291 (30.58%), Postives = 143/291 (49.14%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQ-IDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQ-SKDAQCTIEIG--SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHP----VIDKFVDNSPNSNNC----------AFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLVTSPNIK--IVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINP 2852
            +PAP  + +E  LN+  + ++ W  P+ +  N+    I ++H+YVDG     V  NE   A++  +D  RPHRI+VRSV    Q S+DA CT+ IG  +  L PS ++A+ IT +SA ISW+P+NSN +H V VN  +     PG+Y+  + GL P    +V V       + +   N   +             A+ DF+TL      ++G+  P      P +++L+ G + G  +V W   Q V  P     + GY++  + + +  +N    D   I +  L   NP
Sbjct:  668 VPAPKHLTLERQLNK--SVLIGWSPPEPVGYNL----IDSYHVYVDGVLKVTVKANERTRALIEGVDSTRPHRISVRSVTQNRQTSRDAACTMIIGRDTAHLGPSAVRASHITCSSAVISWLPANSNHQHVVCVNNVEVRTVKPGMYRHTITGLAPSTQYRVTVRAKHLRAVGQHAANVGQTGGAGRPGQEEAPGAYADFRTL------TKGLPDP------PQEIQLEAGPQDGTILVTW---QPVNRPTSTGPVTGYAVYADGKKVTDINSPTGDHALIDIGKLGVFNP 937          

HSP 2 Score: 99.7525 bits (247), Expect = 2.496e-20
Identity = 44/65 (67.69%), Postives = 49/65 (75.38%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEID 4172
            RYFVA+FDYDP+TMSPN     EELPF+ G  IKVFG  D DGFY GE  GRRG VP NMVSE++
Sbjct: 1239 RYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGELRGRRGYVPHNMVSEVE 1303          

HSP 3 Score: 77.7962 bits (190), Expect = 1.040e-13
Identity = 34/64 (53.12%), Postives = 47/64 (73.44%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSE 4166
            ++  +AL+DYDP  +SPN  A   EL FK+G+ I V+G +DEDGFY GE +G RGLVPSN +++
Sbjct: 1365 VKRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLAD 1428          

HSP 4 Score: 72.7886 bits (177), Expect = 3.287e-12
Identity = 42/65 (64.62%), Postives = 52/65 (80.00%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSD-AELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLP 4694
            ++M+ALYDYDPQ LSPNVD++  EL FK  +II + G++DEDGFYMG  +G RGLVPSNFL D P
Sbjct: 1366 KRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLADAP 1430          
BLAST of RIMS binding protein 2 vs. Ensembl Fly
Match: Rbp (gene:FBgn0262483 transcript:FBtr0304826)

HSP 1 Score: 130.183 bits (326), Expect = 1.267e-29
Identity = 89/291 (30.58%), Postives = 143/291 (49.14%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQ-IDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQ-SKDAQCTIEIG--SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHP----VIDKFVDNSPNSNNC----------AFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLVTSPNIK--IVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINP 2852
            +PAP  + +E  LN+  + ++ W  P+ +  N+    I ++H+YVDG     V  NE   A++  +D  RPHRI+VRSV    Q S+DA CT+ IG  +  L PS ++A+ IT +SA ISW+P+NSN +H V VN  +     PG+Y+  + GL P    +V V       + +   N   +             A+ DF+TL      ++G+  P      P +++L+ G + G  +V W   Q V  P     + GY++  + + +  +N    D   I +  L   NP
Sbjct:  747 VPAPKHLTLERQLNK--SVLIGWSPPEPVGYNL----IDSYHVYVDGVLKVTVKANERTRALIEGVDSTRPHRISVRSVTQNRQTSRDAACTMIIGRDTAHLGPSAVRASHITCSSAVISWLPANSNHQHVVCVNNVEVRTVKPGMYRHTITGLAPSTQYRVTVRAKHLRAVGQHAANVGQTGGAGRPGQEEAPGAYADFRTL------TKGLPDP------PQEIQLEAGPQDGTILVTW---QPVNRPTSTGPVTGYAVYADGKKVTDINSPTGDHALIDIGKLGVFNP 1016          

HSP 2 Score: 99.3673 bits (246), Expect = 2.640e-20
Identity = 44/65 (67.69%), Postives = 49/65 (75.38%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEID 4172
            RYFVA+FDYDP+TMSPN     EELPF+ G  IKVFG  D DGFY GE  GRRG VP NMVSE++
Sbjct: 1318 RYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGELRGRRGYVPHNMVSEVE 1382          

HSP 3 Score: 77.7962 bits (190), Expect = 1.086e-13
Identity = 34/64 (53.12%), Postives = 47/64 (73.44%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSE 4166
            ++  +AL+DYDP  +SPN  A   EL FK+G+ I V+G +DEDGFY GE +G RGLVPSN +++
Sbjct: 1444 VKRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLAD 1507          

HSP 4 Score: 72.7886 bits (177), Expect = 3.608e-12
Identity = 42/65 (64.62%), Postives = 52/65 (80.00%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSD-AELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLP 4694
            ++M+ALYDYDPQ LSPNVD++  EL FK  +II + G++DEDGFYMG  +G RGLVPSNFL D P
Sbjct: 1445 KRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLADAP 1509          
BLAST of RIMS binding protein 2 vs. Ensembl Fly
Match: Rbp (gene:FBgn0262483 transcript:FBtr0304827)

HSP 1 Score: 130.183 bits (326), Expect = 1.269e-29
Identity = 89/291 (30.58%), Postives = 143/291 (49.14%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQ-IDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQ-SKDAQCTIEIG--SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHP----VIDKFVDNSPNSNNC----------AFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLVTSPNIK--IVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINP 2852
            +PAP  + +E  LN+  + ++ W  P+ +  N+    I ++H+YVDG     V  NE   A++  +D  RPHRI+VRSV    Q S+DA CT+ IG  +  L PS ++A+ IT +SA ISW+P+NSN +H V VN  +     PG+Y+  + GL P    +V V       + +   N   +             A+ DF+TL      ++G+  P      P +++L+ G + G  +V W   Q V  P     + GY++  + + +  +N    D   I +  L   NP
Sbjct:  747 VPAPKHLTLERQLNK--SVLIGWSPPEPVGYNL----IDSYHVYVDGVLKVTVKANERTRALIEGVDSTRPHRISVRSVTQNRQTSRDAACTMIIGRDTAHLGPSAVRASHITCSSAVISWLPANSNHQHVVCVNNVEVRTVKPGMYRHTITGLAPSTQYRVTVRAKHLRAVGQHAANVGQTGGAGRPGQEEAPGAYADFRTL------TKGLPDP------PQEIQLEAGPQDGTILVTW---QPVNRPTSTGPVTGYAVYADGKKVTDINSPTGDHALIDIGKLGVFNP 1016          

HSP 2 Score: 99.7525 bits (247), Expect = 2.499e-20
Identity = 44/65 (67.69%), Postives = 49/65 (75.38%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEID 4172
            RYFVA+FDYDP+TMSPN     EELPF+ G  IKVFG  D DGFY GE  GRRG VP NMVSE++
Sbjct: 1291 RYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGELRGRRGYVPHNMVSEVE 1355          

HSP 3 Score: 77.7962 bits (190), Expect = 1.038e-13
Identity = 34/64 (53.12%), Postives = 47/64 (73.44%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSE 4166
            ++  +AL+DYDP  +SPN  A   EL FK+G+ I V+G +DEDGFY GE +G RGLVPSN +++
Sbjct: 1417 VKRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLAD 1480          

HSP 4 Score: 72.7886 bits (177), Expect = 3.597e-12
Identity = 42/65 (64.62%), Postives = 52/65 (80.00%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSD-AELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLP 4694
            ++M+ALYDYDPQ LSPNVD++  EL FK  +II + G++DEDGFYMG  +G RGLVPSNFL D P
Sbjct: 1418 KRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLADAP 1482          
BLAST of RIMS binding protein 2 vs. Ensembl Fly
Match: Rbp (gene:FBgn0262483 transcript:FBtr0433493)

HSP 1 Score: 129.798 bits (325), Expect = 1.438e-29
Identity = 89/291 (30.58%), Postives = 143/291 (49.14%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQ-IDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQ-SKDAQCTIEIG--SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHP----VIDKFVDNSPNSNNC----------AFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLVTSPNIK--IVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINP 2852
            +PAP  + +E  LN+  + ++ W  P+ +  N+    I ++H+YVDG     V  NE   A++  +D  RPHRI+VRSV    Q S+DA CT+ IG  +  L PS ++A+ IT +SA ISW+P+NSN +H V VN  +     PG+Y+  + GL P    +V V       + +   N   +             A+ DF+TL      ++G+  P      P +++L+ G + G  +V W   Q V  P     + GY++  + + +  +N    D   I +  L   NP
Sbjct:  678 VPAPKHLTLERQLNK--SVLIGWSPPEPVGYNL----IDSYHVYVDGVLKVTVKANERTRALIEGVDSTRPHRISVRSVTQNRQTSRDAACTMIIGRDTAHLGPSAVRASHITCSSAVISWLPANSNHQHVVCVNNVEVRTVKPGMYRHTITGLAPSTQYRVTVRAKHLRAVGQHAANVGQTGGAGRPGQEEAPGAYADFRTL------TKGLPDP------PQEIQLEAGPQDGTILVTW---QPVNRPTSTGPVTGYAVYADGKKVTDINSPTGDHALIDIGKLGVFNP 947          

HSP 2 Score: 99.7525 bits (247), Expect = 2.574e-20
Identity = 44/65 (67.69%), Postives = 49/65 (75.38%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEID 4172
            RYFVA+FDYDP+TMSPN     EELPF+ G  IKVFG  D DGFY GE  GRRG VP NMVSE++
Sbjct: 1222 RYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGELRGRRGYVPHNMVSEVE 1286          

HSP 3 Score: 77.7962 bits (190), Expect = 1.038e-13
Identity = 34/64 (53.12%), Postives = 47/64 (73.44%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSE 4166
            ++  +AL+DYDP  +SPN  A   EL FK+G+ I V+G +DEDGFY GE +G RGLVPSN +++
Sbjct: 1348 VKRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLAD 1411          

HSP 4 Score: 72.7886 bits (177), Expect = 3.539e-12
Identity = 42/65 (64.62%), Postives = 52/65 (80.00%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSD-AELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLP 4694
            ++M+ALYDYDPQ LSPNVD++  EL FK  +II + G++DEDGFYMG  +G RGLVPSNFL D P
Sbjct: 1349 KRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLADAP 1413          
BLAST of RIMS binding protein 2 vs. Ensembl Zebrafish
Match: RIMBP2 (si:ch73-287m6.1 [Source:ZFIN;Acc:ZDB-GENE-100920-2])

HSP 1 Score: 102.449 bits (254), Expect = 3.500e-21
Identity = 79/302 (26.16%), Postives = 141/302 (46.69%), Query Frame = 3
Query: 1965 CNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTI 2846
            C+   G     ELG +         +P P +I +   L +  + +V W+ P + +     NI  ++I V+G    +V        +L  LDL    +R++V+SV  +G S + +CT+ +G +  +AP+ L+ + I  +SA++SW+PSNSN+ H V+++G ++    P  YK+    L+   + KV+V     +   + P        A ++F T       + G   P      P +V+++ G  PG   V+W  P +     S    I+GY++    Q IA V     D  ++ L  L+ +
Sbjct:  275 CSNGTGALDGEELGEDI--------VPYPRKINLIKQLAR--SVIVAWEAPMVPLGWG--NINGYNILVEGEVRSSVPFGGRTKLLLEKLDLAAFTYRVSVQSVTDRGLSDELRCTLLVGRNVVVAPTGLRMDDILRDSAELSWLPSNSNYAHVVYLDGVEHAVVKPCSYKLRFVNLKAATVYKVKVLAKPHQVPWHMPLEQREKREAGVEFCT------QAAGPPLP------PQEVQVQCGHAPGILQVRWKPPAMSPIGMSNGANIIGYAVCTKGQRIAEVLYPMADYVAVELNRLQCL 552          

HSP 2 Score: 100.138 bits (248), Expect = 1.706e-20
Identity = 46/67 (68.66%), Postives = 50/67 (74.63%), Query Frame = 3
Query: 3969 ENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            E+ R FVALFDYDP +MSPN  A  EELPFK GQ IKV+G  D DGFY GE  GR GL+P NMVSEI
Sbjct:  877 EDFRIFVALFDYDPLSMSPNPDAADEELPFKEGQIIKVYGDKDNDGFYRGEIRGRSGLIPCNMVSEI 943          

HSP 3 Score: 82.8037 bits (203), Expect = 3.519e-15
Identity = 55/125 (44.00%), Postives = 71/125 (56.80%), Query Frame = 3
Query: 4482 SRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPSYQGSFDNMHNPNQYKERNFQAVS-NFPEPPPNRDNRVRTKPF 4853
             R+P   R+M+ALYDYDP+  SPNVD +AEL F   DI+ + G+IDEDGFY G  NG RGLVPSNFL ++P  +E  +   PS+ G  ++   P    E     V    P P P R      +P 
Sbjct:  975 GRHPVATRRMVALYDYDPRESSPNVDVEAELTFCAGDIVAVFGDIDEDGFYYGELNGHRGLVPSNFLEEVPDDVEVYLTDTPSHHGQDESNPAPAARPEAKRVPVERTVPAPAPGRPASPTVRPL 1099          

HSP 4 Score: 77.0258 bits (188), Expect = 1.888e-13
Identity = 36/64 (56.25%), Postives = 43/64 (67.19%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R  VAL+DYDP   SPN   +  EL F +G  + VFG +DEDGFY GE NG RGLVPSN + E+
Sbjct:  982 RRMVALYDYDPRESSPNVD-VEAELTFCAGDIVAVFGDIDEDGFYYGELNGHRGLVPSNFLEEV 1044          

HSP 5 Score: 52.373 bits (124), Expect = 7.058e-6
Identity = 29/72 (40.28%), Postives = 41/72 (56.94%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEIDVKSTF 4187
            +R   A + Y+P    PN      ELP  +G+ + V+G +D+DGFY GE  +G+RGLVPSN V  +  K   
Sbjct:  168 VRLCTARYSYNPYD-GPNEHP-EAELPLVAGKYLYVYGNMDDDGFYEGELLDGQRGLVPSNFVEFVQDKEKL 237          
BLAST of RIMS binding protein 2 vs. Ensembl Zebrafish
Match: si:ch211-105f12.2 (si:ch211-105f12.2 [Source:ZFIN;Acc:ZDB-GENE-131127-333])

HSP 1 Score: 95.1301 bits (235), Expect = 3.882e-21
Identity = 47/83 (56.63%), Postives = 56/83 (67.47%), Query Frame = 3
Query: 3972 NIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKSTFKPIDNSEITFQ 4220
            N+R FVALF Y+PA MSPN   + EELPF+ GQ IKV+G  D DGFY GET  R G VPSNMVSEI       P+++ EI  +
Sbjct:   62 NVRLFVALFSYNPALMSPNPETMEEELPFEQGQIIKVYGDKDADGFYNGETGTRCGFVPSNMVSEI-------PVEDGEIKLR 137          

HSP 2 Score: 74.7146 bits (182), Expect = 4.631e-14
Identity = 35/65 (53.85%), Postives = 45/65 (69.23%), Query Frame = 3
Query: 3966 AENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMV 4160
             E +   VA+FDYDP   SPN   I +ELPF++G  I VFG++D DGFY G+ +G RGLVPSN +
Sbjct:  162 GEKVHRMVAIFDYDPWESSPNI-DIEDELPFRAGDIIYVFGEMDCDGFYYGDLHGYRGLVPSNFL 225          

HSP 3 Score: 58.9214 bits (141), Expect = 1.078e-8
Identity = 36/64 (56.25%), Postives = 46/64 (71.88%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLP 4694
             +M+A++DYDP   SPN+D + EL F+  DII + GE+D DGFY G  +G RGLVPSNFL  LP
Sbjct:  166 HRMVAIFDYDPWESSPNIDIEDELPFRAGDIIYVFGEMDCDGFYYGDLHGYRGLVPSNFLQPLP 229          
BLAST of RIMS binding protein 2 vs. Ensembl Zebrafish
Match: RIMBP2 (si:ch73-287m6.1 [Source:ZFIN;Acc:ZDB-GENE-100920-2])

HSP 1 Score: 102.449 bits (254), Expect = 4.209e-21
Identity = 79/302 (26.16%), Postives = 141/302 (46.69%), Query Frame = 3
Query: 1965 CNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTI 2846
            C+   G     ELG +         +P P +I +   L +  + +V W+ P + +     NI  ++I V+G    +V        +L  LDL    +R++V+SV  +G S + +CT+ +G +  +AP+ L+ + I  +SA++SW+PSNSN+ H V+++G ++    P  YK+    L+   + KV+V     +   + P        A ++F T       + G   P      P +V+++ G  PG   V+W  P +     S    I+GY++    Q IA V     D  ++ L  L+ +
Sbjct:  293 CSNGTGALDGEELGEDI--------VPYPRKINLIKQLAR--SVIVAWEAPMVPLGWG--NINGYNILVEGEVRSSVPFGGRTKLLLEKLDLAAFTYRVSVQSVTDRGLSDELRCTLLVGRNVVVAPTGLRMDDILRDSAELSWLPSNSNYAHVVYLDGVEHAVVKPCSYKLRFVNLKAATVYKVKVLAKPHQVPWHMPLEQREKREAGVEFCT------QAAGPPLP------PQEVQVQCGHAPGILQVRWKPPAMSPIGMSNGANIIGYAVCTKGQRIAEVLYPMADYVAVELNRLQCL 570          

HSP 2 Score: 100.523 bits (249), Expect = 1.460e-20
Identity = 46/67 (68.66%), Postives = 50/67 (74.63%), Query Frame = 3
Query: 3969 ENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            E+ R FVALFDYDP +MSPN  A  EELPFK GQ IKV+G  D DGFY GE  GR GL+P NMVSEI
Sbjct:  991 EDFRIFVALFDYDPLSMSPNPDAADEELPFKEGQIIKVYGDKDNDGFYRGEIRGRSGLIPCNMVSEI 1057          

HSP 3 Score: 79.337 bits (194), Expect = 4.069e-14
Identity = 47/86 (54.65%), Postives = 60/86 (69.77%), Query Frame = 3
Query: 4482 SRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPSYQG 4739
             R+P   R+M+ALYDYDP+  SPNVD +AEL F   DI+ + G+IDEDGFY G  NG RGLVPSNFL ++P  +E  +   PS+ G
Sbjct: 1089 GRHPVATRRMVALYDYDPRESSPNVDVEAELTFCAGDIVAVFGDIDEDGFYYGELNGHRGLVPSNFLEEVPDDVEVYLTDTPSHHG 1174          

HSP 4 Score: 77.411 bits (189), Expect = 1.669e-13
Identity = 36/64 (56.25%), Postives = 43/64 (67.19%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R  VAL+DYDP   SPN   +  EL F +G  + VFG +DEDGFY GE NG RGLVPSN + E+
Sbjct: 1096 RRMVALYDYDPRESSPNVD-VEAELTFCAGDIVAVFGDIDEDGFYYGELNGHRGLVPSNFLEEV 1158          

HSP 5 Score: 52.7582 bits (125), Expect = 5.267e-6
Identity = 29/72 (40.28%), Postives = 41/72 (56.94%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEIDVKSTF 4187
            +R   A + Y+P    PN      ELP  +G+ + V+G +D+DGFY GE  +G+RGLVPSN V  +  K   
Sbjct:  186 VRLCTARYSYNPYD-GPNEHP-EAELPLVAGKYLYVYGNMDDDGFYEGELLDGQRGLVPSNFVEFVQDKEKL 255          
BLAST of RIMS binding protein 2 vs. Ensembl Zebrafish
Match: RIMBP2 (si:ch73-287m6.1 [Source:ZFIN;Acc:ZDB-GENE-100920-2])

HSP 1 Score: 102.064 bits (253), Expect = 4.958e-21
Identity = 79/302 (26.16%), Postives = 141/302 (46.69%), Query Frame = 3
Query: 1965 CNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTI 2846
            C+   G     ELG +         +P P +I +   L +  + +V W+ P + +     NI  ++I V+G    +V        +L  LDL    +R++V+SV  +G S + +CT+ +G +  +AP+ L+ + I  +SA++SW+PSNSN+ H V+++G ++    P  YK+    L+   + KV+V     +   + P        A ++F T       + G   P      P +V+++ G  PG   V+W  P +     S    I+GY++    Q IA V     D  ++ L  L+ +
Sbjct:  293 CSNGTGALDGEELGEDI--------VPYPRKINLIKQLAR--SVIVAWEAPMVPLGWG--NINGYNILVEGEVRSSVPFGGRTKLLLEKLDLAAFTYRVSVQSVTDRGLSDELRCTLLVGRNVVVAPTGLRMDDILRDSAELSWLPSNSNYAHVVYLDGVEHAVVKPCSYKLRFVNLKAATVYKVKVLAKPHQVPWHMPLEQREKREAGVEFCT------QAAGPPLP------PQEVQVQCGHAPGILQVRWKPPAMSPIGMSNGANIIGYAVCTKGQRIAEVLYPMADYVAVELNRLQCL 570          

HSP 2 Score: 100.523 bits (249), Expect = 1.358e-20
Identity = 46/67 (68.66%), Postives = 50/67 (74.63%), Query Frame = 3
Query: 3969 ENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            E+ R FVALFDYDP +MSPN  A  EELPFK GQ IKV+G  D DGFY GE  GR GL+P NMVSEI
Sbjct:  948 EDFRIFVALFDYDPLSMSPNPDAADEELPFKEGQIIKVYGDKDNDGFYRGEIRGRSGLIPCNMVSEI 1014          

HSP 3 Score: 79.337 bits (194), Expect = 3.876e-14
Identity = 47/86 (54.65%), Postives = 60/86 (69.77%), Query Frame = 3
Query: 4482 SRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPSYQG 4739
             R+P   R+M+ALYDYDP+  SPNVD +AEL F   DI+ + G+IDEDGFY G  NG RGLVPSNFL ++P  +E  +   PS+ G
Sbjct: 1046 GRHPVATRRMVALYDYDPRESSPNVDVEAELTFCAGDIVAVFGDIDEDGFYYGELNGHRGLVPSNFLEEVPDDVEVYLTDTPSHHG 1131          

HSP 4 Score: 77.411 bits (189), Expect = 1.577e-13
Identity = 36/64 (56.25%), Postives = 43/64 (67.19%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R  VAL+DYDP   SPN   +  EL F +G  + VFG +DEDGFY GE NG RGLVPSN + E+
Sbjct: 1053 RRMVALYDYDPRESSPNVD-VEAELTFCAGDIVAVFGDIDEDGFYYGELNGHRGLVPSNFLEEV 1115          

HSP 5 Score: 52.7582 bits (125), Expect = 4.884e-6
Identity = 29/72 (40.28%), Postives = 41/72 (56.94%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEIDVKSTF 4187
            +R   A + Y+P    PN      ELP  +G+ + V+G +D+DGFY GE  +G+RGLVPSN V  +  K   
Sbjct:  186 VRLCTARYSYNPYD-GPNEHP-EAELPLVAGKYLYVYGNMDDDGFYEGELLDGQRGLVPSNFVEFVQDKEKL 255          
BLAST of RIMS binding protein 2 vs. Ensembl Zebrafish
Match: rimbp2 (RIMS binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-040724-96])

HSP 1 Score: 101.679 bits (252), Expect = 5.872e-21
Identity = 55/104 (52.88%), Postives = 62/104 (59.62%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEID----------VKSTFKPIDNSEITFQERIIGSIDRNKDS 4259
            R FVA+FDYDP +MSPN  A  EELPFK GQ IKVFG+ D DGFY  E  GRRGLVP NMVSEI           +K  F P++          I  I+RNK S
Sbjct:  769 RIFVAMFDYDPLSMSPNPDAAVEELPFKEGQIIKVFGEKDTDGFYRAEICGRRGLVPCNMVSEIQTDDDEMMDQLLKQGFLPLNTP--------IEKIERNKRS 864          

HSP 2 Score: 91.2781 bits (225), Expect = 8.934e-18
Identity = 68/268 (25.37%), Postives = 124/268 (46.27%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGL 2828
            +P P +I +   L +  + ++ W  P +        I+ +++ VD     ++       +++  L+L    HRI+++S+  +G S   +CT+ +G    +AP +L+   IT  SA+++W+PSNSN+ H +++N  +Y    PG YK     L+P  + K++        V   P+      L  +       S E   +P      P DV+++LG  PG   ++W  P L    TS    ++GY +    Q IA +     D  ++ L
Sbjct:  296 VPYPRRITLIKQLAK--SVIISWDPPVVLPGW--TPISGYNVLVDQEVRMSIPFGGRTKSLIEKLNLTVCTHRISIQSMTERGLSDPLRCTLLVGKDVVVAPYYLRVENITQASAELTWMPSNSNYSHMIYLNDVEYDVVKPGGYKYHFYNLKPMTVYKIR--------VVARPHQMPWQ-LPLEQREKKEVSVEFCTQPAGPPLPPQDVQVQLGQTPGVLQIRWKPPTLTPNGTSNGASVMGYIVFTKGQKIAEIMHPTADFVTVEL 550          

HSP 3 Score: 80.1073 bits (196), Expect = 2.502e-14
Identity = 38/73 (52.05%), Postives = 49/73 (67.12%), Query Frame = 3
Query: 3951 SHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            S ++ A + R  VAL+DYDP   SPN   +  EL F +G  I VFG++DEDGFY GE NG +GLVPSN + E+
Sbjct:  864 SGRQHAVSTRRMVALYDYDPRESSPNVD-VEAELTFCAGDVITVFGEIDEDGFYYGELNGHKGLVPSNFLEEV 935          

HSP 4 Score: 72.0182 bits (175), Expect = 6.595e-12
Identity = 44/76 (57.89%), Postives = 55/76 (72.37%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPS 4730
            R+M+ALYDYDP+  SPNVD +AEL F   D+I + GEIDEDGFY G  NG +GLVPSNFL ++P  +E  +   PS
Sbjct:  873 RRMVALYDYDPRESSPNVDVEAELTFCAGDVITVFGEIDEDGFYYGELNGHKGLVPSNFLEEVPDDVEVYLTNTPS 948          
BLAST of RIMS binding protein 2 vs. Ensembl Xenopus
Match: cep128 (centrosomal protein 128kDa [Source:Xenbase;Acc:XB-GENE-5917651])

HSP 1 Score: 103.605 bits (257), Expect = 2.398e-21
Identity = 74/282 (26.24%), Postives = 131/282 (46.45%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLK-RPHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQ--KVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEG--IQKPTDEI---DYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTI 2846
            +P P ++ I   L +  + VV W+ P +       NI +++IY+D    + V       A++  L+LK R +RI+V+SV   G S   +CT+ +G  +SLAP+ L+   ++   A+I+W P NSN+ H +++N  +      G Y      L+P  L   KV+ HP    +                 LP+     +   IQ  T      D P DV+++LG  PG  ++ W+ P  +    +S  +++ GY++  + Q +  V         +G+  L+ +
Sbjct:  599 VPYPRKLAIIKQLAR--SIVVGWEPPLVTAGTR--NIQSYNIYIDNELRQNVQCGGQTKALIEKLELKTRTYRISVQSVTEDGCSDRMRCTLLVGHGYSLAPTQLRVRSLSATCAEITWQPCNSNYSHALYMNDERCGLAKAGTYWYSFSSLRPSTLYNVKVEAHPQRIPW----------------ELPLERREQKATVIQLTTPSAGPPDAPLDVQVELGPTPGVLLISWL-PVTIDAAGSSNGVRVTGYAVYADGQKVLEVTSPTAGSVLVGMSHLQLL 859          

HSP 2 Score: 95.1301 bits (235), Expect = 9.292e-19
Identity = 40/70 (57.14%), Postives = 49/70 (70.00%), Query Frame = 3
Query: 3969 ENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVK 4178
            E  R FVALFDYDP  MSPN  A  EE+PFK GQ +++FG  D DGFY GE  G+ G +P NMVSE+ ++
Sbjct: 1223 ETARIFVALFDYDPVIMSPNPDAYEEEVPFKEGQILQIFGDKDADGFYHGECAGKTGYIPCNMVSELHIQ 1292          

HSP 3 Score: 75.8702 bits (185), Expect = 8.494e-13
Identity = 40/87 (45.98%), Postives = 50/87 (57.47%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNM-------VSEIDVKSTFKPIDNSEITF 4217
            +  VA+FDY+P   SPN   +  EL F +G  I VFG +DEDGFY GE NG RGLVPSN        V E D +      DN+E+ +
Sbjct: 1351 KKMVAIFDYNPRENSPNMD-VEAELNFTAGDLITVFGPMDEDGFYYGELNGLRGLVPSNFLESAQPQVEESDAQMALHARDNTEVRY 1436          

HSP 4 Score: 61.2326 bits (147), Expect = 1.949e-8
Identity = 37/68 (54.41%), Postives = 49/68 (72.06%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLE 4706
            +KM+A++DY+P+  SPN+D +AEL F   D+I + G +DEDGFY G  NG RGLVPSNFL    P +E
Sbjct: 1351 KKMVAIFDYNPRENSPNMDVEAELNFTAGDLITVFGPMDEDGFYYGELNGLRGLVPSNFLESAQPQVE 1418          

HSP 5 Score: 57.7658 bits (138), Expect = 2.591e-7
Identity = 27/59 (45.76%), Postives = 40/59 (67.80%), Query Frame = 3
Query: 4047 ELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI--DVKSTFKPIDNSEIT 4214
            ELP  +G+ I ++G +D+DGFY GE  +GRRGLVPSN V  +  D    F+P + +E++
Sbjct:  497 ELPLTAGEYIYIYGDMDDDGFYEGELMDGRRGLVPSNFVERVSDDDLIAFQPTEINELS 555          
BLAST of RIMS binding protein 2 vs. Ensembl Xenopus
Match: cep128 (centrosomal protein 128kDa [Source:Xenbase;Acc:XB-GENE-5917651])

HSP 1 Score: 103.605 bits (257), Expect = 2.636e-21
Identity = 74/282 (26.24%), Postives = 131/282 (46.45%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLK-RPHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQ--KVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEG--IQKPTDEI---DYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTI 2846
            +P P ++ I   L +  + VV W+ P +       NI +++IY+D    + V       A++  L+LK R +RI+V+SV   G S   +CT+ +G  +SLAP+ L+   ++   A+I+W P NSN+ H +++N  +      G Y      L+P  L   KV+ HP    +                 LP+     +   IQ  T      D P DV+++LG  PG  ++ W+ P  +    +S  +++ GY++  + Q +  V         +G+  L+ +
Sbjct:  616 VPYPRKLAIIKQLAR--SIVVGWEPPLVTAGTR--NIQSYNIYIDNELRQNVQCGGQTKALIEKLELKTRTYRISVQSVTEDGCSDRMRCTLLVGHGYSLAPTQLRVRSLSATCAEITWQPCNSNYSHALYMNDERCGLAKAGTYWYSFSSLRPSTLYNVKVEAHPQRIPW----------------ELPLERREQKATVIQLTTPSAGPPDAPLDVQVELGPTPGVLLISWL-PVTIDAAGSSNGVRVTGYAVYADGQKVLEVTSPTAGSVLVGMSHLQLL 876          

HSP 2 Score: 95.1301 bits (235), Expect = 1.039e-18
Identity = 40/70 (57.14%), Postives = 49/70 (70.00%), Query Frame = 3
Query: 3969 ENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVK 4178
            E  R FVALFDYDP  MSPN  A  EE+PFK GQ +++FG  D DGFY GE  G+ G +P NMVSE+ ++
Sbjct: 1212 ETARIFVALFDYDPVIMSPNPDAYEEEVPFKEGQILQIFGDKDADGFYHGECAGKTGYIPCNMVSELHIQ 1281          

HSP 3 Score: 75.0998 bits (183), Expect = 1.123e-12
Identity = 40/87 (45.98%), Postives = 50/87 (57.47%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNM-------VSEIDVKSTFKPIDNSEITF 4217
            +  VA+FDY+P   SPN   +  EL F +G  I VFG +DEDGFY GE NG RGLVPSN        V E D +      DN+E+ +
Sbjct: 1357 KKMVAIFDYNPRENSPNMD-VEAELNFTAGDLITVFGPMDEDGFYYGELNGLRGLVPSNFLESAQPQVEESDAQMALHARDNTEVRY 1442          

HSP 4 Score: 61.2326 bits (147), Expect = 2.104e-8
Identity = 37/68 (54.41%), Postives = 49/68 (72.06%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLE 4706
            +KM+A++DY+P+  SPN+D +AEL F   D+I + G +DEDGFY G  NG RGLVPSNFL    P +E
Sbjct: 1357 KKMVAIFDYNPRENSPNMDVEAELNFTAGDLITVFGPMDEDGFYYGELNGLRGLVPSNFLESAQPQVE 1424          

HSP 5 Score: 59.6918 bits (143), Expect = 5.641e-8
Identity = 32/83 (38.55%), Postives = 50/83 (60.24%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI--DVKSTFKPIDNSEIT 4214
            +  ++A + Y+P    PN      ELP  +G+ I ++G +D+DGFY GE  +GRRGLVPSN V  +  D    F+P + +E++
Sbjct:  492 LHVYLARYSYNPFD-GPNENP-EAELPLTAGEYIYIYGDMDDDGFYEGELMDGRRGLVPSNFVERVSDDDLIAFQPTEINELS 572          
BLAST of RIMS binding protein 2 vs. Ensembl Xenopus
Match: cep128 (centrosomal protein 128kDa [Source:Xenbase;Acc:XB-GENE-5917651])

HSP 1 Score: 103.605 bits (257), Expect = 3.038e-21
Identity = 74/282 (26.24%), Postives = 131/282 (46.45%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLK-RPHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQ--KVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEG--IQKPTDEI---DYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTI 2846
            +P P ++ I   L +  + VV W+ P +       NI +++IY+D    + V       A++  L+LK R +RI+V+SV   G S   +CT+ +G  +SLAP+ L+   ++   A+I+W P NSN+ H +++N  +      G Y      L+P  L   KV+ HP    +                 LP+     +   IQ  T      D P DV+++LG  PG  ++ W+ P  +    +S  +++ GY++  + Q +  V         +G+  L+ +
Sbjct:  606 VPYPRKLAIIKQLAR--SIVVGWEPPLVTAGTR--NIQSYNIYIDNELRQNVQCGGQTKALIEKLELKTRTYRISVQSVTEDGCSDRMRCTLLVGHGYSLAPTQLRVRSLSATCAEITWQPCNSNYSHALYMNDERCGLAKAGTYWYSFSSLRPSTLYNVKVEAHPQRIPW----------------ELPLERREQKATVIQLTTPSAGPPDAPLDVQVELGPTPGVLLISWL-PVTIDAAGSSNGVRVTGYAVYADGQKVLEVTSPTAGSVLVGMSHLQLL 866          

HSP 2 Score: 95.1301 bits (235), Expect = 1.091e-18
Identity = 40/70 (57.14%), Postives = 49/70 (70.00%), Query Frame = 3
Query: 3969 ENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVK 4178
            E  R FVALFDYDP  MSPN  A  EE+PFK GQ +++FG  D DGFY GE  G+ G +P NMVSE+ ++
Sbjct: 1207 ETARIFVALFDYDPVIMSPNPDAYEEEVPFKEGQILQIFGDKDADGFYHGECAGKTGYIPCNMVSELHIQ 1276          

HSP 3 Score: 75.0998 bits (183), Expect = 1.201e-12
Identity = 40/87 (45.98%), Postives = 50/87 (57.47%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNM-------VSEIDVKSTFKPIDNSEITF 4217
            +  VA+FDY+P   SPN   +  EL F +G  I VFG +DEDGFY GE NG RGLVPSN        V E D +      DN+E+ +
Sbjct: 1352 KKMVAIFDYNPRENSPNMD-VEAELNFTAGDLITVFGPMDEDGFYYGELNGLRGLVPSNFLESAQPQVEESDAQMALHARDNTEVRY 1437          

HSP 4 Score: 61.2326 bits (147), Expect = 2.139e-8
Identity = 37/68 (54.41%), Postives = 49/68 (72.06%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLE 4706
            +KM+A++DY+P+  SPN+D +AEL F   D+I + G +DEDGFY G  NG RGLVPSNFL    P +E
Sbjct: 1352 KKMVAIFDYNPRENSPNMDVEAELNFTAGDLITVFGPMDEDGFYYGELNGLRGLVPSNFLESAQPQVE 1419          

HSP 5 Score: 59.6918 bits (143), Expect = 6.081e-8
Identity = 32/83 (38.55%), Postives = 50/83 (60.24%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI--DVKSTFKPIDNSEIT 4214
            +  ++A + Y+P    PN      ELP  +G+ I ++G +D+DGFY GE  +GRRGLVPSN V  +  D    F+P + +E++
Sbjct:  482 LHVYLARYSYNPFD-GPNENP-EAELPLTAGEYIYIYGDMDDDGFYEGELMDGRRGLVPSNFVERVSDDDLIAFQPTEINELS 562          
BLAST of RIMS binding protein 2 vs. Ensembl Xenopus
Match: znf384 (zinc finger protein 384 [Source:Xenbase;Acc:XB-GENE-979648])

HSP 1 Score: 98.9821 bits (245), Expect = 7.386e-20
Identity = 46/66 (69.70%), Postives = 48/66 (72.73%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDV 4175
            R FVALFDYDP TMSPN  A  EELPFK GQ IKV+G  D DGFY GET  R G +P NMVSEI V
Sbjct: 1248 RIFVALFDYDPRTMSPNPDAAEEELPFKEGQVIKVYGDKDSDGFYRGETCERAGFIPCNMVSEIQV 1313          

HSP 2 Score: 89.3521 bits (220), Expect = 6.371e-17
Identity = 77/318 (24.21%), Postives = 141/318 (44.34%), Query Frame = 3
Query: 1929 KILPSLQTSNSACNKDYGETPN---NELGFNTNLESQRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTIN 2849
            +I PS+   +S  N   G T +   +E+G +         +P P +I +   L +  + +V W+ P +        I ++++ +       ++       +L  LDL    +R+++++V  +G S + QC++ +G    +AP+HLK + IT  SA++ W+PSNSN+ H +++N  +Y       Y+     L+P+   KV++     +     P        A+ +F TLP       G   P      P +V +  G  P   +V W  P L    TS    + G+S+    Q +A V     +   + LL L  ++
Sbjct:  605 EITPSIHMESSVLNNGTGTTMDVNIDEIGEDI--------VPYPRKITLIKQLAK--SVIVGWEPPLVPPGWG--TIHSYNVLIGKEIRATLNFGSRTKLLLEKLDLATVTYRLSIQTVTDRGNSDELQCSLLVGKDVIVAPTHLKVDNITPMSAELIWLPSNSNYSHVIFLNDEEYDIVKAASYRYHFFNLKPNMTYKVKLLAKPHQMPWQLPLEQRERKEAYTEFTTLP------SGPPIP------PDNVIVHQGPTPVTLLVTWKPPVLSPTGTSNGAHVTGFSVYARGQKVAEVVFPAAENIVVDLLKLLNLD 898          

HSP 3 Score: 77.0258 bits (188), Expect = 3.062e-13
Identity = 35/64 (54.69%), Postives = 44/64 (68.75%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R  VAL+DYDP   SPN   +  EL F +G  + VFG++DEDGFY GE NG +GLVPSN + E+
Sbjct: 1374 RRMVALYDYDPRESSPNVD-VEAELTFCTGDILNVFGEIDEDGFYYGELNGHKGLVPSNFLEEV 1436          

HSP 4 Score: 71.633 bits (174), Expect = 1.545e-11
Identity = 44/76 (57.89%), Postives = 55/76 (72.37%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPS 4730
            R+M+ALYDYDP+  SPNVD +AEL F   DI+ + GEIDEDGFY G  NG +GLVPSNFL ++P  +E  +   PS
Sbjct: 1374 RRMVALYDYDPRESSPNVDVEAELTFCTGDILNVFGEIDEDGFYYGELNGHKGLVPSNFLEEVPDDVEVYLSDTPS 1449          

HSP 5 Score: 56.225 bits (134), Expect = 6.887e-7
Identity = 30/71 (42.25%), Postives = 43/71 (60.56%), Query Frame = 3
Query: 3951 SHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMV 4160
            S Q+ +  +   +A + Y+P    PN      ELP  +G+ + V+G +DEDGFY GE  +G+RGLVPSN V
Sbjct:  500 SKQRYSGKVHLCIARYSYNPFD-GPNENP-EAELPLVAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFV 568          
BLAST of RIMS binding protein 2 vs. Ensembl Xenopus
Match: znf384 (zinc finger protein 384 [Source:Xenbase;Acc:XB-GENE-979648])

HSP 1 Score: 98.2117 bits (243), Expect = 1.028e-19
Identity = 46/66 (69.70%), Postives = 48/66 (72.73%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDV 4175
            R FVALFDYDP TMSPN  A  EELPFK GQ IKV+G  D DGFY GET  R G +P NMVSEI V
Sbjct: 1014 RIFVALFDYDPRTMSPNPDAAEEELPFKEGQVIKVYGDKDSDGFYRGETCERAGFIPCNMVSEIQV 1079          

HSP 2 Score: 88.9669 bits (219), Expect = 6.650e-17
Identity = 77/318 (24.21%), Postives = 141/318 (44.34%), Query Frame = 3
Query: 1929 KILPSLQTSNSACNKDYGETPN---NELGFNTNLESQRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTIN 2849
            +I PS+   +S  N   G T +   +E+G +         +P P +I +   L +  + +V W+ P +        I ++++ +       ++       +L  LDL    +R+++++V  +G S + QC++ +G    +AP+HLK + IT  SA++ W+PSNSN+ H +++N  +Y       Y+     L+P+   KV++     +     P        A+ +F TLP       G   P      P +V +  G  P   +V W  P L    TS    + G+S+    Q +A V     +   + LL L  ++
Sbjct:  371 EITPSIHMESSVLNNGTGTTMDVNIDEIGEDI--------VPYPRKITLIKQLAK--SVIVGWEPPLVPPGWG--TIHSYNVLIGKEIRATLNFGSRTKLLLEKLDLATVTYRLSIQTVTDRGNSDELQCSLLVGKDVIVAPTHLKVDNITPMSAELIWLPSNSNYSHVIFLNDEEYDIVKAASYRYHFFNLKPNMTYKVKLLAKPHQMPWQLPLEQRERKEAYTEFTTLP------SGPPIP------PDNVIVHQGPTPVTLLVTWKPPVLSPTGTSNGAHVTGFSVYARGQKVAEVVFPAAENIVVDLLKLLNLD 664          

HSP 3 Score: 55.8398 bits (133), Expect = 8.472e-7
Identity = 30/71 (42.25%), Postives = 43/71 (60.56%), Query Frame = 3
Query: 3951 SHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMV 4160
            S Q+ +  +   +A + Y+P    PN      ELP  +G+ + V+G +DEDGFY GE  +G+RGLVPSN V
Sbjct:  266 SKQRYSGKVHLCIARYSYNPFD-GPNENP-EAELPLVAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFV 334          
BLAST of RIMS binding protein 2 vs. Ensembl Mouse
Match: Tspoap1 (TSPO associated protein 1 [Source:MGI Symbol;Acc:MGI:2450877])

HSP 1 Score: 132.109 bits (331), Expect = 2.818e-32
Identity = 94/241 (39.00%), Postives = 120/241 (49.79%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKSTFKPIDNSEITFQERIIGSIDRNKDSTISRSLQGKLNIDQYPIVSQSDYQNNPNQYSYNDYPMIHRKSTDSAVSYAASDPNSYQRSQVDTYMPRQPSAG-----NSRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFL 4682
            +R FVALFDYDP +MSPN  A  EELPFK GQ +KVFG  D DGFY GE+ GR G +P NMV+E+ V S   P    ++  Q   +                        P V      N P+ YS    P                 P   +  +V+   P Q   G     +S      R M+A +DY+P+  SPN+D +AEL F+  D+I + G +D+DGFY G  NGQRGLVPSNFL
Sbjct:  156 VRVFVALFDYDPVSMSPNPDAGEEELPFKEGQLLKVFGDKDADGFYRGESGGRTGYIPCNMVAEVAVDS---PAGRQQL-LQRGFL-----------------------PPNVLTEASGNGPSVYSSAHTP--------------GPPPKPRRSKKVELEGPTQLCPGPPKLIHSAAQKTSRPMVAAFDYNPRENSPNMDVEAELPFRAGDVITVFGNMDDDGFYYGELNGQRGLVPSNFL 355          

HSP 2 Score: 75.0998 bits (183), Expect = 2.515e-13
Identity = 36/69 (52.17%), Postives = 46/69 (66.67%), Query Frame = 3
Query: 3954 HQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMV 4160
            H  + +  R  VA FDY+P   SPN   +  ELPF++G  I VFG +D+DGFY GE NG+RGLVPSN +
Sbjct:  288 HSAAQKTSRPMVAAFDYNPRENSPNM-DVEAELPFRAGDVITVFGNMDDDGFYYGELNGQRGLVPSNFL 355          
BLAST of RIMS binding protein 2 vs. Ensembl Mouse
Match: Tspoap1 (TSPO associated protein 1 [Source:MGI Symbol;Acc:MGI:2450877])

HSP 1 Score: 134.42 bits (337), Expect = 9.562e-31
Identity = 93/241 (38.59%), Postives = 118/241 (48.96%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKSTFKPIDNSEITFQERIIGSIDRNKDSTISRSLQGKLNIDQYPIVSQSDYQNNPNQYSYNDYPMIHRKSTDSAVSYAASDPNSYQRSQVDTYMPRQPSAG-----NSRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFL 4682
            +R FVALFDYDP +MSPN  A  EELPFK GQ +KVFG  D DGFY GE+ GR G +P NMV+E+ V S                       +   + R           P V      N P+ YS    P                 P   +  +V+   P Q   G     +S      R M+A +DY+P+  SPN+D +AEL F+  D+I + G +D+DGFY G  NGQRGLVPSNFL
Sbjct: 1618 VRVFVALFDYDPVSMSPNPDAGEEELPFKEGQLLKVFGDKDADGFYRGESGGRTGYIPCNMVAEVAVDSPA--------------------GRQQLLQRGF-------LPPNVLTEASGNGPSVYSSAHTP--------------GPPPKPRRSKKVELEGPTQLCPGPPKLIHSAAQKTSRPMVAAFDYNPRENSPNMDVEAELPFRAGDVITVFGNMDDDGFYYGELNGQRGLVPSNFL 1817          

HSP 2 Score: 114.775 bits (286), Expect = 8.008e-25
Identity = 83/310 (26.77%), Postives = 145/310 (46.77%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGSFS-LAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPN----SNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSN 2939
            +P P  I +   L    + V+ W++P      ++ ++  FHI+V+G   +A+       AVL N+DL+  P  ++V+++ S+G S   +C + +G+ + + PS L+ +++T  SA+I+W+P NSN  H +++NG +     P  Y      L+P  L + +V   I       P         A L F TLP       G+       D P DV+ + G  PG  ++ W+ P  +    TS  +++ GY+I  + Q I  V         + +  L        Q L + H+     +TVRTM+   +S+
Sbjct:  787 VPYPRHITVLKQLAH--SVVLAWELPP-----ERVDLRGFHIFVNGELRQALGPGVPPKAVLENMDLRTGPLHVSVQALTSKGSSDPLRCCLAVGAGAGVVPSQLRIHRLTATSAEIAWVPGNSNLAHAIYLNGEECPPARPSTYWATFCNLRPGTLYQARVEAQIPSQGPWEPGWERPEQRAATLQFTTLPA------GLP------DAPLDVQAEPGPSPGILMISWL-PVTIDAAGTSNGVRVTGYAIYADGQKIMEVASPTAGSVLVEVSQL--------QLLQACHE-----VTVRTMSPHGESS 1063          

HSP 3 Score: 75.8702 bits (185), Expect = 6.196e-13
Identity = 36/69 (52.17%), Postives = 46/69 (66.67%), Query Frame = 3
Query: 3954 HQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMV 4160
            H  + +  R  VA FDY+P   SPN   +  ELPF++G  I VFG +D+DGFY GE NG+RGLVPSN +
Sbjct: 1750 HSAAQKTSRPMVAAFDYNPRENSPNMD-VEAELPFRAGDVITVFGNMDDDGFYYGELNGQRGLVPSNFL 1817          

HSP 4 Score: 60.8474 bits (146), Expect = 2.013e-8
Identity = 36/83 (43.37%), Postives = 49/83 (59.04%), Query Frame = 3
Query: 3951 SHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI---DVKSTF 4187
            SH   A  I+ F+A + Y+P    PN      ELP  +G+ I ++G +DEDGF+ GE  +GRRGLVPSN V  +   D+ ST 
Sbjct:  644 SHSGGA-RIQVFLARYSYNPFE-GPNENP-EAELPLTAGEYIYIYGNMDEDGFFEGELMDGRRGLVPSNFVERVSDDDLLSTL 723          
BLAST of RIMS binding protein 2 vs. Ensembl Mouse
Match: Tspoap1 (TSPO associated protein 1 [Source:MGI Symbol;Acc:MGI:2450877])

HSP 1 Score: 134.42 bits (337), Expect = 1.006e-30
Identity = 93/241 (38.59%), Postives = 118/241 (48.96%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKSTFKPIDNSEITFQERIIGSIDRNKDSTISRSLQGKLNIDQYPIVSQSDYQNNPNQYSYNDYPMIHRKSTDSAVSYAASDPNSYQRSQVDTYMPRQPSAG-----NSRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFL 4682
            +R FVALFDYDP +MSPN  A  EELPFK GQ +KVFG  D DGFY GE+ GR G +P NMV+E+ V S                       +   + R           P V      N P+ YS    P                 P   +  +V+   P Q   G     +S      R M+A +DY+P+  SPN+D +AEL F+  D+I + G +D+DGFY G  NGQRGLVPSNFL
Sbjct: 1558 VRVFVALFDYDPVSMSPNPDAGEEELPFKEGQLLKVFGDKDADGFYRGESGGRTGYIPCNMVAEVAVDSPA--------------------GRQQLLQRGF-------LPPNVLTEASGNGPSVYSSAHTP--------------GPPPKPRRSKKVELEGPTQLCPGPPKLIHSAAQKTSRPMVAAFDYNPRENSPNMDVEAELPFRAGDVITVFGNMDDDGFYYGELNGQRGLVPSNFL 1757          

HSP 2 Score: 115.161 bits (287), Expect = 6.678e-25
Identity = 83/310 (26.77%), Postives = 145/310 (46.77%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGSFS-LAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPN----SNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSN 2939
            +P P  I +   L    + V+ W++P      ++ ++  FHI+V+G   +A+       AVL N+DL+  P  ++V+++ S+G S   +C + +G+ + + PS L+ +++T  SA+I+W+P NSN  H +++NG +     P  Y      L+P  L + +V   I       P         A L F TLP       G+       D P DV+ + G  PG  ++ W+ P  +    TS  +++ GY+I  + Q I  V         + +  L        Q L + H+     +TVRTM+   +S+
Sbjct:  727 VPYPRHITVLKQLAH--SVVLAWELPP-----ERVDLRGFHIFVNGELRQALGPGVPPKAVLENMDLRTGPLHVSVQALTSKGSSDPLRCCLAVGAGAGVVPSQLRIHRLTATSAEIAWVPGNSNLAHAIYLNGEECPPARPSTYWATFCNLRPGTLYQARVEAQIPSQGPWEPGWERPEQRAATLQFTTLPA------GLP------DAPLDVQAEPGPSPGILMISWL-PVTIDAAGTSNGVRVTGYAIYADGQKIMEVASPTAGSVLVEVSQL--------QLLQACHE-----VTVRTMSPHGESS 1003          

HSP 3 Score: 75.8702 bits (185), Expect = 6.526e-13
Identity = 36/69 (52.17%), Postives = 46/69 (66.67%), Query Frame = 3
Query: 3954 HQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMV 4160
            H  + +  R  VA FDY+P   SPN   +  ELPF++G  I VFG +D+DGFY GE NG+RGLVPSN +
Sbjct: 1690 HSAAQKTSRPMVAAFDYNPRENSPNM-DVEAELPFRAGDVITVFGNMDDDGFYYGELNGQRGLVPSNFL 1757          

HSP 4 Score: 60.8474 bits (146), Expect = 2.197e-8
Identity = 36/83 (43.37%), Postives = 49/83 (59.04%), Query Frame = 3
Query: 3951 SHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI---DVKSTF 4187
            SH   A  I+ F+A + Y+P    PN      ELP  +G+ I ++G +DEDGF+ GE  +GRRGLVPSN V  +   D+ ST 
Sbjct:  584 SHSGGA-RIQVFLARYSYNPFE-GPNENP-EAELPLTAGEYIYIYGNMDEDGFFEGELMDGRRGLVPSNFVERVSDDDLLSTL 663          
BLAST of RIMS binding protein 2 vs. Ensembl Mouse
Match: Rimbp2 (RIMS binding protein 2 [Source:MGI Symbol;Acc:MGI:2443235])

HSP 1 Score: 98.9821 bits (245), Expect = 4.874e-20
Identity = 46/64 (71.88%), Postives = 48/64 (75.00%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R FVALFDYDP TMSPN  A  EELPFK GQ IKV+G  D DGFY GET  R GL+P NMVSEI
Sbjct:  878 RIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEI 941          

HSP 2 Score: 93.5893 bits (231), Expect = 1.960e-18
Identity = 78/306 (25.49%), Postives = 137/306 (44.77%), Query Frame = 3
Query: 1956 NSACNKDYGETPNNELGFNTNLES-QRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTI 2846
            +S    D G T N     + N++      +P P +I +   L +  + +V W+ P +        ++++++ VD     ++++     A++  L+     +RI+V+ V S+G S + QCT+ +G    +APS L+ + IT  SAQ+SW+P+NSN+ H +++N  +        YK     L+P+   KV+V     +     P        A ++F TLP       G   P      P DV +  G+      V W  P L     S    + GY +    Q +A V     D  ++ L+ LR++
Sbjct:  289 HSPTQVDSGITDNGGGTLDVNIDDIGEDTVPYPRKITLIKQLAK--SVIVGWEPPAVPPGWG--TVSSYNVLVDKETRMSLALGRRTKALIEKLNTAACTYRISVQCVTSRGNSDELQCTLLVGKDVVVAPSQLRVDNITQISAQLSWLPTNSNYSHIIFLNEEELDIVKAARYKYQFFNLRPNMAYKVKVLAQPHQMPWQLPLEQREKKEACVEFSTLPA------GPPAP------PQDVTVHAGATAASVQVSWKPPALTPTGLSNGANVTGYGVYAKGQRVAEVIAPTADGTAVELIRLRSL 578          

HSP 3 Score: 81.2629 bits (199), Expect = 1.296e-14
Identity = 37/64 (57.81%), Postives = 46/64 (71.88%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R  VAL+DYDP   SPN   +  ELPF +G  I VFG++DEDGFY GE NG++GLVPSN + E+
Sbjct:  982 RRMVALYDYDPRESSPNVD-VEAELPFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEV 1044          

HSP 4 Score: 72.4034 bits (176), Expect = 5.923e-12
Identity = 45/77 (58.44%), Postives = 56/77 (72.73%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPSY 4733
            R+M+ALYDYDP+  SPNVD +AEL F   DII + GEIDEDGFY G  NGQ+GLVPSNFL ++P  +E  +   P +
Sbjct:  982 RRMVALYDYDPRESSPNVDVEAELPFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEVPDDVEVHLSDAPPH 1058          

HSP 5 Score: 54.299 bits (129), Expect = 1.899e-6
Identity = 30/66 (45.45%), Postives = 40/66 (60.61%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI 4169
            +   VA + Y+P    PN      ELP  +G+ + V+G +DEDGFY GE  +G+RGLVPSN V  I
Sbjct:  190 VHLCVARYSYNPFD-GPNENP-EAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFVDFI 253          
BLAST of RIMS binding protein 2 vs. Ensembl Mouse
Match: Rimbp2 (RIMS binding protein 2 [Source:MGI Symbol;Acc:MGI:2443235])

HSP 1 Score: 98.9821 bits (245), Expect = 4.874e-20
Identity = 46/64 (71.88%), Postives = 48/64 (75.00%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R FVALFDYDP TMSPN  A  EELPFK GQ IKV+G  D DGFY GET  R GL+P NMVSEI
Sbjct:  878 RIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEI 941          

HSP 2 Score: 93.5893 bits (231), Expect = 1.960e-18
Identity = 78/306 (25.49%), Postives = 137/306 (44.77%), Query Frame = 3
Query: 1956 NSACNKDYGETPNNELGFNTNLES-QRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTI 2846
            +S    D G T N     + N++      +P P +I +   L +  + +V W+ P +        ++++++ VD     ++++     A++  L+     +RI+V+ V S+G S + QCT+ +G    +APS L+ + IT  SAQ+SW+P+NSN+ H +++N  +        YK     L+P+   KV+V     +     P        A ++F TLP       G   P      P DV +  G+      V W  P L     S    + GY +    Q +A V     D  ++ L+ LR++
Sbjct:  289 HSPTQVDSGITDNGGGTLDVNIDDIGEDTVPYPRKITLIKQLAK--SVIVGWEPPAVPPGWG--TVSSYNVLVDKETRMSLALGRRTKALIEKLNTAACTYRISVQCVTSRGNSDELQCTLLVGKDVVVAPSQLRVDNITQISAQLSWLPTNSNYSHIIFLNEEELDIVKAARYKYQFFNLRPNMAYKVKVLAQPHQMPWQLPLEQREKKEACVEFSTLPA------GPPAP------PQDVTVHAGATAASVQVSWKPPALTPTGLSNGANVTGYGVYAKGQRVAEVIAPTADGTAVELIRLRSL 578          

HSP 3 Score: 81.2629 bits (199), Expect = 1.296e-14
Identity = 37/64 (57.81%), Postives = 46/64 (71.88%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R  VAL+DYDP   SPN   +  ELPF +G  I VFG++DEDGFY GE NG++GLVPSN + E+
Sbjct:  982 RRMVALYDYDPRESSPNVD-VEAELPFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEV 1044          

HSP 4 Score: 72.4034 bits (176), Expect = 5.923e-12
Identity = 45/77 (58.44%), Postives = 56/77 (72.73%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPSY 4733
            R+M+ALYDYDP+  SPNVD +AEL F   DII + GEIDEDGFY G  NGQ+GLVPSNFL ++P  +E  +   P +
Sbjct:  982 RRMVALYDYDPRESSPNVDVEAELPFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEVPDDVEVHLSDAPPH 1058          

HSP 5 Score: 54.299 bits (129), Expect = 1.899e-6
Identity = 30/66 (45.45%), Postives = 40/66 (60.61%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI 4169
            +   VA + Y+P    PN      ELP  +G+ + V+G +DEDGFY GE  +G+RGLVPSN V  I
Sbjct:  190 VHLCVARYSYNPFD-GPNENP-EAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFVDFI 253          
BLAST of RIMS binding protein 2 vs. UniProt/SwissProt
Match: sp|Q7TNF8|RIMB1_MOUSE (Peripheral-type benzodiazepine receptor-associated protein 1 OS=Mus musculus OX=10090 GN=Tspoap1 PE=2 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 6.689e-30
Identity = 93/241 (38.59%), Postives = 118/241 (48.96%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKSTFKPIDNSEITFQERIIGSIDRNKDSTISRSLQGKLNIDQYPIVSQSDYQNNPNQYSYNDYPMIHRKSTDSAVSYAASDPNSYQRSQVDTYMPRQPSAG-----NSRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFL 4682
            +R FVALFDYDP +MSPN  A  EELPFK GQ +KVFG  D DGFY GE+ GR G +P NMV+E+ V S                       +   + R           P V      N P+ YS    P                 P   +  +V+   P Q   G     +S      R M+A +DY+P+  SPN+D +AEL F+  D+I + G +D+DGFY G  NGQRGLVPSNFL
Sbjct: 1618 VRVFVALFDYDPVSMSPNPDAGEEELPFKEGQLLKVFGDKDADGFYRGESGGRTGYIPCNMVAEVAVDSPA--------------------GRQQLLQRGF-------LPPNVLTEASGNGPSVYSSAHTP--------------GPPPKPRRSKKVELEGPTQLCPGPPKLIHSAAQKTSRPMVAAFDYNPRENSPNMDVEAELPFRAGDVITVFGNMDDDGFYYGELNGQRGLVPSNFL 1817          

HSP 2 Score: 114.775 bits (286), Expect = 5.601e-24
Identity = 83/310 (26.77%), Postives = 145/310 (46.77%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGSFS-LAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPN----SNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSN 2939
            +P P  I +   L    + V+ W++P      ++ ++  FHI+V+G   +A+       AVL N+DL+  P  ++V+++ S+G S   +C + +G+ + + PS L+ +++T  SA+I+W+P NSN  H +++NG +     P  Y      L+P  L + +V   I       P         A L F TLP       G+       D P DV+ + G  PG  ++ W+ P  +    TS  +++ GY+I  + Q I  V         + +  L        Q L + H+     +TVRTM+   +S+
Sbjct:  787 VPYPRHITVLKQLAH--SVVLAWELPP-----ERVDLRGFHIFVNGELRQALGPGVPPKAVLENMDLRTGPLHVSVQALTSKGSSDPLRCCLAVGAGAGVVPSQLRIHRLTATSAEIAWVPGNSNLAHAIYLNGEECPPARPSTYWATFCNLRPGTLYQARVEAQIPSQGPWEPGWERPEQRAATLQFTTLPA------GLP------DAPLDVQAEPGPSPGILMISWL-PVTIDAAGTSNGVRVTGYAIYADGQKIMEVASPTAGSVLVEVSQL--------QLLQACHE-----VTVRTMSPHGESS 1063          

HSP 3 Score: 75.8702 bits (185), Expect = 4.334e-12
Identity = 36/69 (52.17%), Postives = 46/69 (66.67%), Query Frame = 3
Query: 3954 HQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMV 4160
            H  + +  R  VA FDY+P   SPN   +  ELPF++G  I VFG +D+DGFY GE NG+RGLVPSN +
Sbjct: 1750 HSAAQKTSRPMVAAFDYNPRENSPNMD-VEAELPFRAGDVITVFGNMDDDGFYYGELNGQRGLVPSNFL 1817          

HSP 4 Score: 60.8474 bits (146), Expect = 1.408e-7
Identity = 36/83 (43.37%), Postives = 49/83 (59.04%), Query Frame = 3
Query: 3951 SHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI---DVKSTF 4187
            SH   A  I+ F+A + Y+P    PN      ELP  +G+ I ++G +DEDGF+ GE  +GRRGLVPSN V  +   D+ ST 
Sbjct:  644 SHSGGA-RIQVFLARYSYNPFE-GPNENP-EAELPLTAGEYIYIYGNMDEDGFFEGELMDGRRGLVPSNFVERVSDDDLLSTL 723          
BLAST of RIMS binding protein 2 vs. UniProt/SwissProt
Match: sp|O95153|RIMB1_HUMAN (Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2)

HSP 1 Score: 134.035 bits (336), Expect = 8.213e-30
Identity = 95/242 (39.26%), Postives = 124/242 (51.24%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKSTFKPIDNSEITFQERIIGSIDRNKDSTISRSLQGKLNIDQYPIVSQSDYQNNPNQYSYNDYPMIHRKSTDSAVSYAASDPNSYQRS-QVDTYMPRQPSAGNSR-NPTEYRK----MLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFL 4682
            +R FVALFDYDP +MSPN  A  EELPF+ GQ +KVFG  D DGFY GE  GR G +P NMV+E+ V S                       +   + R   G L+ D    +      N P  YS                ++    P   +RS + ++  P QP  G  +  P+   K    M+A +DY+PQ  SPN+D +AEL F+  D+I + G +D+DGFY G  NGQRGLVPSNFL
Sbjct: 1627 VRIFVALFDYDPVSMSPNPDAGEEELPFREGQILKVFGDKDADGFYQGEGGGRTGYIPCNMVAEVAVDSPA--------------------GRQQLLQR---GYLSPD----ILLEGSGNGPFVYS---------------TAHTTGPPPKPRRSKKAESEGPAQPCPGPPKLVPSADLKAPHSMVAAFDYNPQESSPNMDVEAELPFRAGDVITVFGGMDDDGFYYGELNGQRGLVPSNFL 1826          

HSP 2 Score: 110.153 bits (274), Expect = 1.555e-22
Identity = 73/261 (27.97%), Postives = 120/261 (45.98%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDL-KRPHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPN----SNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALV 2792
            +P P ++ +   L    + V+ W+ P   V +       FHI V+G   +A+       AVL NLDL   P  I+V+++ S+G S   +C + +G+   + PS L+ +++T  SA+I+W+P NSN  H +++NG +     P  Y      L+P    + QV   +       P         A L F TL            P    D P DV+++ G  PG  ++ W+ P  +    TS  +++ GY+I  + Q I  V
Sbjct:  791 VPYPRRLVVLKQLAH--SVVLAWEPPPEQVELH-----GFHICVNGELRQALGPGAPPKAVLENLDLWAGPLHISVQALTSRGSSDPLRCCLAVGARAGVVPSQLRVHRLTATSAEITWVPGNSNLAHAIYLNGEECPPASPSTYWATFCHLRPGTPYQAQVEAQLPPQGPWEPGWERLEQRAATLQFTTL------------PAGPPDAPLDVQIEPGPSPGILIISWL-PVTIDAAGTSNGVRVTGYAIYADGQKIMEV 1031          

HSP 3 Score: 60.077 bits (144), Expect = 2.375e-7
Identity = 32/82 (39.02%), Postives = 48/82 (58.54%), Query Frame = 3
Query: 3960 KSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI---DVKSTFKP 4193
            +    I+ F+A + Y+P    PN      ELP  +G+ I ++G +DEDGF+ GE  +GRRGLVPSN V  +   D+ ++  P
Sbjct:  650 RGGARIQVFLARYSYNPFE-GPNENP-EAELPLTAGEYIYIYGNMDEDGFFEGELMDGRRGLVPSNFVERVSDDDLLTSLPP 729          
BLAST of RIMS binding protein 2 vs. UniProt/SwissProt
Match: sp|Q9JIR0|RIMB1_RAT (Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 2.413e-28
Identity = 92/236 (38.98%), Postives = 117/236 (49.58%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKSTFKPIDNSEITFQERIIGSIDRNKDSTISRSLQGKLNIDQYPIVSQSDYQNNPNQYSYNDYPMIHRKSTDSAVSYAASDPNSYQRSQVDTYMPRQPSAGNSRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFL 4682
            +R FVALFDYDP +MSPN  A  EELPF+ GQ +KVFG  D DGFY GE+ GR G +P NMV+E+ V +   P    ++  Q   +                        P V      N P+ Y     P    K   S       DP            P  P   +S      R M+A +DY+P+  SPN+D +AEL F+  D+I + G +D+DGFY G  NGQRGLVPSNFL
Sbjct: 1619 LRVFVALFDYDPISMSPNPDAGEEELPFREGQILKVFGDKDADGFYRGESGGRTGYIPCNMVAEVAVDT---PTGRQQL-LQRGFL-----------------------PPNVLTQGSGNGPSVYPSAHTPGPPPKPRRSK-KVELEDPAQ--------LCPGPPKLIHSAALKTSRPMVAAFDYNPRENSPNMDVEAELPFRAGDVITVFGNMDDDGFYYGELNGQRGLVPSNFL 1818          

HSP 2 Score: 112.849 bits (281), Expect = 2.534e-23
Identity = 73/261 (27.97%), Postives = 127/261 (48.66%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGSFS-LAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSN----NCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALV 2792
            +P P  I +   L    + V+ W++P      ++ ++  FHI+V+G   +A+       AVL N+DL+  P  ++V+++ S+G S   +C + +G+ + + PS L+ +++T  SA+I+W+P NSN  H V++NG +     P  Y      L+P  L + +V   I       P         A L F TLP       G+       D P DV+ + G  PG  ++ W+ P  +    TS  +++ GY++  + Q I  V
Sbjct:  789 VPYPRHITVLKQLAH--SVVLAWELPP-----ERVDLRGFHIFVNGELRQALGPGVPPKAVLENMDLRAGPLHVSVQALTSKGSSDPLRCCLAMGAGAGVVPSQLRIHRLTATSAEITWVPGNSNLAHAVYLNGEECPPARPSTYWATFCNLRPGTLYQARVEAQIPSQGPWEPGWERPELRAATLQFTTLPA------GLP------DAPLDVQAEPGPSPGIVMISWL-PVTIDAAGTSNGVRVTGYAVYADGQKIMEV 1029          

HSP 3 Score: 75.8702 bits (185), Expect = 4.052e-12
Identity = 36/69 (52.17%), Postives = 46/69 (66.67%), Query Frame = 3
Query: 3954 HQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMV 4160
            H  + +  R  VA FDY+P   SPN   +  ELPF++G  I VFG +D+DGFY GE NG+RGLVPSN +
Sbjct: 1751 HSAALKTSRPMVAAFDYNPRENSPNMD-VEAELPFRAGDVITVFGNMDDDGFYYGELNGQRGLVPSNFL 1818          

HSP 4 Score: 62.7734 bits (151), Expect = 4.407e-8
Identity = 34/83 (40.96%), Postives = 47/83 (56.63%), Query Frame = 3
Query: 3951 SHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI---DVKSTF 4187
             H      I+ F+A + Y+P    PN      ELP  +G+ I ++G +DEDGF+ GE  +GRRGLVPSN V  +   D+ ST 
Sbjct:  645 GHSGGGARIQVFLARYSYNPFE-GPNENP-EAELPLTAGEYIYIYGNMDEDGFFEGELMDGRRGLVPSNFVERVSDDDLLSTL 725          
BLAST of RIMS binding protein 2 vs. UniProt/SwissProt
Match: sp|O15034|RIMB2_HUMAN (RIMS-binding protein 2 OS=Homo sapiens OX=9606 GN=RIMBP2 PE=1 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 4.212e-21
Identity = 91/343 (26.53%), Postives = 157/343 (45.77%), Query Frame = 3
Query: 1956 NSACNKDYGETPNNELGFNTNLESQRKHI-PAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVT 2957
            +S  + D G T N+    + N++   + I P P +I +   L +  + +V W+ P +        ++++++ VD      +++     A++  L++    +RI+V+ V S+G S + QCT+ +G    +APSHL+ + IT  SAQ+SW+P+NSN+ H +++N  ++       YK     L+P+   KV+V     +     P        AF++F TLP       G   P      P DV ++ G  P    V W  P L     S    + GY +    Q +A V     D  ++ L+ LR++                  +TVRT++   +S  DSAV 
Sbjct:  268 HSPTHIDAGITDNSAGTLDVNIDDIGEDIVPYPRKITLIKQLAK--SVIVGWEPPAVPPGWG--TVSSYNVLVDKETRMNLTLGSRTKALIEKLNMAACTYRISVQCVTSRGSSDELQCTLLVGKDVVVAPSHLRVDNITQISAQLSWLPTNSNYSHVIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVEFSTLPA------GPPAP------PQDVTVQAGVTPATIRVSWRPPVLTPTGLSNGANVTGYGVYAKGQRVAEVIFPTADSTAVELVRLRSLEAK--------------GVTVRTLSAQGES-VDSAVA 579          

HSP 2 Score: 98.5969 bits (244), Expect = 3.586e-19
Identity = 46/64 (71.88%), Postives = 48/64 (75.00%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R FVALFDYDP TMSPN  A  EELPFK GQ IKV+G  D DGFY GET  R GL+P NMVSEI
Sbjct:  851 RIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEI 914          

HSP 3 Score: 77.411 bits (189), Expect = 1.116e-12
Identity = 36/64 (56.25%), Postives = 45/64 (70.31%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R  VAL+DYDP   SPN   +  EL F +G  I VFG++DEDGFY GE NG++GLVPSN + E+
Sbjct:  955 RRMVALYDYDPRESSPNVD-VEAELTFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEV 1017          

HSP 4 Score: 73.9442 bits (180), Expect = 1.276e-11
Identity = 46/77 (59.74%), Postives = 57/77 (74.03%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPSY 4733
            R+M+ALYDYDP+  SPNVD +AEL F   DII + GEIDEDGFY G  NGQ+GLVPSNFL ++P  +E  +   PS+
Sbjct:  955 RRMVALYDYDPRESSPNVDVEAELTFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEVPDDVEVYLSDAPSH 1031          

HSP 5 Score: 56.225 bits (134), Expect = 3.562e-6
Identity = 31/71 (43.66%), Postives = 43/71 (60.56%), Query Frame = 3
Query: 3951 SHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMV 4160
            S Q+ +  +   VA + Y+P    PN      ELP  +G+ + V+G +DEDGFY GE  +G+RGLVPSN V
Sbjct:  161 SKQRYSGKVHLCVARYSYNPFD-GPNENP-EAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFV 229          
BLAST of RIMS binding protein 2 vs. UniProt/SwissProt
Match: sp|Q8QFX1|RIMB2_CHICK (RIMS-binding protein 2 OS=Gallus gallus OX=9031 GN=RIMBP2 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.619e-19
Identity = 83/314 (26.43%), Postives = 146/314 (46.50%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVT 2957
            +P P +I +   L +  + +V W+ P +        I ++++ VD      +++     A++  L++    +RI+++S+ ++G S + QCT+ +G    +APS+LK + IT  SA++SW+P+NSN+ H +++N  ++       YK     L+P+   KV+V     +     P        AF++F TLP       G   P      P DV ++ GS      V W  P L    TS    + GY +    Q +A V     +   + L+ LR        NL ++       +TVRT++   +S  DS+V 
Sbjct:  315 VPYPRKITLIKQLAK--SVIVGWEPPVVPPGWG--TINSYNVLVDKEVRMNIALGSRTKALIEKLNISTCTYRISIQSITNKGNSDELQCTLLVGKDVVVAPSNLKVDNITQISAELSWLPTNSNYSHVIFLNEEEFDIVKAASYKYHFFNLKPNMAYKVKVMAKPHQMPWQLPLEQREKKEAFVEFSTLPA------GPPAP------PQDVTVRAGSTQATIQVSWKPPALTATGTSHGANVTGYGVYAKGQRVAEVIFPTAENTLVELMRLR--------NLEAKE------VTVRTLSAQGES-VDSSVA 597          

HSP 2 Score: 98.2117 bits (243), Expect = 5.796e-19
Identity = 46/64 (71.88%), Postives = 48/64 (75.00%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R FVALFDYDP TMSPN  A  EELPFK GQ IKV+G  D DGFY GET  R GL+P NMVSEI
Sbjct: 1124 RIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETCTRIGLIPCNMVSEI 1187          

HSP 3 Score: 78.5666 bits (192), Expect = 5.611e-13
Identity = 37/73 (50.68%), Postives = 50/73 (68.49%), Query Frame = 3
Query: 3951 SHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            S ++ + + R  VAL+DYDP   SPN   +  EL F +G  I VFG++DEDGFY GE NG++GLVPSN + E+
Sbjct: 1219 SGRQHSVSTRRMVALYDYDPRESSPNVD-VEAELTFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEV 1290          

HSP 4 Score: 74.3294 bits (181), Expect = 1.274e-11
Identity = 46/76 (60.53%), Postives = 56/76 (73.68%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPS 4730
            R+M+ALYDYDP+  SPNVD +AEL F   DII + GEIDEDGFY G  NGQ+GLVPSNFL ++P  +E  +   PS
Sbjct: 1228 RRMVALYDYDPRESSPNVDVEAELTFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEVPDDVEVYLSDAPS 1303          

HSP 5 Score: 56.6102 bits (135), Expect = 3.072e-6
Identity = 30/71 (42.25%), Postives = 43/71 (60.56%), Query Frame = 3
Query: 3951 SHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMV 4160
            S Q+ +  +   +A + Y+P    PN      ELP  +G+ + V+G +DEDGFY GE  +G+RGLVPSN V
Sbjct:  180 SKQRYSGKVHLCIARYSYNPFD-GPNENP-EAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFV 248          
BLAST of RIMS binding protein 2 vs. TrEMBL
Match: A0A4Z2D2M6 (Peripheral-type benzodiazepine receptor-associated protein (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_005184 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 2.645e-42
Identity = 107/304 (35.20%), Postives = 165/304 (54.28%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPV-----IDKFVDNSPNSNN-----------CAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWV-CPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYL 2897
            +PAP  I +E  L Q  + ++ WK P I++  +   ++A+HIYVDG F  AV   E   A++ N+D  +PHRI++RS+ S GQSKDAQCT+ +G   +  P+ LKA KI   SA++SWIP NSN+ H V++N      C PG+YK+ +  L PD L +V V  +     + + +   P   N            AF++F+TLPI      G+  P      P+ V+++ G + G  ++ W+  PQ   + +  + GY++ +N Q I  +NGA  D     +L L TI   + Q L++   QS L
Sbjct:  295 VPAPRMITLERQLFQ--SVLISWKAPDINLMNENKIVSAYHIYVDGQFRLAVMSKEKTRALIDNVDADKPHRISIRSISSHGQSKDAQCTLVVGRGMTATPARLKATKIGTKSAKLSWIPGNSNYYHRVYLNECSLHLCKPGVYKLHLTDLPPDTLHRVCVQALPSPINLQETIQQPPAWINSGCTGVYTQKLAAFIEFRTLPI------GLPDP------PSHVQIEAGPQDGMLLITWLPVPQDKGAADFTVQGYTVCLNGQPIMEMNGASRDH---AILKLSTIKDHI-QRLINNPTQSSL 580          

HSP 2 Score: 101.679 bits (252), Expect = 1.476e-17
Identity = 44/66 (66.67%), Postives = 50/66 (75.76%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEID 4172
            +R  VAL+DYDP TMSPN     EELPF+ GQ IK+  + DEDGFY GE NG RGLVPSNMVSE+D
Sbjct: 1329 LRVVVALYDYDPTTMSPNIDGAQEELPFREGQLIKILTECDEDGFYLGECNGLRGLVPSNMVSELD 1394          
BLAST of RIMS binding protein 2 vs. TrEMBL
Match: A0A5K4F7U3 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 8.571e-42
Identity = 122/359 (33.98%), Postives = 186/359 (51.81%), Query Frame = 3
Query: 1902 VSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRK-HIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPV-----IDKFVDNSPNSNN-----------CAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWV-CPQ------LVT----SPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQS 2891
            +++TT N  ++   L  SN+      G+ PN    F    ES++   +PAP  I +E  L Q  + ++ WK P+++ N     ++A+HIYVDG F  AV   E   A++ N+D  +PHRI++RS+ S GQSKDAQCT+ +G   +  P+ LKA +I   SA++SWIP NSN+ H V++N +    C PG+YK+ +  L PD L +V V  +     I +    SP   N            AF++F+TLPI      G+  P      P+ V+++ G + G  ++ W+  PQ       VT    S  + + GY++ +N Q I  + GA  D     +L L TI   + Q LL    QS
Sbjct:  248 MTTTTNNNKQVKGRLFRSNTDLQITEGDDPNLVELFQVIEESRKSTDVPAPRMITLERQLFQ--SVLISWKSPELNENKI---VSAYHIYVDGQFRLAVMAKEKTRALIDNVDADKPHRISIRSISSHGQSKDAQCTLVVGRGMTATPARLKATQIGTKSAKLSWIPGNSNYYHRVYLNETSLHVCKPGVYKLHLTDLPPDTLHQVCVQALPSPISIQESAQQSPPWINTACSGVYTQKLAAFIEFRTLPI------GLPDP------PSHVQIEAGPQDGMLLITWLPVPQDKNAVEAVTAAGASSTLPVQGYTVCLNGQAIMELKGASRDH---AILKLSTIKDHI-QKLLHNSTQS 585          

HSP 2 Score: 98.2117 bits (243), Expect = 2.033e-16
Identity = 44/69 (63.77%), Postives = 50/69 (72.46%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKS 4181
            I+  VAL+DYDP TMSPN     EELPF+ GQ IK+  + DEDGFY GE NG RGLVPSNMVSE+   S
Sbjct: 1285 IQVVVALYDYDPTTMSPNIDGAQEELPFREGQLIKILTECDEDGFYLGECNGLRGLVPSNMVSELQSHS 1353          

HSP 3 Score: 75.8702 bits (185), Expect = 1.280e-9
Identity = 33/62 (53.23%), Postives = 47/62 (75.81%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGET-NGRRGLVPSNMV 4160
            +  +A++DYDP  +SPN+  I  EL F++G+ I V+G +D+DGFY GET +GRRGLVPSN +
Sbjct: 1503 KIMIAIYDYDPHVLSPNAD-IDAELSFRAGEQITVYGNMDDDGFYYGETKDGRRGLVPSNFL 1563          
BLAST of RIMS binding protein 2 vs. TrEMBL
Match: A0A5K4F4J2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 9.684e-42
Identity = 122/359 (33.98%), Postives = 186/359 (51.81%), Query Frame = 3
Query: 1902 VSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRK-HIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPV-----IDKFVDNSPNSNN-----------CAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWV-CPQ------LVT----SPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQS 2891
            +++TT N  ++   L  SN+      G+ PN    F    ES++   +PAP  I +E  L Q  + ++ WK P+++ N     ++A+HIYVDG F  AV   E   A++ N+D  +PHRI++RS+ S GQSKDAQCT+ +G   +  P+ LKA +I   SA++SWIP NSN+ H V++N +    C PG+YK+ +  L PD L +V V  +     I +    SP   N            AF++F+TLPI      G+  P      P+ V+++ G + G  ++ W+  PQ       VT    S  + + GY++ +N Q I  + GA  D     +L L TI   + Q LL    QS
Sbjct:  248 MTTTTNNNKQVKGRLFRSNTDLQITEGDDPNLVELFQVIEESRKSTDVPAPRMITLERQLFQ--SVLISWKSPELNENKI---VSAYHIYVDGQFRLAVMAKEKTRALIDNVDADKPHRISIRSISSHGQSKDAQCTLVVGRGMTATPARLKATQIGTKSAKLSWIPGNSNYYHRVYLNETSLHVCKPGVYKLHLTDLPPDTLHQVCVQALPSPISIQESAQQSPPWINTACSGVYTQKLAAFIEFRTLPI------GLPDP------PSHVQIEAGPQDGMLLITWLPVPQDKNAVEAVTAAGASSTLPVQGYTVCLNGQAIMELKGASRDH---AILKLSTIKDHI-QKLLHNSTQS 585          

HSP 2 Score: 98.2117 bits (243), Expect = 2.123e-16
Identity = 44/69 (63.77%), Postives = 50/69 (72.46%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKS 4181
            I+  VAL+DYDP TMSPN     EELPF+ GQ IK+  + DEDGFY GE NG RGLVPSNMVSE+   S
Sbjct: 1285 IQVVVALYDYDPTTMSPNIDGAQEELPFREGQLIKILTECDEDGFYLGECNGLRGLVPSNMVSELQSHS 1353          

HSP 3 Score: 75.8702 bits (185), Expect = 1.314e-9
Identity = 33/62 (53.23%), Postives = 47/62 (75.81%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGET-NGRRGLVPSNMV 4160
            +  +A++DYDP  +SPN+  I  EL F++G+ I V+G +D+DGFY GET +GRRGLVPSN +
Sbjct: 1503 KIMIAIYDYDPHVLSPNAD-IDAELSFRAGEQITVYGNMDDDGFYYGETKDGRRGLVPSNFL 1563          
BLAST of RIMS binding protein 2 vs. TrEMBL
Match: G4LWB5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_176510 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 3.545e-40
Identity = 118/342 (34.50%), Postives = 177/342 (51.75%), Query Frame = 3
Query: 1953 SNSACNKDYGETPNNELGFNTNLESQRK-HIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPV-----IDKFVDNSPNSNN-----------CAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWV-CPQ------LVT----SPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQS 2891
            SN+      G+ PN    F    ES++   +PAP  I +E  L Q  + ++ WK P+++ N     ++A+HIYVDG F  AV   E   A++ N+D  +PHRI++RS+ S GQSKDAQCT+ +G   +  P+ LKA +I   SA++SWIP NSN+ H V++N +    C PG+YK+ +  L PD L +V V  +     I +    SP   N            AF++F+TLPI      G+  P      P+ V+++ G + G  ++ W+  PQ       VT    S  + + GY++ +N Q I  + GA  D     +L L TI   + Q LL    QS
Sbjct:  194 SNTDLQITEGDDPNLVELFQVIEESRKSTDVPAPRMITLERQLFQ--SVLISWKSPELNENKI---VSAYHIYVDGQFRLAVMAKEKTRALIDNVDADKPHRISIRSISSHGQSKDAQCTLVVGRGMTATPARLKATQIGTKSAKLSWIPGNSNYYHRVYLNETSLHVCKPGVYKLHLTDLPPDTLHQVCVQALPSPISIQESAQQSPPWINTACSGVYTQKLAAFIEFRTLPI------GLPDP------PSHVQIEAGPQDGMLLITWLPVPQDKNAVEAVTAAGASSTLPVQGYTVCLNGQAIMELKGASRDH---AILKLSTIKDHI-QKLLHNSTQS 514          

HSP 2 Score: 97.8265 bits (242), Expect = 2.435e-16
Identity = 44/69 (63.77%), Postives = 50/69 (72.46%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKS 4181
            I+  VAL+DYDP TMSPN     EELPF+ GQ IK+  + DEDGFY GE NG RGLVPSNMVSE+   S
Sbjct: 1214 IQVVVALYDYDPTTMSPNIDGAQEELPFREGQLIKILTECDEDGFYLGECNGLRGLVPSNMVSELQSHS 1282          
BLAST of RIMS binding protein 2 vs. TrEMBL
Match: A0A094ZIQ3 (Peripheral-type benzodiazepine receptor-associated protein 1 OS=Schistosoma haematobium OX=6185 GN=MS3_02648 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 9.916e-39
Identity = 112/337 (33.23%), Postives = 173/337 (51.34%), Query Frame = 3
Query: 1920 NENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPV-----IDKFVDNSPNSNN-----------CAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWV-CPQ------LVT----SPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTI 2846
            N  ++   L  SN+      G+ PN    F    ES +    AP  I +E  L Q  + ++ WK P+++   +   ++A+HIYVDG F  AV   E   A++ N+D  +PHRI++RS+ S GQSKDAQCT+ +G   +  P+ LKA +I   SA++SWIP NSN+ H V++N +    C PG+YK+ +  L PD L +V V  +     + +    SP   N            AF++F+TLPI      G+  P      P+ V+++ G + G  ++ W+  PQ       VT    S ++ + GY++ +N Q I  + GA  D     +L L TI
Sbjct:  166 NNKQVKGRLFRSNTDLQIPEGDDPNLVELFQVIEESNKS--TAPRMITLERQLFQ--SVLISWKSPELNSMNENKIVSAYHIYVDGQFRLAVMAKEKTRALIDNVDADKPHRISIRSISSHGQSKDAQCTLVVGRGMTATPARLKATQIGTKSAKLSWIPGNSNYYHRVYLNETSLHVCKPGVYKLHLTDLPPDTLHQVCVQALPSPMSVQESAQQSPPWINTAWSGVHTQKLAAFIEFRTLPI------GLPDP------PSHVQIEAGPQDGMLLITWLPVPQDKNAVEAVTAAGASSSLPVQGYTVCLNGQAIMEMKGASRDH---AILKLSTI 483          
BLAST of RIMS binding protein 2 vs. Ensembl Cavefish
Match: rimbp2 (RIMS binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-040724-96])

HSP 1 Score: 101.679 bits (252), Expect = 5.677e-21
Identity = 46/64 (71.88%), Postives = 49/64 (76.56%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R FVALFDYDP +MSPN  A  EELPFK GQ IKVFG+ D DGFY  E  GRRGL+P NMVSEI
Sbjct:  840 RIFVALFDYDPLSMSPNPDAAVEELPFKEGQIIKVFGEKDTDGFYRAEVCGRRGLIPCNMVSEI 903          

HSP 2 Score: 87.4261 bits (215), Expect = 1.086e-16
Identity = 67/257 (26.07%), Postives = 122/257 (47.47%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPI-YNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALV 2792
            +P P +I +   L +  + ++ W  P +       +I+ +++ VD     +V       +++  L+L    HRI+V+S+  +G S   +CT+ +G    +AP  L+ + +T  SA++SW+PSNSN+ H++++N ++Y    PG Y+     L+   + KV+      +     P        + + + I + + S G   P      P DV++  G  PG   V+W  P L    TS    ++GY +    Q IA V
Sbjct:  289 VPYPRRITLIKQLAK--SVIISWDSPVVPPGWG--SISGYNVLVDQEVRMSVPFGTRTKSLIEKLNLATCAHRISVQSMTERGPSDPLRCTLLVGKDVVVAPQCLRVDNVTQTSAELSWMPSNSNYSHSIFLNDAEYDVVKPGSYRYRFYNLKSATVYKVRAVAKPHQMPWQLPLEQR----EKKEISIEFCTQSTGPPCP------PQDVQVHCGQSPGVLQVRWKPPTLSPCGTSNGASVIGYVVCTKGQKIAEV 531          

HSP 3 Score: 77.411 bits (189), Expect = 1.322e-13
Identity = 47/84 (55.95%), Postives = 60/84 (71.43%), Query Frame = 3
Query: 4479 NSRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPS 4730
            + RNP   R+M+ALYDYDP+  SPNVD +AEL F   D+I +  EIDEDGFY G  NG +GLVPSNFL ++P  +E  + T+PS
Sbjct:  935 SGRNPVSTRRMVALYDYDPRESSPNVDVEAELTFCAGDVITVFAEIDEDGFYYGELNGHKGLVPSNFLEEVPDDVEVYL-TEPS 1017          

HSP 4 Score: 76.2554 bits (186), Expect = 3.354e-13
Identity = 35/64 (54.69%), Postives = 43/64 (67.19%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R  VAL+DYDP   SPN   +  EL F +G  I VF ++DEDGFY GE NG +GLVPSN + E+
Sbjct:  943 RRMVALYDYDPRESSPNVD-VEAELTFCAGDVITVFAEIDEDGFYYGELNGHKGLVPSNFLEEV 1005          

HSP 5 Score: 54.299 bits (129), Expect = 1.428e-6
Identity = 29/63 (46.03%), Postives = 41/63 (65.08%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMV 4160
            +R  VA ++Y+P    PN      ELP  +G+ + V+G +DEDGFY GE  +G++GLVPSN V
Sbjct:  194 VRLCVARYNYNPYD-GPNEHP-EAELPLVAGKYLYVYGTMDEDGFYEGELLDGQQGLVPSNFV 254          
BLAST of RIMS binding protein 2 vs. Ensembl Cavefish
Match: si:ch73-287m6.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000067.1:842820:911365:1 gene:ENSAMXG00000002674.2 transcript:ENSAMXT00000002748.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:si:ch73-287m6.1)

HSP 1 Score: 100.908 bits (250), Expect = 7.143e-21
Identity = 72/259 (27.80%), Postives = 127/259 (49.03%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALV 2792
            +P P +I +   L +  + +V W+ P I +     NI  +++ VDG     V        +L  LDL    +R++V+ V  +G S + +CT+ +G + ++AP+ L+ + I  +SA +SW+PSNSN+ HTV+++G ++    P  Y++    L+   + KV+V     +   + P        A ++F T       + G   P      P +V+++ G  PG   V+W  P L    TS    ++GY++    Q IA V
Sbjct:  185 VPYPRKINLIKQLAR--SVIVAWETPLIPMGWG--NINGYNVLVDGEVRSTVPFGGRTKLLLEKLDLAACTYRVSVQCVTERGLSDELRCTLLVGRNVTVAPTGLRLDDILRDSADLSWLPSNSNYSHTVFLDGVEHAVVKPCCYRLRFTNLKATTVYKVKVVAKPHQVPWHMPLEQREKKEAGVEFCT------QAAGPPLP------PHEVQVQCGQAPGILQVRWKPPPLTPLGTSNGANVIGYAVCTKGQRIAEV 427          

HSP 2 Score: 98.2117 bits (243), Expect = 6.027e-20
Identity = 45/65 (69.23%), Postives = 48/65 (73.85%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
             R FVALFDYDP +MSPN  A  EELPFK GQ IKV+G  D DGFY GE  GR GL+P NMVSEI
Sbjct:  738 FRIFVALFDYDPLSMSPNPDAADEELPFKEGQIIKVYGDKDTDGFYRGEIRGRAGLIPCNMVSEI 802          

HSP 3 Score: 67.781 bits (164), Expect = 1.142e-10
Identity = 36/76 (47.37%), Postives = 43/76 (56.58%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYT------------GETNGRRGLVPSNMVSEI 4169
            R  VAL+DYDP   SPN   +  EL F +G  I VFG++DEDGF              GE NG RGLVPSN + E+
Sbjct:  842 RRMVALYDYDPRESSPNVD-VEAELTFCAGDIIAVFGEIDEDGFLLCDSFFFLCVNLQGEMNGHRGLVPSNFLEEV 916          

HSP 4 Score: 66.6254 bits (161), Expect = 2.365e-10
Identity = 46/97 (47.42%), Postives = 59/97 (60.82%), Query Frame = 3
Query: 4479 NSRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYM------------GRKNGQRGLVPSNFLTDLPPPLETRVRTQPSY 4733
              R+P   R+M+ALYDYDP+  SPNVD +AEL F   DII + GEIDEDGF +            G  NG RGLVPSNFL ++P  +E  +   P++
Sbjct:  834 GGRHPVATRRMVALYDYDPRESSPNVDVEAELTFCAGDIIAVFGEIDEDGFLLCDSFFFLCVNLQGEMNGHRGLVPSNFLEEVPDDVEVYLTDTPTH 930          
BLAST of RIMS binding protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000046190.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000113.1:2113989:2161607:-1 gene:ENSAMXG00000015980.2 transcript:ENSAMXT00000046190.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 2.049e-20
Identity = 45/67 (67.16%), Postives = 49/67 (73.13%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDV 4175
            +R FVALF YDP TMSPN  A  EELPF+ GQ IKV+G  D DGFY GE+ GR G VP NMVSEI V
Sbjct: 1224 VRVFVALFPYDPVTMSPNRDAAEEELPFREGQIIKVYGDKDADGFYRGESGGRHGYVPCNMVSEIQV 1290          

HSP 2 Score: 95.5153 bits (236), Expect = 5.322e-19
Identity = 90/351 (25.64%), Postives = 158/351 (45.01%), Query Frame = 3
Query: 1938 PSLQTSNSACNKDYGETPNNEL--GFNTNLES-QRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDL-KRPHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCI-PGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSA 2951
            P++ T ++  N      P   L  G + +LE      +P P +I +   L +  + ++ W+ P + V      + ++++YVD      V       AVL  L+L ++ +R+AV+S+  +G S   +C++ +G    +AP+ L+  ++T  SA +SW+PSNSN+ H V +N  + C+ +  G Y + +  L P     V+V     +     P            F TL      S G        D P DV+L+ G  PG   + W+ P  +    TS  +++ GY+I  + + +  V+        IG   ++T+             Q+   +TVRTM+   +S  DSA
Sbjct:  284 PAVTTDSAKANAHAPILPATPLTNGLDLDLEEVGADTVPYPRKITLIKQLAK--SIIIGWEPPLVPVGWGA--VWSYNVYVDQELRLNVPFGAQTKAVLERLELGQKGYRVAVQSLTERGGSDQLRCSMLVGRDVCVAPTQLRVERVTATSACLSWLPSNSNYVHIVSLNNEE-CELVKAGCYSLCLSNLTPSLHYCVKVEARPHRTPWELPVEQRERKSVITSFTTL------SAGPP------DAPLDVQLEHGPSPGIAQISWL-PVTIDAAGTSNGVRVTGYTIYADKKKVLEVSSPTAGSALIGPSQIQTL-------------QAAREITVRTMSPNGES-VDSA 602          

HSP 3 Score: 70.4774 bits (171), Expect = 1.865e-11
Identity = 32/61 (52.46%), Postives = 43/61 (70.49%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMV 4160
            R  VA+FDYDP   SPN+  +  EL F +G  I VFG +D+DGF+ G+ NG++GLVPSN +
Sbjct: 1332 RRMVAIFDYDPRESSPNAD-VEAELTFSAGDIIYVFGDMDDDGFFYGDLNGQKGLVPSNFL 1391          

HSP 4 Score: 62.003 bits (149), Expect = 7.467e-9
Identity = 35/60 (58.33%), Postives = 47/60 (78.33%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFL 4682
            R+M+A++DYDP+  SPN D +AEL F   DII + G++D+DGF+ G  NGQ+GLVPSNFL
Sbjct: 1332 RRMVAIFDYDPRESSPNADVEAELTFSAGDIIYVFGDMDDDGFFYGDLNGQKGLVPSNFL 1391          

HSP 5 Score: 59.3066 bits (142), Expect = 4.456e-8
Identity = 38/94 (40.43%), Postives = 53/94 (56.38%), Query Frame = 3
Query: 3960 KSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI---DVKST--FKPIDNSEITFQE 4223
            +    ++ F+A + Y+P    PN      ELP  +G+ I V+G +D+DGFY GE  +GRRGLVPSN V  +   DV S    +  D S  +FQE
Sbjct:  159 RGPAKLQVFIARYSYNPYD-GPNDNP-EVELPLTAGEYIYVYGDMDDDGFYEGELMDGRRGLVPSNFVERVSDDDVMSAHHHEAGDLSHNSFQE 250          
BLAST of RIMS binding protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000016473.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000113.1:2115668:2161607:-1 gene:ENSAMXG00000015980.2 transcript:ENSAMXT00000016473.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 2.403e-20
Identity = 45/67 (67.16%), Postives = 49/67 (73.13%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDV 4175
            +R FVALF YDP TMSPN  A  EELPF+ GQ IKV+G  D DGFY GE+ GR G VP NMVSEI V
Sbjct: 1224 VRVFVALFPYDPVTMSPNRDAAEEELPFREGQIIKVYGDKDADGFYRGESGGRHGYVPCNMVSEIQV 1290          

HSP 2 Score: 95.1301 bits (235), Expect = 5.797e-19
Identity = 90/351 (25.64%), Postives = 158/351 (45.01%), Query Frame = 3
Query: 1938 PSLQTSNSACNKDYGETPNNEL--GFNTNLES-QRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDL-KRPHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCI-PGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSA 2951
            P++ T ++  N      P   L  G + +LE      +P P +I +   L +  + ++ W+ P + V      + ++++YVD      V       AVL  L+L ++ +R+AV+S+  +G S   +C++ +G    +AP+ L+  ++T  SA +SW+PSNSN+ H V +N  + C+ +  G Y + +  L P     V+V     +     P            F TL      S G        D P DV+L+ G  PG   + W+ P  +    TS  +++ GY+I  + + +  V+        IG   ++T+             Q+   +TVRTM+   +S  DSA
Sbjct:  284 PAVTTDSAKANAHAPILPATPLTNGLDLDLEEVGADTVPYPRKITLIKQLAK--SIIIGWEPPLVPVGWGA--VWSYNVYVDQELRLNVPFGAQTKAVLERLELGQKGYRVAVQSLTERGGSDQLRCSMLVGRDVCVAPTQLRVERVTATSACLSWLPSNSNYVHIVSLNNEE-CELVKAGCYSLCLSNLTPSLHYCVKVEARPHRTPWELPVEQRERKSVITSFTTL------SAGPP------DAPLDVQLEHGPSPGIAQISWL-PVTIDAAGTSNGVRVTGYTIYADKKKVLEVSSPTAGSALIGPSQIQTL-------------QAAREITVRTMSPNGES-VDSA 602          

HSP 3 Score: 70.4774 bits (171), Expect = 2.015e-11
Identity = 32/61 (52.46%), Postives = 43/61 (70.49%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMV 4160
            R  VA+FDYDP   SPN+  +  EL F +G  I VFG +D+DGF+ G+ NG++GLVPSN +
Sbjct: 1332 RRMVAIFDYDPRESSPNAD-VEAELTFSAGDIIYVFGDMDDDGFFYGDLNGQKGLVPSNFL 1391          

HSP 4 Score: 62.003 bits (149), Expect = 6.949e-9
Identity = 35/60 (58.33%), Postives = 47/60 (78.33%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFL 4682
            R+M+A++DYDP+  SPN D +AEL F   DII + G++D+DGF+ G  NGQ+GLVPSNFL
Sbjct: 1332 RRMVAIFDYDPRESSPNADVEAELTFSAGDIIYVFGDMDDDGFFYGDLNGQKGLVPSNFL 1391          

HSP 5 Score: 59.3066 bits (142), Expect = 4.670e-8
Identity = 38/94 (40.43%), Postives = 53/94 (56.38%), Query Frame = 3
Query: 3960 KSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI---DVKST--FKPIDNSEITFQE 4223
            +    ++ F+A + Y+P    PN      ELP  +G+ I V+G +D+DGFY GE  +GRRGLVPSN V  +   DV S    +  D S  +FQE
Sbjct:  159 RGPAKLQVFIARYSYNPYD-GPNDNP-EVELPLTAGEYIYVYGDMDDDGFYEGELMDGRRGLVPSNFVERVSDDDVMSAHHHEAGDLSHNSFQE 250          
BLAST of RIMS binding protein 2 vs. Ensembl Sea Lamprey
Match: si:ch73-287m6.1 (RIMS binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-040724-96])

HSP 1 Score: 92.4337 bits (228), Expect = 8.280e-19
Identity = 43/67 (64.18%), Postives = 47/67 (70.15%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDV 4175
            +R FV LFDYDP TMSPN  A   ELPFK GQ I+V G+ D DGFY GE  G  GLVP NMVSEI+ 
Sbjct: 1191 LRIFVGLFDYDPMTMSPNPDAADIELPFKEGQIIRVHGEKDGDGFYRGEALGHMGLVPCNMVSEIEA 1257          

HSP 2 Score: 61.2326 bits (147), Expect = 2.552e-9
Identity = 45/173 (26.01%), Postives = 79/173 (45.66%), Query Frame = 3
Query: 2301 QCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLVTSP-----NIKIVGYSILINNQCIALV 2792
            +CT  +G   S+AP  L+ +++T +SA++ W+PS+S++ H V+V+G +     PG     + GL+P    +V+V     +     P     +  A  +F T P  ++ +            P  V+++ G  PG   V W   Q  T P        + GY+I  + Q +  V
Sbjct:  471 RCTSVVGRGASVAPQSLEVHQVTPSSAELWWVPSHSDYTHAVFVDGVEKEVARPGRRHCPLTGLRPGTRHRVRVEARPHRTPWELPLEQREHRDAVAEFTTPPAGHALA------------PLVVEVRPGPVPGSLSVSWTPVQ--TDPAGAFNGAPVTGYAIFADGQKVMEV 629          

HSP 3 Score: 58.9214 bits (141), Expect = 1.136e-8
Identity = 32/75 (42.67%), Postives = 45/75 (60.00%), Query Frame = 3
Query: 3972 NIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI--DVKSTF 4187
             ++ F+A + Y+P    PN      ELP  +G+ + V+G +DEDGFY GE  +GRRGLVPSN +  +  D  S F
Sbjct:  250 KLQVFIARYSYNP-FHGPNEHP-EAELPLTAGEYLYVYGNMDEDGFYEGELVDGRRGLVPSNFIERVRDDEMSAF 322          

HSP 4 Score: 51.2174 bits (121), Expect = 2.848e-6
Identity = 40/116 (34.48%), Postives = 61/116 (52.59%), Query Frame = 3
Query: 4356 NDYPMIHRKSTDSAVSYAASDPNSYQRSQVDTYMPRQPSAGNSRNPTEYRKM---LALYDYDPQTLSPNVD-SDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDL 4691
            +D P +  + + +  +  A  P +       T  P    AG +    ++R++   + L+DYDP T+SPN D +D EL FK   II + GE D DGFY G   G  GLVP N ++++
Sbjct: 1144 SDCPDLGEERSQATATARAVRPRTATSGTTPTLGP----AGAAPLGEDHRRLRIFVGLFDYDPMTMSPNPDAADIELPFKEGQIIRVHGEKDGDGFYRGEALGHMGLVPCNMVSEI 1255          
BLAST of RIMS binding protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002923.1 (pep scaffold:Pmarinus_7.0:GL485378:6628:11246:-1 gene:ENSPMAG00000002676.1 transcript:ENSPMAT00000002923.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 1.740e-13
Identity = 34/64 (53.12%), Postives = 42/64 (65.62%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R  +ALFDYDP   SPN   I  EL F +G  I ++G +DEDGFY GE N + GLVPSN + E+
Sbjct:   70 RRMIALFDYDPRESSPNV-DIEAELSFTAGDIIAIYGDMDEDGFYFGELNSQTGLVPSNFLEEV 132          

HSP 2 Score: 68.9366 bits (167), Expect = 4.016e-13
Identity = 42/71 (59.15%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRV 4715
            R+M+AL+DYDP+  SPNVD +AEL+F   DII I G++DEDGFY G  N Q GLVPSNFL ++P  LE  +
Sbjct:   70 RRMIALFDYDPRESSPNVDIEAELSFTAGDIIAIYGDMDEDGFYFGELNSQTGLVPSNFLEEVPGDLEVAL 140          

HSP 3 Score: 48.521 bits (114), Expect = 3.515e-6
Identity = 20/34 (58.82%), Postives = 25/34 (73.53%), Query Frame = 3
Query: 4077 KVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVK 4178
            +V+G  D DGFY GE  G+RG VP NMVSE+ V+
Sbjct:    3 QVYGDKDGDGFYLGEAGGQRGFVPCNMVSELQVE 36          
BLAST of RIMS binding protein 2 vs. Ensembl Nematostella
Match: EDO39650 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9C9])

HSP 1 Score: 73.559 bits (179), Expect = 5.311e-15
Identity = 51/113 (45.13%), Postives = 70/113 (61.95%), Query Frame = 3
Query: 4353 YNDYPMIHRKSTDSAVSYAASDPNSYQRSQVDTYMPRQPSAGNSRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDL 4691
            YN    +  +  D A    +S P +Y+ S     +P+  S+   R  T  +KM+AL+DYDP+ LSPN DS+ EL+F   D++ + GE+DEDGF+ G  NG RGLVPSNFL DL
Sbjct:   45 YNMVSEVQVEDDDLANQAPSSLPQAYEPS-----LPQDNSSYYPREETSTQKMIALFDYDPRILSPNPDSEVELSFHVGDVVLVYGEMDEDGFFTGELNGLRGLVPSNFLEDL 152          

HSP 2 Score: 73.1738 bits (178), Expect = 9.205e-15
Identity = 33/61 (54.10%), Postives = 44/61 (72.13%), Query Frame = 3
Query: 3987 VALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            +ALFDYDP  +SPN  +   EL F  G  + V+G++DEDGF+TGE NG RGLVPSN + ++
Sbjct:   93 IALFDYDPRILSPNPDS-EVELSFHVGDVVLVYGEMDEDGFFTGELNGLRGLVPSNFLEDL 152          

HSP 3 Score: 70.8626 bits (172), Expect = 4.791e-14
Identity = 33/54 (61.11%), Postives = 37/54 (68.52%), Query Frame = 3
Query: 4017 MSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVK 4178
            MSPN GA  EEL F  G  IK+FG+ DEDGFY GE  G  G VP NMVSE+ V+
Sbjct:    1 MSPNPGAEEEELKFSEGDLIKIFGEKDEDGFYWGECEGVTGFVPYNMVSEVQVE 54          
BLAST of RIMS binding protein 2 vs. Ensembl Nematostella
Match: EDO34249 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPX6])

HSP 1 Score: 62.003 bits (149), Expect = 1.437e-10
Identity = 32/76 (42.11%), Postives = 44/76 (57.89%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKSTFKPIDNS 4205
            R FVAL+DYDP   SPN+     EL F+ G  ++V     +DGFY G    ++GL+PSN V E+ V +   P D +
Sbjct:    1 RTFVALYDYDPMKSSPNTNP-EFELAFREGDILRVEDTSRKDGFYFGSLQDKKGLIPSNFVEEVAVATARAPSDKA 75          

HSP 2 Score: 60.4622 bits (145), Expect = 4.206e-10
Identity = 28/66 (42.42%), Postives = 43/66 (65.15%), Query Frame = 3
Query: 3972 NIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            +++  VAL+DY+P T SP S     EL FK GQ + + G ++ DG+Y  + +GRRGLVP++ V  +
Sbjct:  106 DLQKMVALYDYNPETQSPLSNP-SAELSFKKGQVVTILGPMNSDGYYQADISGRRGLVPASFVESV 170          

HSP 3 Score: 53.9138 bits (128), Expect = 6.631e-8
Identity = 33/79 (41.77%), Postives = 52/79 (65.82%), Query Frame = 3
Query: 4446 DTYMPRQPSAGNSRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFL 4682
            D Y   +    N  N T+ +KM+ALYDY+P+T SP  +  AEL+FK   ++ I+G ++ DG+Y    +G+RGLVP++F+
Sbjct:   89 DLYADLEQVTFNYNNTTDLQKMVALYDYNPETQSPLSNPSAELSFKKGQVVTILGPMNSDGYYQADISGRRGLVPASFV 167          

HSP 4 Score: 51.2174 bits (121), Expect = 5.487e-7
Identity = 28/63 (44.44%), Postives = 41/63 (65.08%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDL 4691
            R  +ALYDYDP   SPN + + ELAF+  DI+ +     +DGFY G    ++GL+PSNF+ ++
Sbjct:    1 RTFVALYDYDPMKSSPNTNPEFELAFREGDILRVEDTSRKDGFYFGSLQDKKGLIPSNFVEEV 63          
BLAST of RIMS binding protein 2 vs. Ensembl Medaka
Match: ENSORLT00000013898.2 (TSPO associated protein 1 [Source:NCBI gene;Acc:101168315])

HSP 1 Score: 132.109 bits (331), Expect = 3.889e-30
Identity = 92/245 (37.55%), Postives = 127/245 (51.84%), Query Frame = 3
Query: 3972 NIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKSTFKPIDNSEITFQERIIGSIDRNKDSTISRSLQGKLNIDQYPIVSQSDYQNNPNQYSYNDYPMIHRKSTDSAVSYAASDPNSYQRSQVDTYMPR----QPSAGNSRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLP 4694
            ++R FVALF YDPA+MSPN  A  EELPF  GQ IKV+G  D DGFY GE+ G  G VP NMVSEI V+      +  +   Q+  +         + + S++ K+    +  + +        + S         K  +SA         + Q   VD+  P      P     +  +  R+M+A++DYDP+  SPN D +AEL F   D+I + G++DEDGF+ G  NG RGLVPSNFL   P
Sbjct: 1972 DVRIFVALFPYDPASMSPNPDAAEEELPFSEGQIIKVYGDKDADGFYRGESAGHVGFVPCNMVSEIQVEDE----ETRQQLLQQGFL---------STATSME-KIGTRTHAQLPRRPVPPPKPRRS---------KKVESA---------ALQEESVDSCGPEPCQAAPPTVTGKPASGARRMIAIFDYDPRESSPNTDIEAELTFSAGDVIHVFGDMDEDGFFYGDLNGHRGLVPSNFLQAFP 2184          

HSP 2 Score: 94.3597 bits (233), Expect = 1.169e-18
Identity = 82/338 (24.26%), Postives = 159/338 (47.04%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLK-RPHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCI-PGIYKIVMQGLQPDNLQ---KVQVHPVIDKF-VDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNL----LSQHDQSY--LPLTV--RTMATVTQSNFDSAVTECTIYSKDSQPIL 2996
            +P P ++ +   L +  + ++ W  P +       N+ +++++VD      V       AVL  LD+  + +R++V+S+  +G S   +C++ +G    +AP+ L  +++T  SA ++W+PSNSN+ H V +N  + C+ +  G Y + +  L P +LQ   KV+  P    + +      +  A + F TL         +  P    D P DV+L+ G  PG  ++ W+ P  +    TS  +++ GYSI ++ + +  V+        +G   ++ +    +Q L    +S H +S   LP+ V  +  A +    F S V    + +  +  I+
Sbjct: 1097 VPYPRKLTLIKQLAK--SIIIGWDPPLVPAGWG--NVFSYNVFVDQELRLNVPFGAQTKAVLERLDINLKAYRVSVQSLTEKGVSDQLRCSMLVGRDVCVAPTQLCVDRVTATSANLTWLPSNSNYVHIVSLNDEE-CELVKAGCYSLCLNNLLP-SLQYTVKVEARPHRTPWELPVERREHRSATITFSTL---------MAGPP---DAPLDVQLEQGPSPGIALISWL-PVTIDAAGTSNGVRVTGYSIYVDRKKVLEVSSPTAGSALLGPSQMQCLQ--AAQELTLRTMSAHGESCDSLPVKVPSKLAAIMAGPAFSSPVVPAALCASPASSIV 1413          

HSP 3 Score: 77.411 bits (189), Expect = 1.867e-13
Identity = 36/67 (53.73%), Postives = 44/67 (65.67%), Query Frame = 3
Query: 3960 KSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMV 4160
            K A   R  +A+FDYDP   SPN+  I  EL F +G  I VFG +DEDGF+ G+ NG RGLVPSN +
Sbjct: 2115 KPASGARRMIAIFDYDPRESSPNTD-IEAELTFSAGDVIHVFGDMDEDGFFYGDLNGHRGLVPSNFL 2180          

HSP 4 Score: 62.3882 bits (150), Expect = 5.904e-9
Identity = 36/98 (36.73%), Postives = 55/98 (56.12%), Query Frame = 3
Query: 3960 KSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI---DVKSTFKPIDNSEITFQERIIGSI 4241
            + A  ++ F+A + Y+P    PN      ELP  +G+ I V+G +D+DGFY GE  +GRRGLVPSN V  +   D  S  +P D  + +    ++ S+
Sbjct:  952 RGAAKLQVFIARYSYNPYD-GPNDNP-EVELPLTAGEYIYVYGDMDDDGFYEGELMDGRRGLVPSNFVERVSDDDFMSAHQP-DTGDASHNSLLVSSL 1046          
BLAST of RIMS binding protein 2 vs. Ensembl Medaka
Match: ENSORLT00000045063.1 (TSPO associated protein 1 [Source:NCBI gene;Acc:101168315])

HSP 1 Score: 132.109 bits (331), Expect = 4.318e-30
Identity = 92/245 (37.55%), Postives = 127/245 (51.84%), Query Frame = 3
Query: 3972 NIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKSTFKPIDNSEITFQERIIGSIDRNKDSTISRSLQGKLNIDQYPIVSQSDYQNNPNQYSYNDYPMIHRKSTDSAVSYAASDPNSYQRSQVDTYMPR----QPSAGNSRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLP 4694
            ++R FVALF YDPA+MSPN  A  EELPF  GQ IKV+G  D DGFY GE+ G  G VP NMVSEI V+      +  +   Q+  +         + + S++ K+    +  + +        + S         K  +SA         + Q   VD+  P      P     +  +  R+M+A++DYDP+  SPN D +AEL F   D+I + G++DEDGF+ G  NG RGLVPSNFL   P
Sbjct: 1673 DVRIFVALFPYDPASMSPNPDAAEEELPFSEGQIIKVYGDKDADGFYRGESAGHVGFVPCNMVSEIQVEDE----ETRQQLLQQGFL---------STATSME-KIGTRTHAQLPRRPVPPPKPRRS---------KKVESA---------ALQEESVDSCGPEPCQAAPPTVTGKPASGARRMIAIFDYDPRESSPNTDIEAELTFSAGDVIHVFGDMDEDGFFYGDLNGHRGLVPSNFLQAFP 1885          

HSP 2 Score: 94.7449 bits (234), Expect = 9.790e-19
Identity = 82/338 (24.26%), Postives = 159/338 (47.04%), Query Frame = 3
Query: 2040 IPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLK-RPHRIAVRSVCSQGQSKDAQCTIEIG-SFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCI-PGIYKIVMQGLQPDNLQ---KVQVHPVIDKF-VDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV----TSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNL----LSQHDQSY--LPLTV--RTMATVTQSNFDSAVTECTIYSKDSQPIL 2996
            +P P ++ +   L +  + ++ W  P +       N+ +++++VD      V       AVL  LD+  + +R++V+S+  +G S   +C++ +G    +AP+ L  +++T  SA ++W+PSNSN+ H V +N  + C+ +  G Y + +  L P +LQ   KV+  P    + +      +  A + F TL         +  P    D P DV+L+ G  PG  ++ W+ P  +    TS  +++ GYSI ++ + +  V+        +G   ++ +    +Q L    +S H +S   LP+ V  +  A +    F S V    + +  +  I+
Sbjct:  798 VPYPRKLTLIKQLAK--SIIIGWDPPLVPAGWG--NVFSYNVFVDQELRLNVPFGAQTKAVLERLDINLKAYRVSVQSLTEKGVSDQLRCSMLVGRDVCVAPTQLCVDRVTATSANLTWLPSNSNYVHIVSLNDEE-CELVKAGCYSLCLNNLLP-SLQYTVKVEARPHRTPWELPVERREHRSATITFSTL---------MAGPP---DAPLDVQLEQGPSPGIALISWL-PVTIDAAGTSNGVRVTGYSIYVDRKKVLEVSSPTAGSALLGPSQMQCLQ--AAQELTLRTMSAHGESCDSLPVKVPSKLAAIMAGPAFSSPVVPAALCASPASSIV 1114          

HSP 3 Score: 77.0258 bits (188), Expect = 1.945e-13
Identity = 36/67 (53.73%), Postives = 44/67 (65.67%), Query Frame = 3
Query: 3960 KSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMV 4160
            K A   R  +A+FDYDP   SPN+  I  EL F +G  I VFG +DEDGF+ G+ NG RGLVPSN +
Sbjct: 1816 KPASGARRMIAIFDYDPRESSPNTD-IEAELTFSAGDVIHVFGDMDEDGFFYGDLNGHRGLVPSNFL 1881          

HSP 4 Score: 62.3882 bits (150), Expect = 6.513e-9
Identity = 36/98 (36.73%), Postives = 55/98 (56.12%), Query Frame = 3
Query: 3960 KSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI---DVKSTFKPIDNSEITFQERIIGSI 4241
            + A  ++ F+A + Y+P    PN      ELP  +G+ I V+G +D+DGFY GE  +GRRGLVPSN V  +   D  S  +P D  + +    ++ S+
Sbjct:  653 RGAAKLQVFIARYSYNPYD-GPNDNP-EVELPLTAGEYIYVYGDMDDDGFYEGELMDGRRGLVPSNFVERVSDDDFMSAHQP-DTGDASHNSLLVSSL 747          
BLAST of RIMS binding protein 2 vs. Ensembl Medaka
Match: ENSORLT00000045084.1 (TSPO associated protein 1 [Source:NCBI gene;Acc:101168315])

HSP 1 Score: 97.8265 bits (242), Expect = 6.451e-20
Identity = 44/69 (63.77%), Postives = 50/69 (72.46%), Query Frame = 3
Query: 3972 NIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVK 4178
            ++R FVALF YDPA+MSPN  A  EELPF  GQ IKV+G  D DGFY GE+ G  G VP NMVSEI V+
Sbjct:  442 DVRIFVALFPYDPASMSPNPDAAEEELPFSEGQIIKVYGDKDADGFYRGESAGHVGFVPCNMVSEIQVE 510          

HSP 2 Score: 76.6406 bits (187), Expect = 1.927e-13
Identity = 36/67 (53.73%), Postives = 44/67 (65.67%), Query Frame = 3
Query: 3960 KSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMV 4160
            K A   R  +A+FDYDP   SPN+  I  EL F +G  I VFG +DEDGF+ G+ NG RGLVPSN +
Sbjct:  585 KPASGARRMIAIFDYDPRESSPNTD-IEAELTFSAGDVIHVFGDMDEDGFFYGDLNGHRGLVPSNFL 650          

HSP 3 Score: 63.1586 bits (152), Expect = 2.377e-9
Identity = 41/94 (43.62%), Postives = 56/94 (59.57%), Query Frame = 3
Query: 4425 SYQRSQVDTYMPR----QPSAGNSRNPTEYRKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLP 4694
            + Q   VD+  P      P     +  +  R+M+A++DYDP+  SPN D +AEL F   D+I + G++DEDGF+ G  NG RGLVPSNFL   P
Sbjct:  561 ALQEESVDSCGPEPCQAAPPTVTGKPASGARRMIAIFDYDPRESSPNTDIEAELTFSAGDVIHVFGDMDEDGFFYGDLNGHRGLVPSNFLQAFP 654          
BLAST of RIMS binding protein 2 vs. Ensembl Medaka
Match: si:ch73-287m6.1 (RIMS-binding protein 2 [Source:NCBI gene;Acc:101174933])

HSP 1 Score: 97.8265 bits (242), Expect = 9.424e-20
Identity = 44/65 (67.69%), Postives = 48/65 (73.85%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
             R FVALFDYDP +MSPN  A  EELPFK GQ I+V+G  D DGFY GE  GR GL+P NMVSEI
Sbjct: 1061 FRIFVALFDYDPLSMSPNPDAADEELPFKEGQIIRVYGDKDTDGFYRGEIRGRMGLIPCNMVSEI 1125          

HSP 2 Score: 93.9745 bits (232), Expect = 1.315e-18
Identity = 84/321 (26.17%), Postives = 143/321 (44.55%), Query Frame = 3
Query: 1896 DTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNL--------------ESQRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALV 2792
            D    T E  N + P   TS +    D G + +  LG N  L              +     +P P +I +   L +  + +V W+ P + +     NIT +++ VDG    ++        +L  LDL    +R++V+S   +G S + +CT+ +G+   +AP  L+ + I  ++A++SW+PSNSN+ HTV+++G ++     G Y++    L+P  + KV V     +     P        A ++F T       + G   P      P DV++  G   G   V+W  P L    TS    ++GY++    Q IA V
Sbjct:  400 DKEKPTGEGGNDLGPLEHTSLALVPVDGGTSQDGLLGSNNALVPYSNGTGGTLDPEDLAEDVVPYPRKINLIKQLAR--SVIVAWEPPVVPLGWG--NITGYNVLVDGEIRASMPYGSRTKCLLEKLDLDACVYRVSVQSATDRGLSDELRCTLLVGANVVVAPYGLRVDDIQQDTAELSWLPSNSNYAHTVFLDGVEHAVVKSGRYRLRFHNLKPLTVYKVTVVAQPHQMPWQLPLEQRERKEAGVEFCT------QAAGPPLP------PHDVQVLCGQGQGVLQVRWKPPMLSSTGTSNGANVIGYAVCTKGQRIAEV 704          

HSP 3 Score: 78.9518 bits (193), Expect = 5.397e-14
Identity = 37/64 (57.81%), Postives = 43/64 (67.19%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R  VAL+DYDP   SPN   +  EL F +G  I VFG +DEDGFY GE NG RGLVPSN + E+
Sbjct: 1165 RRMVALYDYDPRESSPNVD-VEAELTFCAGDIIAVFGDIDEDGFYYGELNGHRGLVPSNFLEEV 1227          

HSP 4 Score: 72.4034 bits (176), Expect = 4.533e-12
Identity = 45/76 (59.21%), Postives = 55/76 (72.37%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPS 4730
            R+M+ALYDYDP+  SPNVD +AEL F   DII + G+IDEDGFY G  NG RGLVPSNFL ++P  +E  +   PS
Sbjct: 1165 RRMVALYDYDPRESSPNVDVEAELTFCAGDIIAVFGDIDEDGFYYGELNGHRGLVPSNFLEEVPDDVEVYLTDTPS 1240          

HSP 5 Score: 53.5286 bits (127), Expect = 2.781e-6
Identity = 28/66 (42.42%), Postives = 41/66 (62.12%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMVSEI 4169
            +R   A + Y+P    PN      ELP  +G+ + V+G++D+DGFY GE  +G+RGLVPSN V  +
Sbjct:  335 VRLCTARYSYNPYD-GPNEHP-EAELPLVAGKYLYVYGEMDDDGFYEGELLDGQRGLVPSNFVEFV 398          
BLAST of RIMS binding protein 2 vs. Ensembl Medaka
Match: si:ch73-287m6.1 (RIMS-binding protein 2 [Source:NCBI gene;Acc:101174933])

HSP 1 Score: 97.4413 bits (241), Expect = 1.007e-19
Identity = 44/65 (67.69%), Postives = 48/65 (73.85%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
             R FVALFDYDP +MSPN  A  EELPFK GQ I+V+G  D DGFY GE  GR GL+P NMVSEI
Sbjct: 1012 FRIFVALFDYDPLSMSPNPDAADEELPFKEGQIIRVYGDKDTDGFYRGEIRGRMGLIPCNMVSEI 1076          

HSP 2 Score: 93.9745 bits (232), Expect = 1.315e-18
Identity = 84/321 (26.17%), Postives = 143/321 (44.55%), Query Frame = 3
Query: 1896 DTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNL--------------ESQRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKR-PHRIAVRSVCSQGQSKDAQCTIEIGS-FSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSP---NSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLV---TSPNIKIVGYSILINNQCIALV 2792
            D    T E  N + P   TS +    D G + +  LG N  L              +     +P P +I +   L +  + +V W+ P + +     NIT +++ VDG    ++        +L  LDL    +R++V+S   +G S + +CT+ +G+   +AP  L+ + I  ++A++SW+PSNSN+ HTV+++G ++     G Y++    L+P  + KV V     +     P        A ++F T       + G   P      P DV++  G   G   V+W  P L    TS    ++GY++    Q IA V
Sbjct:  351 DKEKPTGEGGNDLGPLEHTSLALVPVDGGTSQDGLLGSNNALVPYSNGTGGTLDPEDLAEDVVPYPRKINLIKQLAR--SVIVAWEPPVVPLGWG--NITGYNVLVDGEIRASMPYGSRTKCLLEKLDLDACVYRVSVQSATDRGLSDELRCTLLVGANVVVAPYGLRVDDIQQDTAELSWLPSNSNYAHTVFLDGVEHAVVKSGRYRLRFHNLKPLTVYKVTVVAQPHQMPWQLPLEQRERKEAGVEFCT------QAAGPPLP------PHDVQVLCGQGQGVLQVRWKPPMLSSTGTSNGANVIGYAVCTKGQRIAEV 655          

HSP 3 Score: 78.5666 bits (192), Expect = 6.048e-14
Identity = 37/64 (57.81%), Postives = 43/64 (67.19%), Query Frame = 3
Query: 3978 RYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEI 4169
            R  VAL+DYDP   SPN   +  EL F +G  I VFG +DEDGFY GE NG RGLVPSN + E+
Sbjct: 1116 RRMVALYDYDPRESSPNVD-VEAELTFCAGDIIAVFGDIDEDGFYYGELNGHRGLVPSNFLEEV 1178          

HSP 4 Score: 72.4034 bits (176), Expect = 4.836e-12
Identity = 45/76 (59.21%), Postives = 55/76 (72.37%), Query Frame = 3
Query: 4503 RKMLALYDYDPQTLSPNVDSDAELAFKCNXXXXXXXXXXXXXFYMGRKNGQRGLVPSNFLTDLPPPLETRVRTQPS 4730
            R+M+ALYDYDP+  SPNVD +AEL F   DII + G+IDEDGFY G  NG RGLVPSNFL ++P  +E  +   PS
Sbjct: 1116 RRMVALYDYDPRESSPNVDVEAELTFCAGDIIAVFGDIDEDGFYYGELNGHRGLVPSNFLEEVPDDVEVYLTDTPS 1191          

HSP 5 Score: 53.1434 bits (126), Expect = 3.081e-6
Identity = 28/63 (44.44%), Postives = 40/63 (63.49%), Query Frame = 3
Query: 3975 IRYFVALFDYDPATMSPNSGAIHEELPFKSGQNIKVFGQVDEDGFYTGE-TNGRRGLVPSNMV 4160
            +R   A + Y+P    PN      ELP  +G+ + V+G++D+DGFY GE  +G+RGLVPSN V
Sbjct:  286 VRLCTARYSYNPYD-GPNEHP-EAELPLVAGKYLYVYGEMDDDGFYEGELLDGQRGLVPSNFV 346          
BLAST of RIMS binding protein 2 vs. Planmine SMEST
Match: SMESG000001060.1 (SMESG000001060.1)

HSP 1 Score: 2088.54 bits (5410), Expect = 0.000e+0
Identity = 1106/1139 (97.10%), Postives = 1114/1139 (97.81%), Query Frame = 3
Query:  168 MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTIXXXXXXXXXXXXXXIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKHSLEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKPNLEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYEYINXXXXXXXXXXXXMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGEEDPATREKVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLLAMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDDHSEDSTXXXXXXXXXXXXXCTQQALNYXXXXXXXXXXKKTNQRSYFDFHRNGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKLTDPFGLKTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVXXXXXXXXXXXXIMLGDQLASFLNLMEANSDEKSGNLIXXXXXXXXXXXXFNDSKGCWHSCYCLNNSEFYDNESSFLPRSKLDWMENNPYQYRSMSIHYLDQPRLNNQHXXXXXXXXXXXXXXXXEIRQNLSNELIDDVCSTESSSNSHNYVYQNPDLDSNSMRQKSISDHSSRRDEETNKYLAVRRISK 3584
            MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTISPSSNYSLKSSKEKIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKH LEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKP+LEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYE INLKKKLEEK+LSLMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGEEDPATREKVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLLAMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDDHSEDSTEALKAELRELEKRCTQQALNYEEALLELEALKKTNQRSYFDFHRNGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKL DPFG KTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQK+TRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLG+RPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVAARIAGTAAEAAIMLGDQLASFLNLM ++  +K                 FNDSKGCWHSCYCLNNSEFYDNESSFLPRSKLDWMENNPYQYRSMSIHYLDQPRLNNQHRSLSDDSALDRLSDSREIRQNLSNELIDDVCSTESSSNSHNYVYQNPDLDSNSMR+KSISDHSSR DEETNKYLAVRRISK
Sbjct:    1 MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTISPSSNYSLKSSKEKIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKHYLEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKPDLEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYELINLKKKLEEKELSLMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGEEDPATREKVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLLAMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDDHSEDSTEALKAELRELEKRCTQQALNYEEALLELEALKKTNQRSYFDFHRNGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKLADPFGRKTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKNTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGNRPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVAARIAGTAAEAAIMLGDQLASFLNLMHSSDHDK-----------------FNDSKGCWHSCYCLNNSEFYDNESSFLPRSKLDWMENNPYQYRSMSIHYLDQPRLNNQHRSLSDDSALDRLSDSREIRQNLSNELIDDVCSTESSSNSHNYVYQNPDLDSNSMRRKSISDHSSRGDEETNKYLAVRRISK 1122          
BLAST of RIMS binding protein 2 vs. Planmine SMEST
Match: SMESG000001060.1 (SMESG000001060.1)

HSP 1 Score: 2073.9 bits (5372), Expect = 0.000e+0
Identity = 1112/1139 (97.63%), Postives = 1118/1139 (98.16%), Query Frame = 3
Query:  168 MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTIXXXXXXXXXXXXXXIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKHSLEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKPNLEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYEYINXXXXXXXXXXXXMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGEEDPATREKVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLLAMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDDHSEDSTXXXXXXXXXXXXXCTQQALNYXXXXXXXXXXKKTNQRSYFDFHRNGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKLTDPFGLKTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVXXXXXXXXXXXXIMLGDQLASFLNLMEANSDEKSGNLIXXXXXXXXXXXXFNDSKGCWHSCYCLNNSEFYDNESSFLPRSKLDWMENNPYQYRSMSIHYLDQPRLNNQHXXXXXXXXXXXXXXXXEIRQNLSNELIDDVCSTESSSNSHNYVYQNPDLDSNSMRQKSISDHSSRRDEETNKYLAVRRISK 3584
            MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTISPSSNYSLKSSKEKIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKH LEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKP+LEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYE INLKKKLEEK+LSLMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGEEDPATREKVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLLAMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDDHSEDSTEALKAELRELEKRCTQQALNYEEALLELEALKKTNQRSYFDFHRNGSKDD                IHNSGSSSVTDEFNGFHRDEFSKL DPFG KTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQK+TRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLG+RPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVAARIAGTAAEAAIMLGDQLASFLNLMEANSDEKSG+LISKKKMHSSDHDKFNDSKGCWHSCYCLNNSEFYDNESSFLPRSKLDWMENNPYQYRSMSIHYLDQPRLNNQHRSLSDDSALDRLSDSREIRQNLSNELIDDVCSTESSSNSHNYVYQNPDLDSNSMR+KSISDHSSR DEETNKYLAVRRISK
Sbjct:    1 MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTISPSSNYSLKSSKEKIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKHYLEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKPDLEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYELINLKKKLEEKELSLMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGEEDPATREKVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLLAMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDDHSEDSTEALKAELRELEKRCTQQALNYEEALLELEALKKTNQRSYFDFHRNGSKDD----------------IHNSGSSSVTDEFNGFHRDEFSKLADPFGRKTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKNTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGNRPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVAARIAGTAAEAAIMLGDQLASFLNLMEANSDEKSGSLISKKKMHSSDHDKFNDSKGCWHSCYCLNNSEFYDNESSFLPRSKLDWMENNPYQYRSMSIHYLDQPRLNNQHRSLSDDSALDRLSDSREIRQNLSNELIDDVCSTESSSNSHNYVYQNPDLDSNSMRRKSISDHSSRGDEETNKYLAVRRISK 1123          
BLAST of RIMS binding protein 2 vs. Planmine SMEST
Match: SMESG000001060.1 (SMESG000001060.1)

HSP 1 Score: 2031.91 bits (5263), Expect = 0.000e+0
Identity = 1095/1139 (96.14%), Postives = 1101/1139 (96.66%), Query Frame = 3
Query:  168 MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTIXXXXXXXXXXXXXXIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKHSLEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKPNLEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYEYINXXXXXXXXXXXXMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGEEDPATREKVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLLAMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDDHSEDSTXXXXXXXXXXXXXCTQQALNYXXXXXXXXXXKKTNQRSYFDFHRNGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKLTDPFGLKTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVXXXXXXXXXXXXIMLGDQLASFLNLMEANSDEKSGNLIXXXXXXXXXXXXFNDSKGCWHSCYCLNNSEFYDNESSFLPRSKLDWMENNPYQYRSMSIHYLDQPRLNNQHXXXXXXXXXXXXXXXXEIRQNLSNELIDDVCSTESSSNSHNYVYQNPDLDSNSMRQKSISDHSSRRDEETNKYLAVRRISK 3584
            MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTISPSSNYSLKSSKEKIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKH LEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKP+LEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYE INLKKKLEEK+LSLMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGEEDPATREKVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLLAMDRLLK                                 RETNTSSRDDHSEDSTEALKAELRELEKRCTQQALNYEEALLELEALKKTNQRSYFDFHRNGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKL DPFG KTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQK+TRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLG+RPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVAARIAGTAAEAAIMLGDQLASFLNLMEANSDEKSG+LISKKKMHSSDHDKFNDSKGCWHSCYCLNNSEFYDNESSFLPRSKLDWMENNPYQYRSMSIHYLDQPRLNNQHRSLSDDSALDRLSDSREIRQNLSNELIDDVCSTESSSNSHNYVYQNPDLDSNSMR+KSISDHSSR DEETNKYLAVRRISK
Sbjct:    1 MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTISPSSNYSLKSSKEKIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKHYLEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKPDLEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYELINLKKKLEEKELSLMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGEEDPATREKVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLLAMDRLLK---------------------------------RETNTSSRDDHSEDSTEALKAELRELEKRCTQQALNYEEALLELEALKKTNQRSYFDFHRNGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKLADPFGRKTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKNTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGNRPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVAARIAGTAAEAAIMLGDQLASFLNLMEANSDEKSGSLISKKKMHSSDHDKFNDSKGCWHSCYCLNNSEFYDNESSFLPRSKLDWMENNPYQYRSMSIHYLDQPRLNNQHRSLSDDSALDRLSDSREIRQNLSNELIDDVCSTESSSNSHNYVYQNPDLDSNSMRRKSISDHSSRGDEETNKYLAVRRISK 1106          
BLAST of RIMS binding protein 2 vs. Planmine SMEST
Match: SMESG000001060.1 (SMESG000001060.1)

HSP 1 Score: 1891.32 bits (4898), Expect = 0.000e+0
Identity = 1049/1196 (87.71%), Postives = 1081/1196 (90.38%), Query Frame = 3
Query:  168 MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTIXXXXXXXXXXXXXXIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKHSLEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKPNLEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYEYINXXXXXXXXXXXXMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGE-------------------------EDPATREKVETLTIFV----KSFQKNQKLLEDQLSVLRDKSNKTENYI-----------NEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQI--RDQENL-IKIKSLEILSEE--------------YKTKLLAMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDDHSEDSTXXXXXXXXXXXXXCTQQALNYXXXXXXXXXXKKTNQRSYFDFHRNGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKLTDPFGLKTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVXXXXXXXXXXXXIMLGDQLASFLNLMEANSDEKSGNLIXXXXXXXXXXXXFNDSKGCWHSCYCLNNSEFYDNESSFLPRSKLDWMENNPYQYRSMSIHYLDQPRLNNQHXXXXXXXXXXXXXXXXEIRQNLSNELIDDVCSTESSSNSHNYVYQNPDLDSNSMRQKSISDHSSRRDEETNKYLAVRRISK 3584
            MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTISPSSNYSLKSSKEKIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKH LEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKP+LEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYE INLKKKLEEK+LSLMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLH   +                          D  T   V     FV    +SF  N +   ++    R+K      ++           +++SVL+ ++ K    + + S ++   EKL  ++  N    ++ E L I+I+S +I  +E              YKTKLLAMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDDHSEDSTEALKAELRELEKRCTQQALNYEEALLELEALKKTNQRSYFDFHRNGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKL DPFG KTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQK+TRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLG+RPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVAARIAGTAAEAAIMLGDQLASFLNLMEANSDEKSG+LISKKKMHSSDHDKFNDSKGCWHSCYCLNNSEFYDNESSFLPRSKLDWMENNPYQYRSMSIHYLDQPRLNNQHRSLSDDSALDRLSDSREIRQNLSNELIDDVCSTESSSNSHNYVYQNPDLDSNSMR+KSISDHSSR DEETNKYLAVRRISK
Sbjct:    1 MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTISPSSNYSLKSSKEKIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKHYLEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKPDLEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYELINLKKKLEEKELSLMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHKSLKFSKDSNINFYFTILFYHRFWICYIHRDLLTNIFVLFFNCFVLVINRSFFLNFQNRGEEDPATREKVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLLAMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDDHSEDSTEALKAELRELEKRCTQQALNYEEALLELEALKKTNQRSYFDFHRNGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKLADPFGRKTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKNTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGNRPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVAARIAGTAAEAAIMLGDQLASFLNLMEANSDEKSGSLISKKKMHSSDHDKFNDSKGCWHSCYCLNNSEFYDNESSFLPRSKLDWMENNPYQYRSMSIHYLDQPRLNNQHRSLSDDSALDRLSDSREIRQNLSNELIDDVCSTESSSNSHNYVYQNPDLDSNSMRRKSISDHSSRGDEETNKYLAVRRISK 1196          
BLAST of RIMS binding protein 2 vs. Planmine SMEST
Match: SMESG000001060.1 (SMESG000001060.1)

HSP 1 Score: 1845.86 bits (4780), Expect = 0.000e+0
Identity = 967/977 (98.98%), Postives = 972/977 (99.49%), Query Frame = 3
Query:  168 MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTIXXXXXXXXXXXXXXIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKHSLEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKPNLEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYEYINXXXXXXXXXXXXMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGEEDPATREKVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLLAMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDDHSEDSTXXXXXXXXXXXXXCTQQALNYXXXXXXXXXXKKTNQRSYFDFHRNGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKLTDPFGLKTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKSTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVXXXXXXXXXXXXIMLGDQLASFLNLMEA 3098
            MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTISPSSNYSLKSSKEKIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKH LEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKP+LEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYE INLKKKLEEK+LSLMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGEEDPATREKVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLLAMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDDHSEDSTEALKAELRELEKRCTQQALNYEEALLELEALKKTNQRSYFDFHRNGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKL DPFG KTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQK+TRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLG+RPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVAARIAGTAAEAAIMLGDQLASFLNL+E 
Sbjct:    1 MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTISPSSNYSLKSSKEKIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKHYLEVKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKPDLEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPIDQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYELINLKKKLEEKELSLMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGEEDPATREKVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKLSKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLLAMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDDHSEDSTEALKAELRELEKRCTQQALNYEEALLELEALKKTNQRSYFDFHRNGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKLADPFGRKTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSACNKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKNTRVVRWKVPQIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVRSVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRHTVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNNCAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGNRPGKFVVKWVCPQLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQNLLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVAARIAGTAAEAAIMLGDQLASFLNLVET 977          
The following BLAST results are available for this feature:
BLAST of RIMS binding protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TSPOAP11.710e-3039.26TSPO associated protein 1 [Source:HGNC Symbol;Acc:... [more]
TSPOAP11.847e-3039.26TSPO associated protein 1 [Source:HGNC Symbol;Acc:... [more]
RIMBP28.770e-2226.53RIMS binding protein 2 [Source:HGNC Symbol;Acc:HGN... [more]
RIMBP22.082e-2126.53RIMS binding protein 2 [Source:HGNC Symbol;Acc:HGN... [more]
RIMBP22.101e-2126.53RIMS binding protein 2 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of RIMS binding protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rimb-13.718e-2629.35RIM Binding protein [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of RIMS binding protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbp1.168e-2930.58gene:FBgn0262483 transcript:FBtr0433497[more]
Rbp1.231e-2930.58gene:FBgn0262483 transcript:FBtr0433495[more]
Rbp1.267e-2930.58gene:FBgn0262483 transcript:FBtr0304826[more]
Rbp1.269e-2930.58gene:FBgn0262483 transcript:FBtr0304827[more]
Rbp1.438e-2930.58gene:FBgn0262483 transcript:FBtr0433493[more]
back to top
BLAST of RIMS binding protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIMBP23.500e-2126.16si:ch73-287m6.1 [Source:ZFIN;Acc:ZDB-GENE-100920-2... [more]
si:ch211-105f12.23.882e-2156.63si:ch211-105f12.2 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
RIMBP24.209e-2126.16si:ch73-287m6.1 [Source:ZFIN;Acc:ZDB-GENE-100920-2... [more]
RIMBP24.958e-2126.16si:ch73-287m6.1 [Source:ZFIN;Acc:ZDB-GENE-100920-2... [more]
rimbp25.872e-2152.88RIMS binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of RIMS binding protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep1282.398e-2126.24centrosomal protein 128kDa [Source:Xenbase;Acc:XB-... [more]
cep1282.636e-2126.24centrosomal protein 128kDa [Source:Xenbase;Acc:XB-... [more]
cep1283.038e-2126.24centrosomal protein 128kDa [Source:Xenbase;Acc:XB-... [more]
znf3847.386e-2069.70zinc finger protein 384 [Source:Xenbase;Acc:XB-GEN... [more]
znf3841.028e-1969.70zinc finger protein 384 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of RIMS binding protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tspoap12.818e-3239.00TSPO associated protein 1 [Source:MGI Symbol;Acc:M... [more]
Tspoap19.562e-3138.59TSPO associated protein 1 [Source:MGI Symbol;Acc:M... [more]
Tspoap11.006e-3038.59TSPO associated protein 1 [Source:MGI Symbol;Acc:M... [more]
Rimbp24.874e-2071.88RIMS binding protein 2 [Source:MGI Symbol;Acc:MGI:... [more]
Rimbp24.874e-2071.88RIMS binding protein 2 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of RIMS binding protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7TNF8|RIMB1_MOUSE6.689e-3038.59Peripheral-type benzodiazepine receptor-associated... [more]
sp|O95153|RIMB1_HUMAN8.213e-3039.26Peripheral-type benzodiazepine receptor-associated... [more]
sp|Q9JIR0|RIMB1_RAT2.413e-2838.98Peripheral-type benzodiazepine receptor-associated... [more]
sp|O15034|RIMB2_HUMAN4.212e-2126.53RIMS-binding protein 2 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q8QFX1|RIMB2_CHICK2.619e-1926.43RIMS-binding protein 2 OS=Gallus gallus OX=9031 GN... [more]
back to top
BLAST of RIMS binding protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D2M62.645e-4235.20Peripheral-type benzodiazepine receptor-associated... [more]
A0A5K4F7U38.571e-4233.98Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4F4J29.684e-4233.98Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
G4LWB53.545e-4034.50Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A094ZIQ39.916e-3933.23Peripheral-type benzodiazepine receptor-associated... [more]
back to top
BLAST of RIMS binding protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rimbp25.677e-2171.88RIMS binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
si:ch73-287m6.17.143e-2127.80pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000046190.12.049e-2067.16pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000016473.22.403e-2067.16pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of RIMS binding protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch73-287m6.18.280e-1964.18RIMS binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000002923.11.740e-1353.13pep scaffold:Pmarinus_7.0:GL485378:6628:11246:-1 g... [more]
back to top
BLAST of RIMS binding protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIMS binding protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO396505.311e-1545.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342491.437e-1042.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RIMS binding protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000013898.23.889e-3037.55TSPO associated protein 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000045063.14.318e-3037.55TSPO associated protein 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000045084.16.451e-2063.77TSPO associated protein 1 [Source:NCBI gene;Acc:10... [more]
si:ch73-287m6.19.424e-2067.69RIMS-binding protein 2 [Source:NCBI gene;Acc:10117... [more]
si:ch73-287m6.11.007e-1967.69RIMS-binding protein 2 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of RIMS binding protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001060.10.000e+097.10SMESG000001060.1[more]
SMESG000001060.10.000e+097.63SMESG000001060.1[more]
SMESG000001060.10.000e+096.14SMESG000001060.1[more]
SMESG000001060.10.000e+087.71SMESG000001060.1[more]
SMESG000001060.10.000e+098.98SMESG000001060.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035339 ID=SMED30035339|Name=RIMS binding protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=5610bp
TCTAAAGTGAATAACGTTTAAATTATTATATATTTGATTTTCTTTAAATT
ATTTATATATGAAAATCGCAAATATTTATGGTTGACAATTGATATCAAAT
CCAATTTTAGTCTTATTACTTTAATCCGTTGGTATCTTGAAGAAGTAATA
TAATATCGATCTACAAAATGGACAGCGACGTTGACGCCGACATTCCAGTG
AGAATAAAACCAACTAAAAAGCCACAAAGCAATGAAATTAAATCTCCGCT
TTTTTCACCATTTTCCTCCGGCAATATTCGCTCTCAAAATACGATTTCGC
CAAGCTCTAACTATTCCCTGAAATCTTCAAAAGAAAAAATCGATATAACG
GAAATTCGAAGAATTTTAATGAAATTAAAATCCGAAATCGAGCAAGAAAA
GAAACGAAATCACGAATTAATTGAGCAAAATATGAAGGAATTAAATCATC
AAAAACATTCTCTAGAAGTCAAACACAATAAAGCGATAGAACAATTAAAT
CTATCATGGAAAACGAAATTTGACGATCTCACAAAAATCAACAATAATCA
TATTTCGGAATTAAGTAAATTAAAACAAAAAATTACAGATTTATCAAGAT
CTCCATCGAAACCCAATTTAGAAATACCTGATATGGACCATGTAGTAGCG
AAGATCAACGAATTTTGTAACTTGGAGAGTAATAATTTCAGCAATACTGA
AGAACTTGTCAAAATAATAAACGATTTAAATCATTTGGTTAAAGGCCGAA
TGCCAAATCAGCCAATTGATCAAGACAGCAATGAGATGAAAATCGCAAAA
CTGAAAAATCAAAATACAGAACTGACCAACATTGTGAAAATTTTAGATCG
TAAATTGAAAACCAGTCAATATGAATATATAAACCTAAAGAAAAAACTTG
AAGAAAAAGATCTTAGTTTGATGAATGAGCTTGTAACAGAAAGACCTGAT
GAAAGTAAATTTGATTTCGAAACAATGTTGAAAAGAGCCAATTCGGAAAG
ATTATTGCTAGAAAAACAGCTAACATGGCTGCATAATCGCGGCGAAGAAG
ATCCAGCAACTCGGGAAAAAGTTGAAACTTTAACCATTTTCGTGAAATCG
TTTCAAAAGAATCAAAAGCTTCTTGAAGACCAATTATCTGTATTGAGAGA
TAAATCAAACAAAACTGAAAATTATATCAATGAAATTTCAGTGCTCAAGA
TTGAAAATGAAAAATTGAGTAAGAAAGTCCTTGACAATTCTACGATTCAG
AAAAATTACGAAAAATTGAAAATCGAAATCGAATCAAATCAAATTAGAGA
TCAAGAGAACTTAATTAAAATCAAATCTCTGGAAATTCTCAGCGAAGAAT
ACAAAACAAAATTGCTTGCTATGGATCGATTGTTAAAATACATTCGAGAA
ATCAGTGACAAACGAACGGAATTAGAAATGGAATATGCCGCTATGAAAGC
ACTTCTCGAGACTAAATTGCGAAATGATTTCACAAAAAGAGAAACTAATA
CGTCAAGTCGAGATGATCACTCAGAAGACAGCACTGAAGCCTTAAAAGCT
GAATTACGAGAATTGGAAAAGAGGTGCACTCAGCAGGCTTTAAATTATGA
AGAAGCTCTTTTAGAACTTGAAGCTTTGAAAAAAACAAATCAACGCAGCT
ATTTCGATTTTCATAGAAATGGTTCCAAAGACGATTTAGCTTGGCTTTTA
CAGTTAATGACAAATTATTCAAAGGAAAAAAATATCCATAATTCTGGAAG
CTCAAGTGTTACAGATGAATTTAACGGCTTTCATAGAGACGAATTCAGTA
AACTGACGGATCCTTTCGGACTGAAAACTATTCTTCAAAATAAAACGGAT
GAAAAAAATGATATCAAAAGAGAAACCGCGATTTTCGGAAGATCAGATAC
TGTATCTTCAACAACTGAAAATGAAAATAAAATTTTACCTTCACTACAAA
CGAGCAATTCAGCTTGCAATAAGGATTACGGTGAAACGCCCAATAATGAA
TTGGGTTTTAATACAAATCTTGAATCGCAGAGAAAACATATTCCTGCTCC
AACTCAAATAAAAATTGAAAACCATCTAAATCAAAAGAGTACAAGGGTAG
TAAGATGGAAAGTTCCTCAAATTGATGTGAATATAGATAAATGTAATATT
ACTGCCTTTCATATTTATGTCGATGGTCACTTTTATAAAGCCGTAAGCAT
AAATGAAACTTTAGCAGCAGTTTTACCAAATCTTGATTTAAAAAGACCTC
ATAGAATCGCTGTTCGATCAGTTTGTTCTCAAGGTCAATCTAAGGATGCT
CAATGTACAATTGAAATAGGATCATTTAGCTTGGCTCCTAGTCACTTGAA
AGCCAATAAAATCACGGGAAATTCAGCGCAAATCAGCTGGATCCCATCCA
ATTCTAATTGGCGGCACACAGTATGGGTCAATGGGTCAAAGTATTGCGAT
TGTATACCTGGAATTTACAAAATTGTTATGCAAGGGCTTCAACCTGATAA
CTTGCAAAAAGTTCAGGTTCACCCAGTCATTGACAAATTTGTTGATAATT
CTCCAAATTCAAATAATTGTGCTTTCTTGGATTTTCAAACTCTTCCTATT
TACAATTCTAGTTCAGAAGGAATTCAAAAACCAACAGATGAGATAGATTA
TCCAACCGATGTCAAATTGAAACTTGGTAGCAGACCTGGAAAGTTCGTTG
TGAAATGGGTTTGTCCACAATTAGTTACATCTCCTAATATAAAAATTGTT
GGATATTCTATACTCATTAACAACCAATGTATAGCCTTGGTAAATGGGGC
AAAAAATGATAGATTTTCTATTGGCCTTCTTGATTTAAGAACCATTAATC
CTCCCGTGTCTCAGAATCTCCTTAGTCAACATGACCAATCATATCTTCCT
CTGACCGTTCGAACAATGGCCACTGTAACTCAGTCAAACTTTGATTCTGC
TGTCACAGAATGCACTATATATTCTAAGGACAGCCAACCAATTTTAAGAT
TTTCTGGACACGTTGCCGCCAGGATTGCTGGCACTGCTGCCGAAGCAGCT
ATAATGTTGGGTGATCAGTTAGCATCCTTTTTAAATTTGATGGAAGCCAA
CTCAGATGAAAAATCAGGAAATTTGATTTCAAAGAAAAAGATGCACTCGT
CTGATCACGATAAATTCAACGATTCAAAAGGTTGTTGGCACAGTTGTTAC
TGTTTAAATAACTCTGAATTTTATGATAACGAGTCGTCGTTTTTACCTCG
ATCAAAACTTGACTGGATGGAAAATAATCCTTATCAATATCGGTCTATGT
CAATTCATTATCTCGATCAGCCTCGACTTAATAATCAACACCGATCACTT
TCTGACGATAGTGCCCTTGATCGCCTATCGGATAGTAGGGAAATTCGACA
GAATCTGTCGAATGAACTAATTGACGATGTCTGCTCAACTGAATCTTCGA
GCAATTCGCACAACTATGTCTATCAGAATCCCGACCTCGACTCTAACAGT
ATGCGTCAAAAGTCAATCTCTGATCATTCAAGTCGAAGGGACGAGGAAAC
CAATAAATATTTGGCCGTCAGGCGCATTTCTAAGCAAACTCAATCTCCAA
AAATTTCCAAGGAATATCCACAAGCAAAGATTTCAGTGCCTAAAATTCAA
ATCACAAAAGACAGCAGTTTCTCAGAAGATGATGATAATCCTTCAATTAT
GTCTTATAGGAATAAAGGTCGCTCTATGGGTGATCAGTATGGGAAAATCA
GTCAGCAACAGAAACCCGTTTCCCGTGAGCAAGGAGAACACAAATCTCGA
TCTAATTCAACAATTGATGAATCAGTAGGAATAAAGAATAAAAATTATCC
TATTTCCCCAAATGATAGAATAAATAATCAAAACCAATGGAATCAAAATT
ACAATCAAGATCGAATTAATAATATAAATAATGAAAGATATAATAATTAT
TCTCATCAAAAGTCAGCAGAAAATATTCGTTATTTTGTGGCTCTTTTTGA
CTACGATCCAGCAACAATGTCTCCGAATTCCGGTGCGATTCATGAAGAAT
TGCCTTTTAAATCTGGTCAAAATATAAAGGTTTTTGGTCAAGTTGATGAA
GATGGATTTTATACTGGTGAAACGAATGGCCGGAGAGGCCTTGTCCCATC
AAATATGGTCAGTGAAATTGATGTAAAGAGTACATTTAAACCTATCGACA
ATTCTGAAATTACATTCCAAGAAAGAATTATAGGTTCAATTGATAGAAAT
AAAGATTCTACTATAAGTAGATCTCTTCAAGGAAAATTGAATATTGACCA
ATATCCCATAGTGTCACAATCTGACTACCAAAATAATCCAAATCAGTATT
CTTATAATGATTACCCCATGATTCATAGAAAAAGTACTGATAGTGCAGTT
AGTTATGCAGCATCTGATCCGAATTCATATCAAAGATCTCAAGTAGATAC
TTACATGCCTCGTCAGCCTTCAGCGGGAAACTCGAGAAACCCTACAGAAT
ATAGAAAAATGCTAGCCTTATATGACTATGATCCTCAAACATTAAGTCCT
AATGTTGATTCAGACGCGGAATTGGCATTTAAATGCAATGACATAATTGA
AATAATCGGGGAAATTGATGAAGACGGATTTTACATGGGTCGAAAAAACG
GCCAACGAGGTTTGGTACCTTCTAATTTTTTAACAGACCTTCCACCTCCG
CTGGAAACTCGAGTACGAACTCAGCCAAGTTATCAAGGCAGTTTTGACAA
TATGCATAATCCCAATCAGTACAAAGAAAGAAATTTCCAAGCAGTTTCAA
ATTTTCCAGAGCCTCCGCCAAATAGAGACAATCGTGTAAGAACGAAACCA
TTTGAAATCGAAAGATCTTTAATACGAAACACATCCGCTAATAATGATGA
GTATTTAAATGAAAGAGTGTCACTTCCAGATGCACAGAAAAATAATCCGA
GCTTTGAAGAAAGTTTCGATAGTGGGCCTTCAGTATCACGGCCGTACATG
GTTAAGTCAGAACCAAAACCAAATCCTTATCACAATACTGCCCCAAGAAT
GTCGATTCATGAACAAAACACTGACAATAAAGGAATGATGTACTCAAATT
CCGGATCACCAAGCAGCAAAATGCCAAATCGTTCAAACAAACCCATAACC
GATCGTAGAAGTAGTCACGACAAACCGATTCACAGAAATCAACAACCACA
AAATGTTCCTATGAGGGATCTTTCTCCACCGCCTCCGTTAGAAGCGGACG
ACATGCCGATTGTGATGGATTTGGCACCGTCAAAGGAAACTCAGAAGAAA
AAGAAAGTTTCGACAAATTCAGAAAATTATCGTTCAAATGCTTTTGAAAA
TCAAGAGAATTATGGAAACAACGAAAGTCTTTATGTCAACACGAATTCAG
TCATGTCAGATAATTTAGAAAGAAAACGATCTGTTTTTAAAAATCCTTTT
AAGAAAAAGAAATCCTGATAATCCTCTCTTTTATTTCTCTCTCTCTGTCT
CTTTATTTATCTTAATGAACTTATTCATTTTAAACAAAGATTTATCATTT
CAAATTATTATCATTCCATATATTATTAAAGGTTCTAAATTTGAATTTTT
AATGTTACCG
back to top

protein sequence of SMED30035339-orf-1

>SMED30035339-orf-1 ID=SMED30035339-orf-1|Name=SMED30035339-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1767bp
MDSDVDADIPVRIKPTKKPQSNEIKSPLFSPFSSGNIRSQNTISPSSNYS
LKSSKEKIDITEIRRILMKLKSEIEQEKKRNHELIEQNMKELNHQKHSLE
VKHNKAIEQLNLSWKTKFDDLTKINNNHISELSKLKQKITDLSRSPSKPN
LEIPDMDHVVAKINEFCNLESNNFSNTEELVKIINDLNHLVKGRMPNQPI
DQDSNEMKIAKLKNQNTELTNIVKILDRKLKTSQYEYINLKKKLEEKDLS
LMNELVTERPDESKFDFETMLKRANSERLLLEKQLTWLHNRGEEDPATRE
KVETLTIFVKSFQKNQKLLEDQLSVLRDKSNKTENYINEISVLKIENEKL
SKKVLDNSTIQKNYEKLKIEIESNQIRDQENLIKIKSLEILSEEYKTKLL
AMDRLLKYIREISDKRTELEMEYAAMKALLETKLRNDFTKRETNTSSRDD
HSEDSTEALKAELRELEKRCTQQALNYEEALLELEALKKTNQRSYFDFHR
NGSKDDLAWLLQLMTNYSKEKNIHNSGSSSVTDEFNGFHRDEFSKLTDPF
GLKTILQNKTDEKNDIKRETAIFGRSDTVSSTTENENKILPSLQTSNSAC
NKDYGETPNNELGFNTNLESQRKHIPAPTQIKIENHLNQKSTRVVRWKVP
QIDVNIDKCNITAFHIYVDGHFYKAVSINETLAAVLPNLDLKRPHRIAVR
SVCSQGQSKDAQCTIEIGSFSLAPSHLKANKITGNSAQISWIPSNSNWRH
TVWVNGSKYCDCIPGIYKIVMQGLQPDNLQKVQVHPVIDKFVDNSPNSNN
CAFLDFQTLPIYNSSSEGIQKPTDEIDYPTDVKLKLGSRPGKFVVKWVCP
QLVTSPNIKIVGYSILINNQCIALVNGAKNDRFSIGLLDLRTINPPVSQN
LLSQHDQSYLPLTVRTMATVTQSNFDSAVTECTIYSKDSQPILRFSGHVA
ARIAGTAAEAAIMLGDQLASFLNLMEANSDEKSGNLISKKKMHSSDHDKF
NDSKGCWHSCYCLNNSEFYDNESSFLPRSKLDWMENNPYQYRSMSIHYLD
QPRLNNQHRSLSDDSALDRLSDSREIRQNLSNELIDDVCSTESSSNSHNY
VYQNPDLDSNSMRQKSISDHSSRRDEETNKYLAVRRISKQTQSPKISKEY
PQAKISVPKIQITKDSSFSEDDDNPSIMSYRNKGRSMGDQYGKISQQQKP
VSREQGEHKSRSNSTIDESVGIKNKNYPISPNDRINNQNQWNQNYNQDRI
NNINNERYNNYSHQKSAENIRYFVALFDYDPATMSPNSGAIHEELPFKSG
QNIKVFGQVDEDGFYTGETNGRRGLVPSNMVSEIDVKSTFKPIDNSEITF
QERIIGSIDRNKDSTISRSLQGKLNIDQYPIVSQSDYQNNPNQYSYNDYP
MIHRKSTDSAVSYAASDPNSYQRSQVDTYMPRQPSAGNSRNPTEYRKMLA
LYDYDPQTLSPNVDSDAELAFKCNDIIEIIGEIDEDGFYMGRKNGQRGLV
PSNFLTDLPPPLETRVRTQPSYQGSFDNMHNPNQYKERNFQAVSNFPEPP
PNRDNRVRTKPFEIERSLIRNTSANNDEYLNERVSLPDAQKNNPSFEESF
DSGPSVSRPYMVKSEPKPNPYHNTAPRMSIHEQNTDNKGMMYSNSGSPSS
KMPNRSNKPITDRRSSHDKPIHRNQQPQNVPMRDLSPPPPLEADDMPIVM
DLAPSKETQKKKKVSTNSENYRSNAFENQENYGNNESLYVNTNSVMSDNL
ERKRSVFKNPFKKKKS*
back to top
Aliases
The feature 'RIMS binding protein 2' has the following synonyms
Synonym
Smed_14471
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0010923negative regulation of phosphatase activity
GO:0007269neurotransmitter secretion
GO:0008150biological_process
GO:0014047glutamate secretion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001452SH3_domain
IPR011511SH3_2
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0030156benzodiazepine receptor binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005829cytosol
GO:0098793presynapse