LLGL scribble cell polarity complex component 2

Overview
NameLLGL scribble cell polarity complex component 2
Smed IDSMED30035336
Length (bp)4995
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LLGL scribble cell polarity complex component 2 (SMED30035336) t-SNE clustered cells

Violin plots show distribution of expression levels for LLGL scribble cell polarity complex component 2 (SMED30035336) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LLGL scribble cell polarity complex component 2 (SMED30035336) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LLGL scribble cell polarity complex component 2 (SMED30035336) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035336

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynx progenitor cellSMED30035336SMESG000018172.1 SMED30035336smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035336SMESG000018172.1 Contig51268newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035336SMESG000018172.1 Contig51268uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30035336SMESG000018172.1 dd_Smed_v4_2164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035336SMESG000018172.1 dd_Smed_v4_2164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035336SMESG000018172.1 dd_Smed_v4_2164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30035336SMESG000018172.1 dd_Smed_v4_2164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30035336SMESG000018172.1 dd_Smed_v4_2164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035336SMESG000018172.1 dd_Smed_v4_2164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035336SMESG000018172.1 dd_Smed_v4_2164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035336SMESG000018172.1 dd_Smed_v4_2164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035336SMESG000018172.1 dd_Smed_v4_2164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035336SMESG000050419.1 SMESG000018172.1 Contig39115newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035336SMESG000050419.1 SMESG000018172.1 Contig39115uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035336SMESG000018172.1 Contig42409newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035336SMESG000018172.1 Contig42409uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30035336SMESG000018172.1 OX_Smed_1.0.20362ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neuronSMED30035336SMESG000018172.1 dd_Smed_v6_2164_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30035336SMESG000018172.1 dd_Smed_v6_2164_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30035336SMESG000018172.1 dd_Smed_v6_2164_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30035336SMESG000018172.1 dd_Smed_v6_2164_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neural progenitor cellSMED30035336SMESG000018172.1 dd_Smed_v6_2164_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30035336SMESG000018172.1 dd_Smed_v6_2164_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30035336SMESG000018172.1 dd_Smed_v6_2164_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30035336SMESG000018172.1 dd_Smed_v4_2164_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Human
Match: LLGL1 (LLGL scribble cell polarity complex component 1 [Source:HGNC Symbol;Acc:HGNC:6628])

HSP 1 Score: 81.6481 bits (200), Expect = 9.943e-15
Identity = 76/314 (24.20%), Postives = 131/314 (41.72%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFK--------NWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSN----GISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGT--DNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNY--------IVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            PYL+  ++S IT    +  VP  L+    +  E           +WP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ +F       ++ +Q+        ++VGC    S+D  L +  + L  ++              +   + G VLV +      +    +  I    D+EG  W   E         +S +   L +        +V+  P   VTA+     W  ++ G ++G  L D+ +   V +  T+      S A + PL+  + LKKS+RQSFR+++K +
Sbjct:  385 PYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQSPQPVSSALSWPITGGRNLAQEPSQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGLFQTDCEHADSLAQAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQ-----------MVVAGTAGQVLVLELSDVPVEQAVSVAIIDLLQDREGFTWKGHE--------RLSPRTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTEWSLVAFGTSHGFGLFDYQRKSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSR 671          

HSP 2 Score: 57.3806 bits (137), Expect = 2.945e-7
Identity = 49/191 (25.65%), Postives = 86/191 (45.03%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVV-GSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYD-------LGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            FD EL + A+GT+ G +KIYG+PG+ +T ++     +  + FL GQGRL+S+ +++ + LWE         +  ++S       G          F   +    L  + VV   + + I  +   G+   F D   L++     ++  + L    D       LG V+ +Q +    +   I YS G+L+I
Sbjct:   42 FDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPG----------FDGASAPLSLTRVTVVLLVAASDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTKILIGYSRGLLVI 222          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Human
Match: LLGL1 (LLGL scribble cell polarity complex component 1 [Source:HGNC Symbol;Acc:HGNC:6628])

HSP 1 Score: 81.6481 bits (200), Expect = 9.943e-15
Identity = 76/314 (24.20%), Postives = 131/314 (41.72%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFK--------NWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSN----GISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGT--DNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNY--------IVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            PYL+  ++S IT    +  VP  L+    +  E           +WP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ +F       ++ +Q+        ++VGC    S+D  L +  + L  ++              +   + G VLV +      +    +  I    D+EG  W   E         +S +   L +        +V+  P   VTA+     W  ++ G ++G  L D+ +   V +  T+      S A + PL+  + LKKS+RQSFR+++K +
Sbjct:  385 PYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQSPQPVSSALSWPITGGRNLAQEPSQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGLFQTDCEHADSLAQAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQ-----------MVVAGTAGQVLVLELSDVPVEQAVSVAIIDLLQDREGFTWKGHE--------RLSPRTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTEWSLVAFGTSHGFGLFDYQRKSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSR 671          

HSP 2 Score: 57.3806 bits (137), Expect = 2.945e-7
Identity = 49/191 (25.65%), Postives = 86/191 (45.03%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVV-GSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYD-------LGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            FD EL + A+GT+ G +KIYG+PG+ +T ++     +  + FL GQGRL+S+ +++ + LWE         +  ++S       G          F   +    L  + VV   + + I  +   G+   F D   L++     ++  + L    D       LG V+ +Q +    +   I YS G+L+I
Sbjct:   42 FDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPG----------FDGASAPLSLTRVTVVLLVAASDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTKILIGYSRGLLVI 222          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Human
Match: LLGL1 (LLGL scribble cell polarity complex component 1 [Source:HGNC Symbol;Acc:HGNC:6628])

HSP 1 Score: 76.2554 bits (186), Expect = 5.533e-13
Identity = 77/314 (24.52%), Postives = 130/314 (41.40%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFK--------NWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSN----GISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGT--DNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNY--------IVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            PYL+  ++S IT    +  VP  L+    +  E           +WP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ +F       ++ +Q+        ++VGC    S+D  L +  + L  ++              +   + G VLV +      +    +  I    D+EG  W   E         +S +   L +        +V+  P   VTA+     W  ++ G ++G  L+D      VF   T+      S A + PL+  + LKKS+RQSFR+++K +
Sbjct:  385 PYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQSPQPVSSALSWPITGGRNLAQEPSQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGLFQTDCEHADSLAQAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQ-----------MVVAGTAGQVLVLELSDVPVEQAVSVAIIDLLQDREGFTWKGHE--------RLSPRTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTEWSLVAFGTSHGFGLLD-----PVFPRCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSR 666          

HSP 2 Score: 57.3806 bits (137), Expect = 2.567e-7
Identity = 49/191 (25.65%), Postives = 86/191 (45.03%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVV-GSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYD-------LGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            FD EL + A+GT+ G +KIYG+PG+ +T ++     +  + FL GQGRL+S+ +++ + LWE         +  ++S       G          F   +    L  + VV   + + I  +   G+   F D   L++     ++  + L    D       LG V+ +Q +    +   I YS G+L+I
Sbjct:   42 FDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPG----------FDGASAPLSLTRVTVVLLVAASDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTKILIGYSRGLLVI 222          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Human
Match: LLGL1 (LLGL scribble cell polarity complex component 1 [Source:HGNC Symbol;Acc:HGNC:6628])

HSP 1 Score: 76.2554 bits (186), Expect = 5.533e-13
Identity = 77/314 (24.52%), Postives = 130/314 (41.40%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFK--------NWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSN----GISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGT--DNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNY--------IVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            PYL+  ++S IT    +  VP  L+    +  E           +WP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ +F       ++ +Q+        ++VGC    S+D  L +  + L  ++              +   + G VLV +      +    +  I    D+EG  W   E         +S +   L +        +V+  P   VTA+     W  ++ G ++G  L+D      VF   T+      S A + PL+  + LKKS+RQSFR+++K +
Sbjct:  385 PYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQSPQPVSSALSWPITGGRNLAQEPSQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGLFQTDCEHADSLAQAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQ-----------MVVAGTAGQVLVLELSDVPVEQAVSVAIIDLLQDREGFTWKGHE--------RLSPRTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTEWSLVAFGTSHGFGLLD-----PVFPRCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSR 666          

HSP 2 Score: 57.3806 bits (137), Expect = 2.567e-7
Identity = 49/191 (25.65%), Postives = 86/191 (45.03%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVV-GSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYD-------LGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            FD EL + A+GT+ G +KIYG+PG+ +T ++     +  + FL GQGRL+S+ +++ + LWE         +  ++S       G          F   +    L  + VV   + + I  +   G+   F D   L++     ++  + L    D       LG V+ +Q +    +   I YS G+L+I
Sbjct:   42 FDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPG----------FDGASAPLSLTRVTVVLLVAASDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTKILIGYSRGLLVI 222          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Human
Match: LLGL2 (LLGL scribble cell polarity complex component 2 [Source:HGNC Symbol;Acc:HGNC:6629])

HSP 1 Score: 68.5514 bits (166), Expect = 9.771e-11
Identity = 90/372 (24.19%), Postives = 153/372 (41.13%), Query Frame = 1
Query: 1354 FNLTILMAHSNEKNILIVLKDDSKSTEIKTPSNIVDF-VLTTNNFSELSKQSHTLLILCESQLXXXXXXXXXXXXXXCPYLSLNNTSHITSLTSIIQVPPSLFPN----ASTVNELFKN--WPFRNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS-----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIR 2424
            F   +  A   +++ + V+ D  + T     S ++ F VLT  + +      + L++L E +L+ ID+++     +  PYL+  + S IT    +  +P  L+       S  N  F    WP                 D+  +GH DGT++ W    SGV L LL K+ +  +F    ++ N    + G       ++VG     S+D  L I  I L  +S            +     + G VLV + +    +  + ++ A+   D+EG  W   E     S     E       +V+  P   VT+LA    W  ++ G ++G  L D  Q + VF   T+    + +  G  PL+  + LKKS+R
Sbjct:  300 FQGGMPRASYGDRHCISVIHD-GQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNAHFSTMEWPIDGGTSLTPAPPQR---DLLLTGHEDGTVRFWDA--SGVCLRLLYKLSTVRVF-LTDTDPNENFSAQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSG-----------YLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKGHERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEG--PLSRVKSLKKSLR 651          

HSP 2 Score: 64.3142 bits (155), Expect = 2.397e-9
Identity = 43/187 (22.99%), Postives = 92/187 (49.20%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKI-TAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQD---LDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            +   L + A+GT+ G IK+YG+PG+ +  ++     +  +  L GQ +L+++ ++N + LW  K++    E+    S +     G   +A  I+      +      ELL +G+ +  +F + +      F   +D +I SD V+ ++ +     + +++  V+ +Q +P   +   I YS G+++I
Sbjct:   40 YSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSC-----ELLYLGTESGNVFVVQLPA----FRALEDRTISSDAVLQRLPEEARHRRVFEM--VEALQEHPRDPNQILIGYSRGLVVI 215          

HSP 3 Score: 54.6842 bits (130), Expect = 1.618e-6
Identity = 25/67 (37.31%), Postives = 39/67 (58.21%), Query Frame = 1
Query: 2788 SSNKVPCLFAGTNAGAIFAFEISF---EDNTDEMVKVKLSKELHLQHKAPILLLSITNSNHVPFINP 2979
            SS   P L+AGTN G I+AF +     E   DE V+ + +KE+ L H+AP++ + + + + VP   P
Sbjct:  726 SSRHCPSLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHSVPLPEP 792          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0078166)

HSP 1 Score: 72.0182 bits (175), Expect = 5.040e-12
Identity = 70/277 (25.27%), Postives = 125/277 (45.13%), Query Frame = 1
Query: 1693 NWPFRN----ENCANEKHEDEL-LIDIFGSGHADGTIKIWQVLPSGVL-NLLIKVESSEIFHQ-------AVSEVNACSQSNGIS--KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLS------STDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            +WP       +N      ED   L +I  +GH DG++K W    +GVL   +   ++S IF         A ++++A     G    ++ G     S+D  L +  I            P   +L  + G + G +++  +     K  L  IS N   D++G +W   +   + S      +   +E+  N++ ++++ P   +T +A + +W  +S G  +GLVL DF     VF   T+   +  + AG+  L+  +  KKS+R+SFRKL+K +
Sbjct:  403 SWPITGGTLPDNLEESVEEDATKLYEILLTGHEDGSVKFWDC--TGVLLKPIYNFKTSSIFGSESDFRDDAAADMSAEQVDEGEPPFRKSGLFDPYSDDPRLAVKKIAFC---------PKTGQL--IVGGTAGQIVIADFIDLPEKVSLKYISMNLVSDRDGFVWKGHDQLNVRSNLLDGEAIPTTERGVNISGVLQVLPPASITCMALEASWGLVSGGTAHGLVLFDFKNFVPVFHRCTLNP-NDLTGAGEQ-LSRRKSFKKSLRESFRKLRKGR 664          

HSP 2 Score: 54.299 bits (129), Expect = 1.253e-6
Identity = 45/189 (23.81%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGI----AYTLINSPLKPIN--FLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            +D  L L A+GT+ G +K++G PG+     +TL+N+    +N   L+++ G GR++S+   N++ LWE     +T   I ++     +   K++++  S S           +LL +G+    I+Q+       H +   +  I  D V+ ++    K  + G ++ I+  P+  S   ++Y+ G+ ++
Sbjct:   35 YDPVLKLMAIGTQTGALKVFGQPGVELYGQHTLLNNSASELNVQLLEWVYGTGRILSLTAANQLILWEPV--GATLLPIKTLPFDGKLK--KVSSLCCSLS----------KDLLWIGTEGGNIYQL-----DLHTFTIKEPVIYHDVVLEQVPPAYK-LNPGAIESIRQLPNSPSKLLVAYNRGLCVL 203          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0306592)

HSP 1 Score: 72.0182 bits (175), Expect = 5.271e-12
Identity = 70/277 (25.27%), Postives = 125/277 (45.13%), Query Frame = 1
Query: 1693 NWPFRN----ENCANEKHEDEL-LIDIFGSGHADGTIKIWQVLPSGVL-NLLIKVESSEIFHQ-------AVSEVNACSQSNGIS--KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLS------STDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            +WP       +N      ED   L +I  +GH DG++K W    +GVL   +   ++S IF         A ++++A     G    ++ G     S+D  L +  I            P   +L  + G + G +++  +     K  L  IS N   D++G +W   +   + S      +   +E+  N++ ++++ P   +T +A + +W  +S G  +GLVL DF     VF   T+   +  + AG+  L+  +  KKS+R+SFRKL+K +
Sbjct:  411 SWPITGGTLPDNLEESVEEDATKLYEILLTGHEDGSVKFWDC--TGVLLKPIYNFKTSSIFGSESDFRDDAAADMSAEQVDEGEPPFRKSGLFDPYSDDPRLAVKKIAFC---------PKTGQL--IVGGTAGQIVIADFIDLPEKVSLKYISMNLVSDRDGFVWKGHDQLNVRSNLLDGEAIPTTERGVNISGVLQVLPPASITCMALEASWGLVSGGTAHGLVLFDFKNFVPVFHRCTLNP-NDLTGAGEQ-LSRRKSFKKSLRESFRKLRKGR 672          

HSP 2 Score: 54.299 bits (129), Expect = 1.331e-6
Identity = 45/190 (23.68%), Postives = 93/190 (48.95%), Query Frame = 1
Query:  199 CFDNELYLFAVGTKKGEIKIYGSPGI----AYTLINSPLKPIN--FLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
             +D  L L A+GT+ G +K++G PG+     +TL+N+    +N   L+++ G GR++S+   N++ LWE     +T   I ++     +   K++++  S S           +LL +G+    I+Q+       H +   +  I  D V+ ++    K  + G ++ I+  P+  S   ++Y+ G+ ++
Sbjct:   42 AYDPVLKLMAIGTQTGALKVFGQPGVELYGQHTLLNNSASELNVQLLEWVYGTGRILSLTAANQLILWEPV--GATLLPIKTLPFDGKLK--KVSSLCCSLS----------KDLLWIGTEGGNIYQL-----DLHTFTIKEPVIYHDVVLEQVPPAYK-LNPGAIESIRQLPNSPSKLLVAYNRGLCVL 211          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0306590)

HSP 1 Score: 72.0182 bits (175), Expect = 5.271e-12
Identity = 70/277 (25.27%), Postives = 125/277 (45.13%), Query Frame = 1
Query: 1693 NWPFRN----ENCANEKHEDEL-LIDIFGSGHADGTIKIWQVLPSGVL-NLLIKVESSEIFHQ-------AVSEVNACSQSNGIS--KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLS------STDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            +WP       +N      ED   L +I  +GH DG++K W    +GVL   +   ++S IF         A ++++A     G    ++ G     S+D  L +  I            P   +L  + G + G +++  +     K  L  IS N   D++G +W   +   + S      +   +E+  N++ ++++ P   +T +A + +W  +S G  +GLVL DF     VF   T+   +  + AG+  L+  +  KKS+R+SFRKL+K +
Sbjct:  411 SWPITGGTLPDNLEESVEEDATKLYEILLTGHEDGSVKFWDC--TGVLLKPIYNFKTSSIFGSESDFRDDAAADMSAEQVDEGEPPFRKSGLFDPYSDDPRLAVKKIAFC---------PKTGQL--IVGGTAGQIVIADFIDLPEKVSLKYISMNLVSDRDGFVWKGHDQLNVRSNLLDGEAIPTTERGVNISGVLQVLPPASITCMALEASWGLVSGGTAHGLVLFDFKNFVPVFHRCTLNP-NDLTGAGEQ-LSRRKSFKKSLRESFRKLRKGR 672          

HSP 2 Score: 54.299 bits (129), Expect = 1.331e-6
Identity = 45/190 (23.68%), Postives = 93/190 (48.95%), Query Frame = 1
Query:  199 CFDNELYLFAVGTKKGEIKIYGSPGI----AYTLINSPLKPIN--FLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
             +D  L L A+GT+ G +K++G PG+     +TL+N+    +N   L+++ G GR++S+   N++ LWE     +T   I ++     +   K++++  S S           +LL +G+    I+Q+       H +   +  I  D V+ ++    K  + G ++ I+  P+  S   ++Y+ G+ ++
Sbjct:   42 AYDPVLKLMAIGTQTGALKVFGQPGVELYGQHTLLNNSASELNVQLLEWVYGTGRILSLTAANQLILWEPV--GATLLPIKTLPFDGKLK--KVSSLCCSLS----------KDLLWIGTEGGNIYQL-----DLHTFTIKEPVIYHDVVLEQVPPAYK-LNPGAIESIRQLPNSPSKLLVAYNRGLCVL 211          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0306589)

HSP 1 Score: 72.0182 bits (175), Expect = 5.271e-12
Identity = 70/277 (25.27%), Postives = 125/277 (45.13%), Query Frame = 1
Query: 1693 NWPFRN----ENCANEKHEDEL-LIDIFGSGHADGTIKIWQVLPSGVL-NLLIKVESSEIFHQ-------AVSEVNACSQSNGIS--KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLS------STDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            +WP       +N      ED   L +I  +GH DG++K W    +GVL   +   ++S IF         A ++++A     G    ++ G     S+D  L +  I            P   +L  + G + G +++  +     K  L  IS N   D++G +W   +   + S      +   +E+  N++ ++++ P   +T +A + +W  +S G  +GLVL DF     VF   T+   +  + AG+  L+  +  KKS+R+SFRKL+K +
Sbjct:  411 SWPITGGTLPDNLEESVEEDATKLYEILLTGHEDGSVKFWDC--TGVLLKPIYNFKTSSIFGSESDFRDDAAADMSAEQVDEGEPPFRKSGLFDPYSDDPRLAVKKIAFC---------PKTGQL--IVGGTAGQIVIADFIDLPEKVSLKYISMNLVSDRDGFVWKGHDQLNVRSNLLDGEAIPTTERGVNISGVLQVLPPASITCMALEASWGLVSGGTAHGLVLFDFKNFVPVFHRCTLNP-NDLTGAGEQ-LSRRKSFKKSLRESFRKLRKGR 672          

HSP 2 Score: 54.299 bits (129), Expect = 1.331e-6
Identity = 45/190 (23.68%), Postives = 93/190 (48.95%), Query Frame = 1
Query:  199 CFDNELYLFAVGTKKGEIKIYGSPGI----AYTLINSPLKPIN--FLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
             +D  L L A+GT+ G +K++G PG+     +TL+N+    +N   L+++ G GR++S+   N++ LWE     +T   I ++     +   K++++  S S           +LL +G+    I+Q+       H +   +  I  D V+ ++    K  + G ++ I+  P+  S   ++Y+ G+ ++
Sbjct:   42 AYDPVLKLMAIGTQTGALKVFGQPGVELYGQHTLLNNSASELNVQLLEWVYGTGRILSLTAANQLILWEPV--GATLLPIKTLPFDGKLK--KVSSLCCSLS----------KDLLWIGTEGGNIYQL-----DLHTFTIKEPVIYHDVVLEQVPPAYK-LNPGAIESIRQLPNSPSKLLVAYNRGLCVL 211          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0306591)

HSP 1 Score: 72.0182 bits (175), Expect = 5.271e-12
Identity = 70/277 (25.27%), Postives = 125/277 (45.13%), Query Frame = 1
Query: 1693 NWPFRN----ENCANEKHEDEL-LIDIFGSGHADGTIKIWQVLPSGVL-NLLIKVESSEIFHQ-------AVSEVNACSQSNGIS--KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLS------STDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            +WP       +N      ED   L +I  +GH DG++K W    +GVL   +   ++S IF         A ++++A     G    ++ G     S+D  L +  I            P   +L  + G + G +++  +     K  L  IS N   D++G +W   +   + S      +   +E+  N++ ++++ P   +T +A + +W  +S G  +GLVL DF     VF   T+   +  + AG+  L+  +  KKS+R+SFRKL+K +
Sbjct:  411 SWPITGGTLPDNLEESVEEDATKLYEILLTGHEDGSVKFWDC--TGVLLKPIYNFKTSSIFGSESDFRDDAAADMSAEQVDEGEPPFRKSGLFDPYSDDPRLAVKKIAFC---------PKTGQL--IVGGTAGQIVIADFIDLPEKVSLKYISMNLVSDRDGFVWKGHDQLNVRSNLLDGEAIPTTERGVNISGVLQVLPPASITCMALEASWGLVSGGTAHGLVLFDFKNFVPVFHRCTLNP-NDLTGAGEQ-LSRRKSFKKSLRESFRKLRKGR 672          

HSP 2 Score: 54.299 bits (129), Expect = 1.331e-6
Identity = 45/190 (23.68%), Postives = 93/190 (48.95%), Query Frame = 1
Query:  199 CFDNELYLFAVGTKKGEIKIYGSPGI----AYTLINSPLKPIN--FLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
             +D  L L A+GT+ G +K++G PG+     +TL+N+    +N   L+++ G GR++S+   N++ LWE     +T   I ++     +   K++++  S S           +LL +G+    I+Q+       H +   +  I  D V+ ++    K  + G ++ I+  P+  S   ++Y+ G+ ++
Sbjct:   42 AYDPVLKLMAIGTQTGALKVFGQPGVELYGQHTLLNNSASELNVQLLEWVYGTGRILSLTAANQLILWEPV--GATLLPIKTLPFDGKLK--KVSSLCCSLS----------KDLLWIGTEGGNIYQL-----DLHTFTIKEPVIYHDVVLEQVPPAYK-LNPGAIESIRQLPNSPSKLLVAYNRGLCVL 211          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Zebrafish
Match: llgl1 (LLGL scribble cell polarity complex component 1 [Source:ZFIN;Acc:ZDB-GENE-060825-69])

HSP 1 Score: 108.227 bits (269), Expect = 4.539e-23
Identity = 86/313 (27.48%), Postives = 146/313 (46.65%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNEL------FKNWPF-RNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFDKEGIIWNDCE-IPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATKHTYTVN 2484
            PYL+  ++S IT    I  VPP L+    +  +       ++NWP    +N A +  + ELL+    +GH DGT++ W    SGV L  L K+ ++ IF       ++ +Q+        ++VGC    S+D  L I  I L  +S       +A ++          V+V   + +D+  D+  +    D+EG  W   + +P    S   +   Q +  +V+  P   VTA+     W  ++ G ++G  L D+H+   V +  T+      S A + PL+  + LKKS+RQSFR+++K + + K    VN
Sbjct:  380 PYLAPLHSSAITCSCHISNVPPKLWERVISAGQQQCPLQNYENWPICGGKNLAPDPKQKELLL----TGHEDGTVRFWDA--SGVSLKPLYKLSTASIFQTDCEHNDSLTQAGEEEWPPFRKVGCFDPYSDDPRLGIQKISLCKYSGKLVVAGTAGQVI---------VMVLGDEKSDHMIDVATVDLLQDREGFTWKGHDRLPPKSGSVVFAPGFQPV-VLVQCLPPAAVTAVTLHAEWNLIAFGTSHGFGLFDYHRRSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRVVVN 674          

HSP 2 Score: 68.9366 bits (167), Expect = 5.765e-11
Identity = 48/189 (25.40%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDL-----SIDSDHVISKIQDLDKT-YDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            +D +L L A+GTK G IKIYG+PG+  T ++     +  + FL GQGR++S+ ++N I LWE     +   ++            ++ + ++      ++TS   + ++++  S N +  +   G   HF +   L     S+  D ++  + +  K    LG V+ +Q +P  +    I YS G++++
Sbjct:   42 YDPKLQLMAIGTKSGAIKIYGAPGVEMTGLHKDTAAVTQIHFLCGQGRILSLLDDNTIHLWEIVQRENRSHLL------------EVHSFNLPGRPGIESTSATRVTVMLLNLSCN-LLALGTEGGGVHFLELPTLTLLNKSLFQDEIMQSVPEEYKCGKSLGPVESLQEHPKDSDKILIGYSRGLVVL 217          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Zebrafish
Match: llgl1 (LLGL scribble cell polarity complex component 1 [Source:ZFIN;Acc:ZDB-GENE-060825-69])

HSP 1 Score: 108.227 bits (269), Expect = 4.634e-23
Identity = 86/313 (27.48%), Postives = 146/313 (46.65%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNEL------FKNWPF-RNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFDKEGIIWNDCE-IPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATKHTYTVN 2484
            PYL+  ++S IT    I  VPP L+    +  +       ++NWP    +N A +  + ELL+    +GH DGT++ W    SGV L  L K+ ++ IF       ++ +Q+        ++VGC    S+D  L I  I L  +S       +A ++          V+V   + +D+  D+  +    D+EG  W   + +P    S   +   Q +  +V+  P   VTA+     W  ++ G ++G  L D+H+   V +  T+      S A + PL+  + LKKS+RQSFR+++K + + K    VN
Sbjct:  353 PYLAPLHSSAITCSCHISNVPPKLWERVISAGQQQCPLQNYENWPICGGKNLAPDPKQKELLL----TGHEDGTVRFWDA--SGVSLKPLYKLSTASIFQTDCEHNDSLTQAGEEEWPPFRKVGCFDPYSDDPRLGIQKISLCKYSGKLVVAGTAGQVI---------VMVLGDEKSDHMIDVATVDLLQDREGFTWKGHDRLPPKSGSVVFAPGFQPV-VLVQCLPPAAVTAVTLHAEWNLIAFGTSHGFGLFDYHRRSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRVVVN 647          

HSP 2 Score: 68.9366 bits (167), Expect = 4.699e-11
Identity = 48/189 (25.40%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDL-----SIDSDHVISKIQDLDKT-YDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            +D +L L A+GTK G IKIYG+PG+  T ++     +  + FL GQGR++S+ ++N I LWE     +   ++            ++ + ++      ++TS   + ++++  S N +  +   G   HF +   L     S+  D ++  + +  K    LG V+ +Q +P  +    I YS G++++
Sbjct:   15 YDPKLQLMAIGTKSGAIKIYGAPGVEMTGLHKDTAAVTQIHFLCGQGRILSLLDDNTIHLWEIVQRENRSHLL------------EVHSFNLPGRPGIESTSATRVTVMLLNLSCN-LLALGTEGGGVHFLELPTLTLLNKSLFQDEIMQSVPEEYKCGKSLGPVESLQEHPKDSDKILIGYSRGLVVL 190          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Zebrafish
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:795670])

HSP 1 Score: 75.8702 bits (185), Expect = 3.525e-13
Identity = 72/314 (22.93%), Postives = 133/314 (42.36%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNEL------FKNWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKY--DGTDNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATKHTYTVN 2484
            PYL   + S IT    +  +P  L+                K WP    +N A +  + +LL+    +GH DGT++ W    SGV L  + K+ ++ +FH      +  +Q +       ++VGC    S+D  L I  I L  +S            +     + G +LV +   +  +   + T +     +EG  W      ++     +         +V+  P   VTA+A    W+ +  G ++G  L D++Q   +    T+    + +  G  PL+  + +KKS+RQSFR++++ + + +  +T N
Sbjct:  375 PYLVPLHCSAITCSHHVSSIPLKLWERVQAAGAHQNTHYSRKPWPINGGKNLAPDPPQRDLLL----TGHEDGTVRFWDA--SGVCLYPMYKLSTAGVFHTDADPNDNMNQGSEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-----------YLTVAGTAGQILVLELNDEAAEQMVEATVVDLLQGQEGFRWKGQARLDVREEPVLFPPGFQPFALVQCQPPAVVTAIALHSEWKLVGFGTSHGFGLYDYNQRNNIMVKCTLNPSDQMAMEG--PLSRVKSIKKSLRQSFRRIRRSRVSMRKHHTNN 669          

HSP 2 Score: 61.6178 bits (148), Expect = 9.581e-9
Identity = 46/190 (24.21%), Postives = 91/190 (47.89%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEM--ISSISLS----AYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKI-QDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            F   L L A+GT+ G IK+YG+PG+ +  ++     +  + FL  Q  L+++  +N + +W  +   S  E+  I   +LS    A  +  ++TA+    S           ELL++G+    +F + + G    F + ++ +I  + V +++ +D     +L  V+ +  NP       I YS G++++
Sbjct:   40 FSPSLELLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPNQVELVTLLEDNSLHMWTLRAHNSMCELLEIGRFTLSGPPGAIPSVTRVTAVLAHSSG----------ELLLLGTEGGHVFVVEVPG----FRELEENNISVEDVQNRVPEDYVGRRNLESVETLHENPLNPRQVLIGYSRGLMVL 215          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Zebrafish
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:795670])

HSP 1 Score: 75.8702 bits (185), Expect = 3.525e-13
Identity = 72/314 (22.93%), Postives = 133/314 (42.36%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNEL------FKNWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKY--DGTDNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATKHTYTVN 2484
            PYL   + S IT    +  +P  L+                K WP    +N A +  + +LL+    +GH DGT++ W    SGV L  + K+ ++ +FH      +  +Q +       ++VGC    S+D  L I  I L  +S            +     + G +LV +   +  +   + T +     +EG  W      ++     +         +V+  P   VTA+A    W+ +  G ++G  L D++Q   +    T+    + +  G  PL+  + +KKS+RQSFR++++ + + +  +T N
Sbjct:  375 PYLVPLHCSAITCSHHVSSIPLKLWERVQAAGAHQNTHYSRKPWPINGGKNLAPDPPQRDLLL----TGHEDGTVRFWDA--SGVCLYPMYKLSTAGVFHTDADPNDNMNQGSEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-----------YLTVAGTAGQILVLELNDEAAEQMVEATVVDLLQGQEGFRWKGQARLDVREEPVLFPPGFQPFALVQCQPPAVVTAIALHSEWKLVGFGTSHGFGLYDYNQRNNIMVKCTLNPSDQMAMEG--PLSRVKSIKKSLRQSFRRIRRSRVSMRKHHTNN 669          

HSP 2 Score: 61.6178 bits (148), Expect = 9.581e-9
Identity = 46/190 (24.21%), Postives = 91/190 (47.89%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEM--ISSISLS----AYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKI-QDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            F   L L A+GT+ G IK+YG+PG+ +  ++     +  + FL  Q  L+++  +N + +W  +   S  E+  I   +LS    A  +  ++TA+    S           ELL++G+    +F + + G    F + ++ +I  + V +++ +D     +L  V+ +  NP       I YS G++++
Sbjct:   40 FSPSLELLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPNQVELVTLLEDNSLHMWTLRAHNSMCELLEIGRFTLSGPPGAIPSVTRVTAVLAHSSG----------ELLLLGTEGGHVFVVEVPG----FRELEENNISVEDVQNRVPEDYVGRRNLESVETLHENPLNPRQVLIGYSRGLMVL 215          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Zebrafish
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:795670])

HSP 1 Score: 75.8702 bits (185), Expect = 3.713e-13
Identity = 72/314 (22.93%), Postives = 133/314 (42.36%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNEL------FKNWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKY--DGTDNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATKHTYTVN 2484
            PYL   + S IT    +  +P  L+                K WP    +N A +  + +LL+    +GH DGT++ W    SGV L  + K+ ++ +FH      +  +Q +       ++VGC    S+D  L I  I L  +S            +     + G +LV +   +  +   + T +     +EG  W      ++     +         +V+  P   VTA+A    W+ +  G ++G  L D++Q   +    T+    + +  G  PL+  + +KKS+RQSFR++++ + + +  +T N
Sbjct:  375 PYLVPLHCSAITCSHHVSSIPLKLWERVQAAGAHQNTHYSRKPWPINGGKNLAPDPPQRDLLL----TGHEDGTVRFWDA--SGVCLYPMYKLSTAGVFHTDADPNDNMNQGSEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-----------YLTVAGTAGQILVLELNDEAAEQMVEATVVDLLQGQEGFRWKGQARLDVREEPVLFPPGFQPFALVQCQPPAVVTAIALHSEWKLVGFGTSHGFGLYDYNQRNNIMVKCTLNPSDQMAMEG--PLSRVKSIKKSLRQSFRRIRRSRVSMRKHHTNN 669          

HSP 2 Score: 61.2326 bits (147), Expect = 1.082e-8
Identity = 46/190 (24.21%), Postives = 91/190 (47.89%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEM--ISSISLS----AYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKI-QDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            F   L L A+GT+ G IK+YG+PG+ +  ++     +  + FL  Q  L+++  +N + +W  +   S  E+  I   +LS    A  +  ++TA+    S           ELL++G+    +F + + G    F + ++ +I  + V +++ +D     +L  V+ +  NP       I YS G++++
Sbjct:   40 FSPSLELLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPNQVELVTLLEDNSLHMWTLRAHNSMCELLEIGRFTLSGPPGAIPSVTRVTAVLAHSSG----------ELLLLGTEGGHVFVVEVPG----FRELEENNISVEDVQNRVPEDYVGRRNLESVETLHENPLNPRQVLIGYSRGLMVL 215          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Xenopus
Match: LLGL1 (LLGL1, scribble cell polarity complex component [Source:NCBI gene;Acc:100486472])

HSP 1 Score: 92.4337 bits (228), Expect = 4.405e-18
Identity = 92/311 (29.58%), Postives = 136/311 (43.73%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNE-----LFKNWPF-RNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFD----KEGIIW--NDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATK 2466
            PYL+  ++S IT    I  V   L+    +  E        NWP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ IF        + +QSN       ++VGC    S+D  L I  I L  +S              L   + G VLV   D  D K + T   A  D    +EG  W  +D   P    S       Q +  +V+  P   VTA+A    W  ++ G ++G  L D+H+   V +  T+      S A + PL+  + LKKS+RQSFR+++K + + K
Sbjct:  362 PYLAPLHSSAITCAYHISNVTTKLWERIISAGEQQNPQFSSNWPIDGGRNLAEEPAQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGIFQTDCDHNESFNQSNDEEWPPFRKVGCFDPYSDDPRLGIQKIALCKYSGK-----------MLVAGTAGQVLVM--DLNDEKVEHTINVATVDLLQEREGFTWKGHDRLTPRN-GSLFFQPGFQTIT-LVQCMPPAAVTAVALHSEWNLVAFGTSHGFGLFDYHRRSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGK 649          

HSP 2 Score: 63.929 bits (154), Expect = 2.638e-9
Identity = 26/65 (40.00%), Postives = 42/65 (64.62%), Query Frame = 1
Query:  199 CFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYK 393
             FD  L + A+G K G +KIYG+PG+ +T ++     +  + FL GQGRL+S+ ++N + LWE +
Sbjct:   41 AFDPLLRIMAIGAKSGAVKIYGAPGVEFTGLHKDTATVTQMHFLPGQGRLLSLLDDNTMHLWELQ 105          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Xenopus
Match: LLGL1 (LLGL1, scribble cell polarity complex component [Source:NCBI gene;Acc:100486472])

HSP 1 Score: 92.4337 bits (228), Expect = 5.514e-18
Identity = 92/311 (29.58%), Postives = 136/311 (43.73%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNE-----LFKNWPF-RNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFD----KEGIIW--NDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATK 2466
            PYL+  ++S IT    I  V   L+    +  E        NWP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ IF        + +QSN       ++VGC    S+D  L I  I L  +S              L   + G VLV   D  D K + T   A  D    +EG  W  +D   P    S       Q +  +V+  P   VTA+A    W  ++ G ++G  L D+H+   V +  T+      S A + PL+  + LKKS+RQSFR+++K + + K
Sbjct:  362 PYLAPLHSSAITCAYHISNVTTKLWERIISAGEQQNPQFSSNWPIDGGRNLAEEPAQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGIFQTDCDHNESFNQSNDEEWPPFRKVGCFDPYSDDPRLGIQKIALCKYSGK-----------MLVAGTAGQVLVM--DLNDEKVEHTINVATVDLLQEREGFTWKGHDRLTPRN-GSLFFQPGFQTIT-LVQCMPPAAVTAVALHSEWNLVAFGTSHGFGLFDYHRRSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGK 649          

HSP 2 Score: 63.929 bits (154), Expect = 2.734e-9
Identity = 26/65 (40.00%), Postives = 42/65 (64.62%), Query Frame = 1
Query:  199 CFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYK 393
             FD  L + A+G K G +KIYG+PG+ +T ++     +  + FL GQGRL+S+ ++N + LWE +
Sbjct:   41 AFDPLLRIMAIGAKSGAVKIYGAPGVEFTGLHKDTATVTQMHFLPGQGRLLSLLDDNTMHLWELQ 105          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Xenopus
Match: LLGL1 (LLGL1, scribble cell polarity complex component [Source:NCBI gene;Acc:100486472])

HSP 1 Score: 92.0485 bits (227), Expect = 5.753e-18
Identity = 92/311 (29.58%), Postives = 136/311 (43.73%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNE-----LFKNWPF-RNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFD----KEGIIW--NDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATK 2466
            PYL+  ++S IT    I  V   L+    +  E        NWP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ IF        + +QSN       ++VGC    S+D  L I  I L  +S              L   + G VLV   D  D K + T   A  D    +EG  W  +D   P    S       Q +  +V+  P   VTA+A    W  ++ G ++G  L D+H+   V +  T+      S A + PL+  + LKKS+RQSFR+++K + + K
Sbjct:  362 PYLAPLHSSAITCAYHISNVTTKLWERIISAGEQQNPQFSSNWPIDGGRNLAEEPAQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGIFQTDCDHNESFNQSNDEEWPPFRKVGCFDPYSDDPRLGIQKIALCKYSGK-----------MLVAGTAGQVLVM--DLNDEKVEHTINVATVDLLQEREGFTWKGHDRLTPRN-GSLFFQPGFQTIT-LVQCMPPAAVTAVALHSEWNLVAFGTSHGFGLFDYHRRSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGK 649          

HSP 2 Score: 63.929 bits (154), Expect = 2.577e-9
Identity = 26/64 (40.62%), Postives = 42/64 (65.62%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYK 393
            FD  L + A+G K G +KIYG+PG+ +T ++     +  + FL GQGRL+S+ ++N + LWE +
Sbjct:   42 FDPLLRIMAIGAKSGAVKIYGAPGVEFTGLHKDTATVTQMHFLPGQGRLLSLLDDNTMHLWELQ 105          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Xenopus
Match: LLGL1 (LLGL1, scribble cell polarity complex component [Source:NCBI gene;Acc:100486472])

HSP 1 Score: 92.0485 bits (227), Expect = 6.777e-18
Identity = 92/311 (29.58%), Postives = 136/311 (43.73%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNE-----LFKNWPF-RNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFD----KEGIIW--NDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATK 2466
            PYL+  ++S IT    I  V   L+    +  E        NWP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ IF        + +QSN       ++VGC    S+D  L I  I L  +S              L   + G VLV   D  D K + T   A  D    +EG  W  +D   P    S       Q +  +V+  P   VTA+A    W  ++ G ++G  L D+H+   V +  T+      S A + PL+  + LKKS+RQSFR+++K + + K
Sbjct:  358 PYLAPLHSSAITCAYHISNVTTKLWERIISAGEQQNPQFSSNWPIDGGRNLAEEPAQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGIFQTDCDHNESFNQSNDEEWPPFRKVGCFDPYSDDPRLGIQKIALCKYSGK-----------MLVAGTAGQVLVM--DLNDEKVEHTINVATVDLLQEREGFTWKGHDRLTPRN-GSLFFQPGFQTIT-LVQCMPPAAVTAVALHSEWNLVAFGTSHGFGLFDYHRRSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGK 645          

HSP 2 Score: 63.929 bits (154), Expect = 2.470e-9
Identity = 50/189 (26.46%), Postives = 88/189 (46.56%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTG------KITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            FD  L + A+G K G +KIYG+PG+ +T ++     +  + FL GQGRL+S+ ++N + LWE + +  +  +  + S       G      ++T I I+ S           E+  +G+    ++ I I            L  +   +  +I    KT  LG V+ +Q +P Q     I YS G++++
Sbjct:   29 FDPLLRIMAIGAKSGAVKIYGAPGVEFTGLHKDTATVTQMHFLPGQGRLLSLLDDNTMHLWELQQKDGSSHLEETRSFLLPGKPGSPPSFTRVTVILITAS----------CEVAGLGTEGGGVYFIQI--------PSLKLLEEKTLLQDEIYRCGKT--LGPVESLQEHPCQRGKILIGYSRGLVVL 197          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Xenopus
Match: LLGL1 (LLGL1, scribble cell polarity complex component [Source:NCBI gene;Acc:100486472])

HSP 1 Score: 91.6633 bits (226), Expect = 7.793e-18
Identity = 92/311 (29.58%), Postives = 136/311 (43.73%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNE-----LFKNWPF-RNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFD----KEGIIW--NDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATK 2466
            PYL+  ++S IT    I  V   L+    +  E        NWP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ IF        + +QSN       ++VGC    S+D  L I  I L  +S              L   + G VLV   D  D K + T   A  D    +EG  W  +D   P    S       Q +  +V+  P   VTA+A    W  ++ G ++G  L D+H+   V +  T+      S A + PL+  + LKKS+RQSFR+++K + + K
Sbjct:  358 PYLAPLHSSAITCAYHISNVTTKLWERIISAGEQQNPQFSSNWPIDGGRNLAEEPAQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGIFQTDCDHNESFNQSNDEEWPPFRKVGCFDPYSDDPRLGIQKIALCKYSGK-----------MLVAGTAGQVLVM--DLNDEKVEHTINVATVDLLQEREGFTWKGHDRLTPRN-GSLFFQPGFQTIT-LVQCMPPAAVTAVALHSEWNLVAFGTSHGFGLFDYHRRSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGK 645          

HSP 2 Score: 63.929 bits (154), Expect = 2.495e-9
Identity = 50/189 (26.46%), Postives = 88/189 (46.56%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTG------KITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            FD  L + A+G K G +KIYG+PG+ +T ++     +  + FL GQGRL+S+ ++N + LWE + +  +  +  + S       G      ++T I I+ S           E+  +G+    ++ I I            L  +   +  +I    KT  LG V+ +Q +P Q     I YS G++++
Sbjct:   29 FDPLLRIMAIGAKSGAVKIYGAPGVEFTGLHKDTATVTQMHFLPGQGRLLSLLDDNTMHLWELQQKDGSSHLEETRSFLLPGKPGSPPSFTRVTVILITAS----------CEVAGLGTEGGGVYFIQI--------PSLKLLEEKTLLQDEIYRCGKT--LGPVESLQEHPCQRGKILIGYSRGLVVL 197          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Mouse
Match: Llgl1 (LLGL1 scribble cell polarity complex component [Source:MGI Symbol;Acc:MGI:102682])

HSP 1 Score: 82.0333 bits (201), Expect = 5.783e-15
Identity = 75/308 (24.35%), Postives = 131/308 (42.53%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFK--------NWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSN----GISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLSSTDISEKLQNL--NYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            PYL+  ++S IT    +  VP  L+    +  E           +WP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ +F       ++ +Q+        ++VGC    S+D  L I  + L  ++              +   + G VLV +      +  ++  + +   D+EG  W   E   L   T +           +++  P   VTA+     W  ++ G ++G  L D+ +   V +  T+      S A + PL+  + LKKS+RQSFR+++K +
Sbjct:  384 PYLAPLHSSAITCSAHVANVPSKLWARIVSAGEQQSPQPASSALSWPITGGRNLAQEPSQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGLFQTDCEHADSLAQAVEDDWPPFRKVGCFDPYSDDPRLGIQKVALCKYTAQ-----------MVVAGTAGQVLVLELSEVPAEHAVSVANVDLLQDREGFTWKGHE--RLNPHTGLLPWPAGFQPRMLIQCLPPAAVTAVTLHAEWSLVAFGTSHGFGLFDYQRKSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSR 670          

HSP 2 Score: 60.4622 bits (145), Expect = 1.993e-8
Identity = 54/204 (26.47%), Postives = 92/204 (45.10%), Query Frame = 1
Query:  172 GMLDDVTCNCFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVV----------GSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYD-LGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            G  +  +   FD EL + A+GT+ G +KIYG+PG+ +T ++     +  + FL GQGRL+++ +++ + LWE          I   +  A++  G         SF   +    L  + VV          G+ +  IF + +        +G  LS D   V+  + D  +    LG V+ +Q +    S   I YS G+L+I
Sbjct:   32 GFPNQPSALAFDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLPGQGRLLTLLDDSSLHLWE----------IIHHNGCAHLEEGLSFHPPSRPSFDNASFPASLTRVTVVLLVAGNTAALGTESGSIFFLDVA--TLALLEGQTLSPDV--VLRSVPDDYRCGKALGPVESLQGHLQDPSKILIGYSRGLLVI 221          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Mouse
Match: Llgl1 (LLGL1 scribble cell polarity complex component [Source:MGI Symbol;Acc:MGI:102682])

HSP 1 Score: 82.0333 bits (201), Expect = 6.161e-15
Identity = 75/308 (24.35%), Postives = 131/308 (42.53%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFK--------NWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSN----GISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLSSTDISEKLQNL--NYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            PYL+  ++S IT    +  VP  L+    +  E           +WP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ +F       ++ +Q+        ++VGC    S+D  L I  + L  ++              +   + G VLV +      +  ++  + +   D+EG  W   E   L   T +           +++  P   VTA+     W  ++ G ++G  L D+ +   V +  T+      S A + PL+  + LKKS+RQSFR+++K +
Sbjct:  384 PYLAPLHSSAITCSAHVANVPSKLWARIVSAGEQQSPQPASSALSWPITGGRNLAQEPSQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGLFQTDCEHADSLAQAVEDDWPPFRKVGCFDPYSDDPRLGIQKVALCKYTAQ-----------MVVAGTAGQVLVLELSEVPAEHAVSVANVDLLQDREGFTWKGHE--RLNPHTGLLPWPAGFQPRMLIQCLPPAAVTAVTLHAEWSLVAFGTSHGFGLFDYQRKSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSR 670          

HSP 2 Score: 60.4622 bits (145), Expect = 2.149e-8
Identity = 53/194 (27.32%), Postives = 89/194 (45.88%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVV----------GSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYD-LGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            FD EL + A+GT+ G +KIYG+PG+ +T ++     +  + FL GQGRL+++ +++ + LWE          I   +  A++  G         SF   +    L  + VV          G+ +  IF + +        +G  LS D   V+  + D  +    LG V+ +Q +    S   I YS G+L+I
Sbjct:   42 FDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLPGQGRLLTLLDDSSLHLWE----------IIHHNGCAHLEEGLSFHPPSRPSFDNASFPASLTRVTVVLLVAGNTAALGTESGSIFFLDVA--TLALLEGQTLSPDV--VLRSVPDDYRCGKALGPVESLQGHLQDPSKILIGYSRGLLVI 221          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Mouse
Match: Llgl2 (LLGL2 scribble cell polarity complex component [Source:MGI Symbol;Acc:MGI:1918843])

HSP 1 Score: 66.2402 bits (160), Expect = 3.919e-10
Identity = 88/356 (24.72%), Postives = 149/356 (41.85%), Query Frame = 1
Query: 1402 IVLKDDSKSTEIKTPSNIVDF-VLTTNNFSELSKQSHTLLILCESQLXXXXXXXXXXXXXXCPYLSLNNTSHITSLTSIIQVPPSLFPN----ASTVNELFKN--WPF-RNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEV-NACSQSNG---ISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIR 2424
            I +  + + T     S ++DF VL+  + +      + L++L E +L+ ID+++     +  PYL+  + S IT    +  +P  L+       S  N  F    WP     + A    + +LL+    +GH DGT++ W    SGV L LL K+ +  +F        N  +Q        ++VG     S+D  L I  I L  +S            +     + G VLV + +    +  + ++ A+   D+EG  W   E           E       +V+  P   VT+LA    W  ++ G ++G  L D  Q + VF   T+    + +  G  PL+  + LKKS+R
Sbjct:  315 ISVVHNGQQTAFDFTSRVIDFTVLSEADPAAAFDDPYALVVLAEEELVVIDLQTPGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNSHFSTMEWPIDGGTSLAPPPPQRDLLL----TGHEDGTVRFWDA--SGVCLRLLYKLSTVRVFLTDTDPSENLIAQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSG-----------YLAVAGTAGQVLVLELNDEAAEHAVEQVEADLLQDQEGYRWKGHERLAARPGPVCFEAGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEG--PLSRVKSLKKSLR 651          

HSP 2 Score: 64.6994 bits (156), Expect = 1.139e-9
Identity = 43/187 (22.99%), Postives = 93/187 (49.73%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKI-TAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQD---LDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            +   L + A+GT+ G +K+YG+PG+ +  ++     +  + FL GQ +L+++ ++N + LW  K++    E+    S +     G   +A  +++     +      ELL +G+ +  +F + + G    F    D +I SD V+  + +     + +++  V+ +Q +P   +   I YS G+++I
Sbjct:   40 YSPSLRILAIGTRSGAVKLYGAPGVEFMGLHKENNAVLQIHFLPGQCQLVTLLDDNSLHLWSLKVKGGVSELQEEESFTLRGPPGAAPSATQVTEILPHSSG-----ELLYLGTESGNVFVVQLPG----FRTLHDRTICSDEVLQWLPEEARHRRVFEM--VEALQEHPRDPNQILIGYSRGLVVI 215          

HSP 3 Score: 56.6102 bits (135), Expect = 3.410e-7
Identity = 25/67 (37.31%), Postives = 41/67 (61.19%), Query Frame = 1
Query: 2788 SSNKVPCLFAGTNAGAIFAFEISF---EDNTDEMVKVKLSKELHLQHKAPILLLSITNSNHVPFINP 2979
            SS   P L+AGTN G ++AF +     E  TDE V+ + +KE+ L H+AP++ + + + ++VP   P
Sbjct:  728 SSRHCPSLWAGTNGGTVYAFSLRVPPAERRTDEPVRAEQAKEIQLMHRAPVVGILVLDGHNVPLPEP 794          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Mouse
Match: Llgl2 (LLGL2 scribble cell polarity complex component [Source:MGI Symbol;Acc:MGI:1918843])

HSP 1 Score: 65.855 bits (159), Expect = 4.374e-10
Identity = 88/356 (24.72%), Postives = 149/356 (41.85%), Query Frame = 1
Query: 1402 IVLKDDSKSTEIKTPSNIVDF-VLTTNNFSELSKQSHTLLILCESQLXXXXXXXXXXXXXXCPYLSLNNTSHITSLTSIIQVPPSLFPN----ASTVNELFKN--WPF-RNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEV-NACSQSNG---ISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIR 2424
            I +  + + T     S ++DF VL+  + +      + L++L E +L+ ID+++     +  PYL+  + S IT    +  +P  L+       S  N  F    WP     + A    + +LL+    +GH DGT++ W    SGV L LL K+ +  +F        N  +Q        ++VG     S+D  L I  I L  +S            +     + G VLV + +    +  + ++ A+   D+EG  W   E           E       +V+  P   VT+LA    W  ++ G ++G  L D  Q + VF   T+    + +  G  PL+  + LKKS+R
Sbjct:  315 ISVVHNGQQTAFDFTSRVIDFTVLSEADPAAAFDDPYALVVLAEEELVVIDLQTPGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNSHFSTMEWPIDGGTSLAPPPPQRDLLL----TGHEDGTVRFWDA--SGVCLRLLYKLSTVRVFLTDTDPSENLIAQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSG-----------YLAVAGTAGQVLVLELNDEAAEHAVEQVEADLLQDQEGYRWKGHERLAARPGPVCFEAGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEG--PLSRVKSLKKSLR 651          

HSP 2 Score: 64.6994 bits (156), Expect = 1.063e-9
Identity = 43/187 (22.99%), Postives = 93/187 (49.73%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKI-TAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQD---LDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            +   L + A+GT+ G +K+YG+PG+ +  ++     +  + FL GQ +L+++ ++N + LW  K++    E+    S +     G   +A  +++     +      ELL +G+ +  +F + + G    F    D +I SD V+  + +     + +++  V+ +Q +P   +   I YS G+++I
Sbjct:   40 YSPSLRILAIGTRSGAVKLYGAPGVEFMGLHKENNAVLQIHFLPGQCQLVTLLDDNSLHLWSLKVKGGVSELQEEESFTLRGPPGAAPSATQVTEILPHSSG-----ELLYLGTESGNVFVVQLPG----FRTLHDRTICSDEVLQWLPEEARHRRVFEM--VEALQEHPRDPNQILIGYSRGLVVI 215          

HSP 3 Score: 56.6102 bits (135), Expect = 3.375e-7
Identity = 25/67 (37.31%), Postives = 41/67 (61.19%), Query Frame = 1
Query: 2788 SSNKVPCLFAGTNAGAIFAFEISF---EDNTDEMVKVKLSKELHLQHKAPILLLSITNSNHVPFINP 2979
            SS   P L+AGTN G ++AF +     E  TDE V+ + +KE+ L H+AP++ + + + ++VP   P
Sbjct:  752 SSRHCPSLWAGTNGGTVYAFSLRVPPAERRTDEPVRAEQAKEIQLMHRAPVVGILVLDGHNVPLPEP 818          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Mouse
Match: Llgl2 (LLGL2 scribble cell polarity complex component [Source:MGI Symbol;Acc:MGI:1918843])

HSP 1 Score: 51.6026 bits (122), Expect = 9.411e-7
Identity = 28/122 (22.95%), Postives = 62/122 (50.82%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKI-TAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQI 564
            +   L + A+GT+ G +K+YG+PG+ +  ++     +  + FL GQ +L+++ ++N + LW  K++    E+    S +     G   +A  +++     +      ELL +G+ +  +F +
Sbjct:   40 YSPSLRILAIGTRSGAVKLYGAPGVEFMGLHKENNAVLQIHFLPGQCQLVTLLDDNSLHLWSLKVKGGVSELQEEESFTLRGPPGAAPSATQVTEILPHSSG-----ELLYLGTESGNVFVV 156          
BLAST of LLGL scribble cell polarity complex component 2 vs. UniProt/SwissProt
Match: sp|Q8K4K5|L2GL1_RAT (Lethal(2) giant larvae protein homolog 1 OS=Rattus norvegicus OX=10116 GN=Llgl1 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.743e-15
Identity = 77/314 (24.52%), Postives = 133/314 (42.36%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFK--------NWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSN----GISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATKHTYT 2478
            PYL+  ++S IT    +  VP  L+    +  E           +WP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ +F       ++ +Q+        ++VGC    S+D  L I  + L  ++              +   + G VLV +      +  ++  S +   D+EG  W   E     +             +++  P   VTA+A    W  ++ G ++G  L D+ +   V +  T+      S A + PL+  + LKKS+RQSFR+++K + + K   T
Sbjct:  384 PYLAPLHSSAITCSAHVANVPSKLWARIVSAGERQSPQPASSALSWPITGGRNLAQEPSQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGLFQTDCEHADSLAQAVEDDWPPFRKVGCFDPYSDDPRLGIQKVALCKYTAQ-----------MVVAGTAGQVLVLELSDVPGEHTVSVASVDLLQDREGFTWKGHERLSPHTGPLPWPAGFQPRVLIQCLPPAAVTAVALHAEWSLVAFGTSHGFGLFDYQRKSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRAT 678          

HSP 2 Score: 62.3882 bits (150), Expect = 4.266e-8
Identity = 54/204 (26.47%), Postives = 92/204 (45.10%), Query Frame = 1
Query:  172 GMLDDVTCNCFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVV----------GSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYD-LGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            G  +  +   FD EL + A+GT+ G +KIYG+PG+ +T ++     +  + FL GQGRL+++ +++ + LWE          I   +  A++  G         SF   +    L  + VV          G+ +  IF + +        +G  LS   D V+  + D  +    LG V+ +Q +    S   I YS G+L+I
Sbjct:   32 GFPNQPSALAFDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLPGQGRLLTLLDDSSLHLWE----------IIQRNGCAHLEEGLSFHPPSRPSFGNASFPAGLTRVTVVLLAAGDTVVLGTESGSIFFLDVA--TLALLEGQTLS--PDEVLRSVPDDYRCGKALGPVESLQGHLQDPSKILIGYSRGLLVI 221          
BLAST of LLGL scribble cell polarity complex component 2 vs. UniProt/SwissProt
Match: sp|Q8MKF0|L2GL1_BOVIN (Lethal(2) giant larvae protein homolog 1 OS=Bos taurus OX=9913 GN=LLGL1 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.944e-14
Identity = 75/308 (24.35%), Postives = 131/308 (42.53%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFK--------NWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSN----GISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLSSTDISEKLQNL--NYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            PYL+  ++S IT    +  VP  L+    +  E           +WP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ +F       ++ +Q+        ++VGC    S+D  L I  + L  ++              +   + G VLV +      +  ++  + +   D+EG  W   E   L   T +           +++  P   VTA+     W  ++ G ++G  L D+ +   V +  T+      S A + PL+  + LKKS+RQSFR+++K +
Sbjct:  384 PYLAPLHSSAITCSAHVANVPSKLWARIVSAGEQQSPQPASSALSWPITGGRNLAQEPSQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGLFQTDCEHADSLAQAVEDDWPPFRKVGCFDPYSDDPRLGIQKVALCKYTAQ-----------MVVAGTAGQVLVLELSEVPAEHAVSVANVDLLQDREGFTWKGHE--RLNPHTGLLPWPAGFQPRMLIQCLPPAAVTAVTLHAEWSLVAFGTSHGFGLFDYQRKSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSR 670          

HSP 2 Score: 62.3882 bits (150), Expect = 4.339e-8
Identity = 50/195 (25.64%), Postives = 92/195 (47.18%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISL---------SAYINTG--KITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYD-LGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            FD EL + A+GT+ G +KIYG+PG+ +T ++     +  + FL GQGRL+++ +++ + LWE         +   +S          +A    G  ++T + ++             + +V+G+ +  IF + +        +G  LS   D V+  + D  +    LG V+ +Q +    S   I YS G+L+I
Sbjct:   42 FDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLPGQGRLLTLLDDSSLHLWEIIQRNGCAHLEEGLSFHPPSRPSFDNASFPAGLTRVTVVLLAAG-----------DTVVLGTESGSIFFLDVA--TLALLEGQTLS--PDEVLRSVPDDYRCGKALGPVESLQGHLQDPSKILIGYSRGLLVI 221          
BLAST of LLGL scribble cell polarity complex component 2 vs. UniProt/SwissProt
Match: sp|Q80Y17|L2GL1_MOUSE (Lethal(2) giant larvae protein homolog 1 OS=Mus musculus OX=10090 GN=Llgl1 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.046e-14
Identity = 75/308 (24.35%), Postives = 131/308 (42.53%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFK--------NWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSN----GISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLSSTDISEKLQNL--NYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            PYL+  ++S IT    +  VP  L+    +  E           +WP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ +F       ++ +Q+        ++VGC    S+D  L I  + L  ++              +   + G VLV +      +  ++  + +   D+EG  W   E   L   T +           +++  P   VTA+     W  ++ G ++G  L D+ +   V +  T+      S A + PL+  + LKKS+RQSFR+++K +
Sbjct:  384 PYLAPLHSSAITCSAHVANVPSKLWARIVSAGEQQSPQPASSALSWPITGGRNLAQEPSQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGLFQTDCEHADSLAQAVEDDWPPFRKVGCFDPYSDDPRLGIQKVALCKYTAQ-----------MVVAGTAGQVLVLELSEVPAEHAVSVANVDLLQDREGFTWKGHE--RLNPHTGLLPWPAGFQPRMLIQCLPPAAVTAVTLHAEWSLVAFGTSHGFGLFDYQRKSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSR 670          

HSP 2 Score: 60.4622 bits (145), Expect = 1.394e-7
Identity = 54/204 (26.47%), Postives = 92/204 (45.10%), Query Frame = 1
Query:  172 GMLDDVTCNCFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVV----------GSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYD-LGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            G  +  +   FD EL + A+GT+ G +KIYG+PG+ +T ++     +  + FL GQGRL+++ +++ + LWE          I   +  A++  G         SF   +    L  + VV          G+ +  IF + +        +G  LS D   V+  + D  +    LG V+ +Q +    S   I YS G+L+I
Sbjct:   32 GFPNQPSALAFDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLPGQGRLLTLLDDSSLHLWE----------IIHHNGCAHLEEGLSFHPPSRPSFDNASFPASLTRVTVVLLVAGNTAALGTESGSIFFLDVA--TLALLEGQTLSPDV--VLRSVPDDYRCGKALGPVESLQGHLQDPSKILIGYSRGLLVI 221          
BLAST of LLGL scribble cell polarity complex component 2 vs. UniProt/SwissProt
Match: sp|Q15334|L2GL1_HUMAN (Lethal(2) giant larvae protein homolog 1 OS=Homo sapiens OX=9606 GN=LLGL1 PE=1 SV=3)

HSP 1 Score: 81.6481 bits (200), Expect = 4.775e-14
Identity = 76/314 (24.20%), Postives = 131/314 (41.72%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFK--------NWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSN----GISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGT--DNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNY--------IVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            PYL+  ++S IT    +  VP  L+    +  E           +WP     N A E  +  LL+    +GH DGT++ W    SGV L  L K+ ++ +F       ++ +Q+        ++VGC    S+D  L +  + L  ++              +   + G VLV +      +    +  I    D+EG  W   E         +S +   L +        +V+  P   VTA+     W  ++ G ++G  L D+ +   V +  T+      S A + PL+  + LKKS+RQSFR+++K +
Sbjct:  385 PYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQSPQPVSSALSWPITGGRNLAQEPSQRGLLL----TGHEDGTVRFWDA--SGVALRPLYKLSTAGLFQTDCEHADSLAQAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQ-----------MVVAGTAGQVLVLELSDVPVEQAVSVAIIDLLQDREGFTWKGHE--------RLSPRTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTEWSLVAFGTSHGFGLFDYQRKSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSR 671          

HSP 2 Score: 57.3806 bits (137), Expect = 1.414e-6
Identity = 49/191 (25.65%), Postives = 86/191 (45.03%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVV-GSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYD-------LGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            FD EL + A+GT+ G +KIYG+PG+ +T ++     +  + FL GQGRL+S+ +++ + LWE         +  ++S       G          F   +    L  + VV   + + I  +   G+   F D   L++     ++  + L    D       LG V+ +Q +    +   I YS G+L+I
Sbjct:   42 FDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPG----------FDGASAPLSLTRVTVVLLVAASDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTKILIGYSRGLLVI 222          
BLAST of LLGL scribble cell polarity complex component 2 vs. UniProt/SwissProt
Match: sp|Q08470|L2GL_DROPS (Protein lethal(2) giant larvae OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=l(2)gl PE=1 SV=3)

HSP 1 Score: 77.0258 bits (188), Expect = 1.303e-12
Identity = 87/366 (23.77%), Postives = 163/366 (44.54%), Query Frame = 1
Query: 1447 SNIVDFVLTTNNFSELSKQSHTLLILCESQLXXXXXXXXXXXXXXCPYLSLNNTSHITSLTSIIQVPPSLF------PNASTVNELFKNWPFRNENCAN---EKHEDELLID--IFGSGHADGTIKIWQVLPSGVL-NLLIKVESSEIF-------HQAVSEVNACSQSNGIS--KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYD-GTDNKGDLTEISANF--DKEGIIWNDCEIPELLS------STDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            S ++DF +T   + E S     L++L E +L A D+    ++ I  PYL   + S +T      QV   ++       +   ++    +WP       +   E  EDE++ D  I  +GH DG++K W    +GVL   +   +++ IF           ++++A     G    ++ G     S+D  L +  I            P   +L  + G + G +++  +D   +++  L   S N   D++G +W   +   + +      +  ++E   N+  ++++ P   +T +A +  W  +S G  +GLVL DF     VF   T+   +  + AG+  L+  +  KKS+R+SFRKL+K +
Sbjct:  326 SKVIDFFVT---YKEGSDDVEVLIVLLEEELCAYDLTDPSILSIKAPYLHSVHASAVTCNYLASQVTQGVYERILRAGDEQDIDYSSIDWPITGGVLTDDSVESDEDEVVKDYEILLTGHEDGSVKFWDC--TGVLLKPIYNFKTASIFGNEHEYREDGAADISAEQLDEGEPPFRKAGLFDPYSDDPRLAVKKIAFC---------PKTGQL--VVGGTAGQIVIADFDTAAEDQSSLKYNSMNLVSDRDGFVWKGHDQLNVRANLLEDNAVPLTENGVNITGVLQVLPPASITCMALEANWGLVSGGTAHGLVLFDFKNFVPVFHRCTLNP-NDLTGAGEQ-LSRRKSFKKSLRESFRKLRKGR 673          
BLAST of LLGL scribble cell polarity complex component 2 vs. TrEMBL
Match: U3N6C3 (Lethal giant larvae protein OS=Schistosoma japonicum OX=6182 GN=Lgl PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 3.141e-34
Identity = 204/897 (22.74%), Postives = 360/897 (40.13%), Query Frame = 1
Query:   58 MASKLFAPFKKFPQQLPIXXXXXXXXXXASMANYNSIC-------GMLDDVTCNCFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDD-LSIDSDHVISKIQDLDKTYDLG---GVDKIQFNPDQNSLFYISYSNGMLLILXXXXXXXXXXXXXXXXXXXXXHDEKLIVTGTTEEESKKPSEATNELKLPESEDITSSEVPKIDENKEQGEKT-----DEAEEVAKSEIVKSKADEEIQKLDEAKPEVQKSEDIKPEIKKLKESTQVPYAHVELPAITKYVFSGKKILAVNWA-------NDKIAVAQEDSESICFYDIGSDNFKISESEKTVTI-PENFQTSLAKFSFCN------------LKNFNLTILMAHSNEKNILIVLKDDSKSTEIKTPSNIVDFVLTT------------NNFSELSKQSH--TLLILCESQLXXXXXXXXXXXXXXCPYLSLNNTSHITSLTSIIQVPPSLFPN----ASTVNELFKN--WPFRNENCANEKHED---ELLIDIFGSGHADGTIKIWQVLPSGVLNLLIKVESSEIFHQA-VSEVNACSQSN------------GISKQVGCHLTDSEDNLLQITNIQLMLHST--NSFSEPSANELFCL-TGNSCGTV--LVFKYDG-------TDNKGDLTEISANF----DKEGIIWNDCE-------IPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKA------SNAGQAPLTVGQQLKKSIRQSFRKLK 2445
            MA ++F PF+K P QL                + +S C       G L+  +C  FD+ L L A+GT KG +KIYGSPG+ +T +     PI  + FL G+GR++  + +  + L+E       W + S I +   +   +IT + +               ++ +GS    + Q+ +     H   GDD L+  +  +IS+    DK   LG    +  ++  P  N L  I+Y+ G + +   +        +     +        +   T E E   PS   +EL    +++     VP  D+ +  GE T     D A E   S   K  +D+    + +A      +  ++P+  KL+E  +        P I+  +   + +   +W        + ++ VA  D     +  + + + ++ E      I P N           N            L  F   +       +  + VL+D       +  S ++DFVL              N  ++ S  SH  TLL+L E +L+A+D+   D    D PYL+  + S +T++T I QVP +L       A T  +   N  WP    + A+   ++       DI   GH++G + +W +        L  + +S +F+ A +     C  S             G   +   H  +  D  L I+ + ++L S   +  S+  A +   L  G + G V   V   +G       T  + D++ +  N     +++  IW D         +P+  + T ++    + +++V+LNP   +T+LA + +W  L+VG ++G  L+D      + +H T      A      S      +  G+Q+K +IR SFR+LK
Sbjct:    1 MAQRIFEPFRKLPHQLQNLDFVKRLHDYTLGKHTDSYCCYQSSAYGCLESPSCLAFDDILGLLAIGTSKGLLKIYGSPGVVFT-VQREGPPITSVLFLPGEGRIVCASIDGALHLFELDSSCGRWSLCSHIRVQQNVEQDRITCLCLGHG------------IIYIGSGNGTLRQVAV--KNGHMTLGDDTLTACTSSIISESVPADKRDQLGVDSPIVSLELQPQGNHLL-IAYAGGCVAVAVPQTVPSGSVTQPAVSVDG-------VTAPTAEGEVVTPS--VDELAPTITQETQGEAVPS-DKGETAGETTQSILNDSAVESTPSTPAKGHSDKRSTLMFKA-----LTRSLRPDTPKLEEQVEPSLPVPPAPRISHLLLRDQPVEWASWRVSTIDSLSTEVVVAYGDGAFQVWPIVAAVSDQLFEPIIVSMIDPPNTPYGPLPCGAINKILVNPSANGGLLTAFCGGLPRPQFENRYAVSVLQDHEHHVCYQFGSKVIDFVLIPSEGNMSNETVPGNFMTKPSAPSHSATLLVLTERELVAVDLTQPDWPAYDSPYLNCMDFSPVTAITHIGQVPSALIQRLHQAAHTTTDDITNCSWPIWGGSQADGNKKNLAQNAGNDIVALGHSNGWVTLWAIGRGDTTIHLGTLPTSSLFNSADLQNDQKCGSSALGEETWPPFRPVGYCSRAQRHTLEGCDPRLAISQLLILLGSPIRSGVSDSVAPDTLTLVVGGASGQVSLWVAGSEGFLHTPELTSFEPDVSRVYINLIDQSEEDKYIWKDAPCLRPTEGVPQYCTPTGLT---FHPSHLVQLNPPSQITSLALELSWNLLAVGSSHGFALLDLFNRSIIHTHFTYDSSGPAKIFNTVSTVQNVIMARGKQIKSNIRHSFRRLK 863          

HSP 2 Score: 131.724 bits (330), Expect = 1.031e-26
Identity = 139/514 (27.04%), Postives = 225/514 (43.77%), Query Frame = 1
Query: 2794 NKVPCLFAGTNAGAIFAFEISFEDNTDEMVKVKLSKELHLQHKAPILLLSITNS-NHVPFINPADQIGSYQRKFKNSDNLXXXXXXXXXXXXXXTKIADVEIGPSGDSENKEDAKQKSGTLPSPVVQEEIIEPTDGVRRSIDSSKDKINPTNINMKKSGTLPASFLQAIGKSQGSSDSHEFLVVSEEQVKIFSLPSLKAKYKYKVVDTGHHFSHSKTAA--GSQEPEQAQDKKNDNATTEVQIENANLKAPIR-RISSVGLCKVRGLKSTGDK--WSVSLALTNGEIVVLHISNLKK---------YLSNVFNH-----FSSNILAGISN----GEMNLIISYSHKFNVQITDFSQNNFHRFEPSVSIQIPKSARPVVEVKAETDTKPTEAVEVKSETVEIEPIVNGHGHEVVNGHEDDEEKD--QMGDEAVVQNASAVHH---------GDITMDSIKEYITNIDGNVTIKTFESSKEKQINVDGGQIVTTIHEKQIKDGEIIKDDIVKITSD 4230
            ++ P ++ GT++G   A+ +S++ NT   VK  L KE+   H +PI+ L I ++ NH P +        + + ++NS                               E+ E  +QK  T PS    E   E          S KD    T I M+ +              Q + D H+ L+ SEE+VK+FSLPSL+A Y +K VD       S T+    + +PE+  +++ D A  E +    N     R R++  GL           K  W+    L +G+I VL + +L+K         YL +   +     F+++I   I       E+  I S  + F V + +   ++F      V+I++P  AR  ++  A  +    +  +  S        VNG      N   D+ + D   + +E ++  A  V+          GD+T+DSIKEY+   D  + +KT E S EK+  V+GG+I TT+HE +  DG++ KDDIVK  +D
Sbjct:  992 DRTPSIWVGTSSGKALAYSLSWK-NTSGPVKATLCKEIQSHHHSPIVSLDIVDAINHGPIM--------HSQAYRNSC-----------------------------IESDESTEQKESTKPSETPAEVTTE----------SVKD----TEIPMQST--------------QSTQDIHQLLLCSEEKVKLFSLPSLRAIYDHKFVDRLRMLGMSLTSGTGSTSKPEKDVNEEADAAVGESETAYVNASQVNRKRVTGFGLQNFTSGSGENTKLEWNAVATLLDGQIAVLSLPSLRKVFKERCYPGYLPSTLPYVATRTFNTHIFWFIGCRLLVSELTPIPSL-NSFAVPVNNVITDDF------VAIRLPDWAR--IKKGAPVEDDILKVTQTAS--------VNGSPQIAGNFATDETKIDFIPVVEEEIIPTAKKVNDITLENGQNAGDVTLDSIKEYLNGTDVTLVVKTTELSTEKRTLVEGGKITTTVHEVEKIDGKVTKDDIVKFVTD 1422          
BLAST of LLGL scribble cell polarity complex component 2 vs. TrEMBL
Match: A0A4Z2CPT0 (Lethal(2) giant larvae protein 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_008475 PE=4 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 1.374e-33
Identity = 204/897 (22.74%), Postives = 359/897 (40.02%), Query Frame = 1
Query:   58 MASKLFAPFKKFPQQLPIXXXXXXXXXXASMANYNSIC-------GMLDDVTCNCFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDD-LSIDSDHVISKIQDLDKTYDLG---GVDKIQFNPDQNSLFYISYSNGMLLILXXXXXXXXXXXXXXXXXXXXXHDEKLIVTGTTEEESKKPSEATNELKLPESEDITSSEVPKIDENKEQGEKT-----DEAEEVAKSEIVKSKADEEIQKLDEAKPEVQKSEDIKPEIKKLKESTQVPYAHVELPAITKYVFSGKKILAVNWA-------NDKIAVAQEDSESICFYDIGSDNFKISESEKTVTI-PENFQTSLAKFSFCN------------LKNFNLTILMAHSNEKNILIVLKDDSKSTEIKTPSNIVDFVLTT------------NNFSELSKQSH--TLLILCESQLXXXXXXXXXXXXXXCPYLSLNNTSHITSLTSIIQVPPSLFPN----ASTVNELFKN--WPFRNENCANEKHED---ELLIDIFGSGHADGTIKIWQVLPSGVLNLLIKVESSEIFHQA-VSEVNACSQSN------------GISKQVGCHLTDSEDNLLQITNIQLMLHST--NSFSEPSANELFCL-TGNSCGTV--LVFKYDG-------TDNKGDLTEISANF----DKEGIIWNDCE-------IPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKA------SNAGQAPLTVGQQLKKSIRQSFRKLK 2445
            MA ++F PF+K P QL                + +S C       G L+  +C  FD+ L L A+GT KG +KIYGSPG+ +T +     PI  + FL G+GR++  + +  + L+E       W + S I +   +   +IT + +               ++ +GS    + Q+ +     H   GDD L+  +  +IS+    DK   LG    +  ++  P  N L  I+Y+ G + +   +        +     +        +   T E E   PS   +EL    +++     VP  D+ +  GE T     D A E   S   K  +D+      +A      +  ++P+  KL+E  +        P I+  +   + +   +W        + ++ VA  D     +  + + + ++ E      I P N           N            L  F   +       +  + VL+D       +  S ++DFVL              N  ++ S  SH  TLL+L E +L+A+D+   D    D PYL+  + S +T++T I QVP +L       A T  +   N  WP    + A+   ++       DI   GH++G + +W +        L  + +S +F+ A +     C  S             G   +   H  +  D  L I+ + ++L S   +  S+  A +   L  G + G V   V   +G       T  + D++ +  N     +++  IW D         +P+  + T ++    + +++V+LNP   +T+LA + +W  L+VG ++G  L+D      + +H T      A      S      +  G+Q+K +IR SFR+LK
Sbjct:    1 MAQRIFEPFRKLPHQLQNLDFVKRLHDYTLGKHTDSYCCYQSSAYGCLESPSCLAFDDILGLLAIGTSKGLLKIYGSPGVVFT-VQREGPPITSVLFLPGEGRIVCASIDGALHLFELDSSCGRWSLCSHIRVQQNVEQDRITCLCLGHG------------IIYIGSGNGTLRQVAV--KNGHMTLGDDTLTACTSSIISESVPADKRDQLGVDSPIVSLELQPQGNHLL-IAYAGGCVAVAVPQTVPSGSVTQPAVSVDG-------VTAPTAEGEVVTPS--VDELAPTITQETQGEAVPS-DKGETAGETTQSILNDSAVESTPSTPAKGHSDKRSTLKFKA-----LTRSLRPDTPKLEEQVEPSLPVPPAPRISHLLLRDQPVEWASWRVSTIDSLSTEVVVAYGDGAFQVWPIVAAVSDQLFEPIIVSMIDPPNTPYGPLPCGAINKILVNPSANGGLLTVFCGGLPRPQFENRYAVSVLQDHEHHVCYQFGSKVIDFVLIPSEGNMSNETVPGNFMTKPSAPSHSATLLVLTERELVAVDLTQPDWPAYDSPYLNCMDFSPVTAITHIGQVPSALIQRLHQAAHTTTDDITNCSWPIWGGSQADGNKKNLAQNAGNDIIALGHSNGWVTLWAIGRGDTTIHLGTLPTSSLFNSADLQNDQKCGSSALGEETWPPFRPVGYCSRAQRHTLEGCDPRLAISQLLILLGSPIRSGVSDSVAPDTLTLVVGGASGQVSLWVAGSEGFLHTPELTSFEPDVSRVYINLIDQSEEDKYIWKDAPCLRPTEGVPQYCTPTGLTF---HPSHLVQLNPPSQITSLALELSWNLLAVGSSHGFALLDLFNRSIIHTHFTYDSSGPAKIFNTVSTVQNVIMARGKQIKSNIRHSFRRLK 863          

HSP 2 Score: 131.724 bits (330), Expect = 8.204e-27
Identity = 139/514 (27.04%), Postives = 226/514 (43.97%), Query Frame = 1
Query: 2794 NKVPCLFAGTNAGAIFAFEISFEDNTDEMVKVKLSKELHLQHKAPILLLSITNS-NHVPFINPADQIGSYQRKFKNSDNLXXXXXXXXXXXXXXTKIADVEIGPSGDSENKEDAKQKSGTLPSPVVQEEIIEPTDGVRRSIDSSKDKINPTNINMKKSGTLPASFLQAIGKSQGSSDSHEFLVVSEEQVKIFSLPSLKAKYKYKVVDTGHHFSHSKTAA--GSQEPEQAQDKKNDNATTEVQIENANLKAPIR-RISSVGLCKVRGLKSTGDK--WSVSLALTNGEIVVLHISNLKK---------YLSNVFNH-----FSSNILAGISN----GEMNLIISYSHKFNVQITDFSQNNFHRFEPSVSIQIPKSARPVVEVKAETDTKPTEAVEVKSETVEIEPIVNGHGHEVVNGHEDDEEKD--QMGDEAVVQNASAVHH---------GDITMDSIKEYITNIDGNVTIKTFESSKEKQINVDGGQIVTTIHEKQIKDGEIIKDDIVKITSD 4230
            ++ P ++ GT++G   A+ +S++ NT   VK  L KE+   H +PI+ L I ++ NH P +        + + ++NS                               E+ E  +QK  T PS    E   E          S KD    T I M+ +              Q + D H+ L+ SEE+VK+FSLPSL+A Y +K VD       S T+    + +PE+  +++ D A  E +    N     R R++  GL           K  W+    L +G+I VL + +L+K         YL +   +     F+++I   I       E+  I S  + F V + +   ++F      V+I++P  AR   +   E D         ++ +V+  P + G      N   D+ + D   + +E ++  A  V+          GD+T+DSIKEY+   D  + +KT E S EK+  V+GG+I TT+HE +  DG++ KDDIVK  +D
Sbjct:  992 DRTPSIWVGTSSGKALAYSLSWK-NTSGPVKATLCKEIQSHHHSPIVSLDIVDAINHGPIM--------HSQAYRNSC-----------------------------IESDEATEQKESTKPSETPAEVTTE----------SVKD----TEIPMQST--------------QSTQDIHQLLLCSEEKVKLFSLPSLRAIYDHKFVDRLRMLGMSLTSGTGSTSKPEKDVNEEADAAVGESETAYVNASQVNRKRVTGFGLQNFTSGSGENTKLEWNAVATLLDGQIAVLSLPSLRKVFKERCYPGYLPSTLPYVATRTFNTHIFWFIGCRLLVSELTPIPSL-NSFAVPVNNVITDDF------VAIRLPDWARIKKDAPVEDDILKV----TQTASVDESPQIAG------NFATDETKIDFIPVVEEEIIPTAKKVNDITLENGQNVGDVTLDSIKEYLNGTDVTLVVKTTELSTEKRTLVEGGKITTTVHEVEKIDGKVTKDDIVKFVTD 1422          
BLAST of LLGL scribble cell polarity complex component 2 vs. TrEMBL
Match: A0A504YG94 (Putative Neurocalcin OS=Fasciola gigantica OX=46835 GN=FGIG_11027 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.677e-29
Identity = 149/529 (28.17%), Postives = 244/529 (46.12%), Query Frame = 1
Query: 2776 TSLSSSNKVPCLFAGTNAGAIFAFEISFEDNTDEMVKVKLSKELHLQHKAPILLLSITNSNHVPFINPADQIGSYQRKFKNSDNLXXXXXXXXXXXXXXTKIADVEIGPSG-DSENKEDAKQKSGTLPSPVVQEEIIEPTDGVRRSIDSSKDKINPTNINMKKSGTLPASFLQAIGKSQGSSDSHEFLVVSEEQVKIFSLPSLKAKYKYKVVD-------TGHHFSHSKTAAGSQEPEQAQDKKNDNATTEVQIENANLKAPIRRISSVGL-CKVR-GLKSTGDKWSVSLAL--TNGEIVVL----HISNLKKYLSNVFNHFSSNILAGISNGEMNLIISYSHKFNVQITDFSQ--NNFH----RFEPSVSIQIPKSARP----VVEVKAETDTKPTEAVEVKSETVEIEPIVNGHGHEV----------VNGHEDDEEKDQMGDEAVVQNASAVHHGDITMDSIKEYITNIDGNVTIKTFESSKEKQINVDGGQIVTTIHEKQIKDGEIIKDDIVKITSDTRESNELL 4254
            T   ++ + P L+ GT+ G   A+ + + D T   VKV+L KEL L+H+API+ + + ++           + S  RK +NS                       E  PS  D   ++ ++++SG  P+P        PT  ++   D ++              TL              +D H+FLV S+EQVK+FSLP+L+A +K+K VD        G     S T     E + A   ++  A  E + +        + ++++G+ C  R G     D+W V        G I+ L     I  L+KY+    +    + ++ +S   + L       F  ++T   +  ++F     R  PS+++ +P+ ARP     +EV  ET   PT  V    E+ + EP     G  V          ++ H + +++ +M D+A+     A   GD+T+DSIKEY+ N D  VT+KTFESS EK   V+GG+IVTT+HE +  DG+++KDD+VK TSD   +  ++
Sbjct:  473 TQPKATKRTPSLWVGTSNGRAIAYVLKW-DGTQGSVKVQLLKELQLRHQAPIIGMYVIDAGS------KSPVSSTLRK-RNS----------------------CEPPPSAVDVPVEKPSEEESGECPTP--------PTVDIKPVSDEAR--------------TL--------------ADVHQFLVCSDEQVKLFSLPALRALHKHKYVDRIRLPYGVGQITLTSDTPNTKSEKQVADPAEHGEAVGEEESKGQQYHR--KSLTAIGVQCFTRDGSDQPKDEWFVVAVRRDCKGSILTLPHLRQICKLRKYVDA--DVHPVHCVSSLSTANLILWNVGRQLFVQELTSVPRLLSSFCCAPGRSSPSLTLTLPEWARPGDATQLEVTDETQ-NPTLNVMPAMESSD-EPTTEIVGPSVEDQARVSEKPISYHNERDQEMKMPDDAIPGVPQA---GDLTLDSIKEYL-NGDNMVTVKTFESSTEKHTLVEGGRIVTTLHETEKIDGKVMKDDVVKFTSDGENTTPMI 925          
BLAST of LLGL scribble cell polarity complex component 2 vs. TrEMBL
Match: A0A5K4FD99 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.369e-28
Identity = 150/531 (28.25%), Postives = 242/531 (45.57%), Query Frame = 1
Query: 2746 STVGSLLIVYTSLSSSNKVPCLFAGTNAGAIFAFEISFEDNTDEMVKVKLSKELHLQHKAPILLLSITNS-NHVPFINPADQIGSYQRKFKNSDNLXXXXXXXXXXXXXXTKIADVEIGPSGDSENKEDAKQKSGTLPSPVVQEEIIEPTDGVRRSIDSSKDKINPTNINMKKSGTLPASFLQAIGKSQGSSDSHEFLVVSEEQVKIFSLPSLKAKYKYKVVDTGHHFSHSKT--AAGSQEPEQAQDKKNDNAT---TEVQIENANLKAPIRRISSVGLCKVRGLKSTGDK--WSVSLALTNGEIVVLHISNLKK---------YL---------SNVFN-HFSSNILAGISNGEMNLIISYSHKFNVQITDFSQNNFHRFEPSVSIQIPKSARPV---VEVKAETDTKPTEAVEVKSETVEIEPIVNGHGHEVVNG-----HEDDEEKDQMGDEAVVQNASAVHHGDITMDSIKEYITNIDGNVTIKTFESSKEKQINVDGGQIVTTIHEKQIKDGEIIKDDIVKITSDT 4233
            S V  LL   T + + ++ P ++ GT +G + AF +S+   T   V   LSKEL L H +PI+ L I ++ +H P +        + + ++NS                      VE   SG+S  K+++ Q S T P+ V       P DG +     ++  I PT+                      + D H+ L+ SEEQVK+FS+PSL+  YK+K +D       S T  A  + +PE+   ++  +A    +EV   N +   P +R++  GL           K  W+    L +G+I VL + NL+K         YL         +  FN H   +I   +   E+N I S +      ++D   ++F      ++I +P+ AR     V V+ E + K +    + SE   ++   N    E  NG      E+    ++M D  +++N   +  GD+T+DSIKEY+   D  + +KT E S EK+  V+GG+I TT+HE +  DG+I KDD+VK   D+
Sbjct:  970 SAVRCLLFSETYIQAGDRAPSIWVGTGSGKVLAFNLSWR-GTAGPVTATLSKELQLHHHSPIVSLYIIDAVDHGPIM--------HSQAYRNSC---------------------VE---SGESNEKQESTQPSET-PAEV-------PMDGGK----DTETPIQPTST---------------------TQDIHQLLLCSEEQVKLFSIPSLRPVYKHKFIDRLRMLGMSVTSGAGSTSKPEKEVTEEAGDAVVGESEVVYVNTSQINP-KRVTGFGLQNFTSGSGENAKLEWNAVATLLDGQIAVLSLPNLRKVFKERCYSGYLPSSTLPCVATRTFNTHVFWSIGCRLLVSELNPIPSLNSSAT-PVSDVITDDF------IAIHLPEWARTTNKDVSVENE-NLKISNQTNLASE--PLQSTENITTDEKTNGCAPVVEEEIIPTNKMND-TILENGQNI--GDVTLDSIKEYLNGTDVTMVVKTTELSTEKRTLVEGGKITTTVHEVEKVDGKITKDDVVKFVGDS 1420          

HSP 2 Score: 132.494 bits (332), Expect = 5.010e-27
Identity = 199/921 (21.61%), Postives = 373/921 (40.50%), Query Frame = 1
Query:   58 MASKLFAPFKKFPQQLP-------IXXXXXXXXXXASMANYNSICGMLDDVTCNCFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDD-LSIDSDHVISKIQDLDKTYDLG---GVDKIQFNPDQNSLFYISYSNGMLLILXXXXXXXXXXXXXXXXXXXXXHDEKLIVTGTTEEESKKPSEATNELK--LPESE--DITSSEVPKIDENKEQGEKTDEAEEVAKSEIVKSKADE----EIQKLDEA-KPEVQKSEDIKPEIKKLKESTQVPYAHVELPAITKYVFSGKKILAVNWANDKI-AVAQEDSESICFYDIGSDNFKI-----SESEKT-----VTIPENFQTSLAKFSFCNLKNFNLTILMAHSNEKNILIV------------------LKDDSKSTEIKTPSNIVDFVLTTNNFSELSKQ--------------SHTLLILCESQLXXXXXXXXXXXXXXCPYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFKN------WP-FRNENCANEKHEDELLIDIFGSGHADGTIKIWQV-----------LPSGVLNLLIKVESSEIFHQAVSE---------VNACSQSNGISKQVGCHLTDSEDNLLQITNIQLMLHST--NSFSEPSANELFCLTGNSCGTVLVFKYDGTDN----------KGDLTEISANF----DKEGIIWNDC-------EIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTI------QRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPAT 2463
            MA ++  PF+K P QL        I   +  K  D+   + +S  G  +  +   FD  L L A+GT KG +KIYGSPGI +T +     P+  L FL G+GR++  + +  + L+E       W   S + +        IT + +               ++ +GS++  + Q+ +     H   GDD L+  +  +IS    +DK   LG    +  ++  P  N L  I+Y+ G + +   +    +   +     +        +VT  T +         +EL   +P+    + T  +  +++  K Q    D A E   S   K  +++    +++ L  + +P+  K+E      K+++ S  VP A    P I+  +   +    V WA+ ++ +V    +E +  Y  G   F++     + S++      V++ +   T         +K     IL++ S    +L V                  L+D       +  S ++DFVL  +  S  ++               S TLL+L E +L+AID+   D    D PYL+  + + +T++T I QVPP+L        ++  +      WP +   +  N+        D+   GH++G + +W +           LP+  L  L  +++ +    ++ E         V  CS++   S        ++ D  L IT + ++L S   +  S+  A +   L     G  +     G++           + D+  I  N     D+   +W D         +P   + T ++     L   ++LNP   +T+LA + +W  L++G ++G  L+D      + +H T       + ++  +      +  G+QL  ++RQSFR+LK  + +T
Sbjct:    1 MAQRILEPFRKLPHQLQNLEIVKRIHDYTLGKHTDSYSCHQSSAYGCPESPSALAFDEFLGLLAIGTSKGLVKIYGSPGIVFT-VQREGSPVISLLFLPGEGRIVCASADGTLDLFELDSRCGRWSSTSRVKVQQTGEQDLITCMCLGHG------------VIYIGSASGTLRQVAV--KNGHMTLGDDALTACTSSIISDSVPVDKRDQLGVDSPIISLELQPQGNHLL-IAYAGGCVAVAIPQPIPLESVTQPAAPAD--------VVTAPTAQGEVVTPNVVDELAPTIPQEPQGEATPGDKSEVNGEKSQPLSNDSAVESTPSTPAKGHSEKRSTLKLKALTRSLRPDASKTE------KEVEPSLPVPPA----PRISHLLLRDQP---VEWASWRVTSVDSLSTEVVVAY--GDGAFQVWPIVAAVSDQPFEPIIVSMIDPPNTPYGPLPCGAIKK----ILISPSANAGLLTVFCGGLPRPQFENRYAVSVLQDHEHHVCYQFGSKVIDFVLVPSEGSVSNETVSGEVVTKPCPPSYSATLLVLTERELVAIDLTQPDWPVYDSPYLNCMDFTPVTAITHIGQVPPALIHRLHQAAQITSDDITNCSWPIWGGSHNGNKNFSQNPGNDVIVLGHSNGWVTLWAIGRADTTIHLGTLPTSSLFNLTDLQNGQKCGNSILEEETWPPFRPVGYCSRAQRQS-------IENYDPRLAITQLLVLLGSPIRSGVSDSVAPDTLTLVVGGAGGQVSLWVAGSEGFLHAPELSSFEPDVFRICVNLIDHSDENKYVWKDALSLRPTEGVPHYCTPTGLTFHPCQL---IQLNPPSQITSLALELSWNLLAIGSSHGFALLDLFDRSIIHAHFTYDSSGPAKMVNAVATVQNVIMARGRQLTSTMRQSFRRLKHFRTST 868          
BLAST of LLGL scribble cell polarity complex component 2 vs. TrEMBL
Match: A0A1S8WTN0 (LLGL domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=X801_06283 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 3.115e-28
Identity = 113/348 (32.47%), Postives = 176/348 (50.57%), Query Frame = 1
Query: 3319 DSHEFLVVSEEQVKIFSLPSLKAKYKYKVVDTGHHFSHSKTAAGSQ--------EPEQAQDKKNDNATTEVQIENAN---------LKAPIRR-ISSVGLCK-VRGLKSTGD----KWSVSLALTNGEIVVLHISNLKK-YLSNVFNHFSSNILAGISN-GEMNLIISYSHKFNVQITDFSQNNFHRFE---------PS---VSIQIPKSARPVVEVKAETDTKPTEAVEVKSETVEIEPIVNGHGHEVVNGHEDDEEKDQMGDEAVVQN-------ASAVHHGDITMDSIKEYITNIDGNVTIKTFESSKEKQINVDGGQIVTTIHEKQIKDGEIIKDDIVKITSD 4230
            +SH+ L+ SEEQVK+F LPSL+A +K+K VD      HS  A  +         E   +  K  DNA T    E A          +  P R+ +++ G+   VRG   TG+    +W V +   +G+ V+L I +L+K + S  F   + + +  +S+    NL+  ++     Q+     ++  R           PS    ++ +P  ARP      E++    E   V +E V  E +VNG   E VNG  + +  + M   A ++          A H GD+TMDSIKEY+ N +G VTIKT E+S EK+  V+GGQ+VTT+HE +  DG++I+DD++K ++D
Sbjct: 1021 ESHQLLLCSEEQVKLFQLPSLRALHKHKFVDRIRLPGHSSAATATPSSNTTVTGEVAASAPKSGDNAETAEHPEPATEPETKPVTMVPQPHRKSLTAFGVQPFVRG---TGEHSKTEWDVVVTRYDGQAVILSIPHLRKLFKSRSFIDPTVHPVPCVSSLSSTNLVFWHA---GCQLILNELSSVPRLSSPALLTPGAPSPLQATVTLPDWARPREPAPVESEVS-KEPEAVATEEVVAEAVVNG---EAVNGTSEVQATETMDSAAPLEEKIGSALPTGAPHVGDVTMDSIKEYL-NGEGTVTIKTIETSSEKRTIVEGGQMVTTLHESERVDGKLIRDDVIKFSTD 1357          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Cavefish
Match: llgl1 (LLGL scribble cell polarity complex component 1 [Source:NCBI gene;Acc:103037820])

HSP 1 Score: 97.4413 bits (241), Expect = 9.756e-20
Identity = 104/392 (26.53%), Postives = 181/392 (46.17%), Query Frame = 1
Query: 1354 FNLTILMAHSNEKNILIVLKDDSKSTEIKTPSNIVDF--VLTTNNFSELSKQSHTLLILCESQLXXXXXXXXXXXXXXCPYLSLNNTSHITSLTSIIQVPPSLFPNASTVNE------LFKNWPF-RNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFDKEGIIWNDCE-IPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATKHTYTVN 2484
            F+  +  A   +++ L +L+D S+   +   S ++DF  V  T+  SE    S  L++L E +L+ ID+++     I  PYL+  ++S IT    I  VP  L+       +         NWP    +N A +  + EL++    +GH DGT++ W    SGV L  L K+ ++ IF       ++ +Q+        ++VGC    S+D  L I  I L  +S       +A ++          VL    + +D+  D+  +    D+EG  W   + +P    S   +   Q +  +V+  P   VTA+     W  ++ G ++G  L D+H+   V +  T+      S A + PL+  + LKKS+RQSFR+++K + + K    V+
Sbjct:  303 FSGGMPRASYGDRHCLTILQD-SQHVTLDFTSRVIDFFTVHCTDAHSEFDDPS-ALVVLLEEELVVIDLQTAGWPTIPAPYLAPLHSSAITCSYHISNVPTKLWERVVGAGQQQGSLQTHTNWPICGGKNLAPDPKQQELML----TGHEDGTVRFWDA--SGVSLRPLYKLSTANIFQTDCDHNDSLTQAGEEEWPPFRKVGCFDPYSDDPRLGIQKICLCKYSGKLVVAGTAGQVI---------VLYLSDEKSDHMIDVATVDLLQDREGFTWKGHDRLPPKSGSVVFAPGFQPV-VLVQCMPPAAVTAVTLHAEWNLIAFGTSHGFGLFDYHRRSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRVLVS 674          

HSP 2 Score: 76.6406 bits (187), Expect = 1.926e-13
Identity = 54/191 (28.27%), Postives = 93/191 (48.69%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEY--KIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDL-----SIDSDHVISKIQDLDKT-YDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            +D +L L A+GTK G IK+YGSPG+ +T ++     +  + FL GQGR++S+ ++N + LWE   + + S+ E + S ++         +A  ++     K + D    LL VG+           G   HF +   L     S+  D ++  + D  K    LG V+ +Q +P       I YS G++++
Sbjct:   42 YDPKLQLMAIGTKSGAIKVYGSPGVEFTGLHKDTATVTQMHFLHGQGRILSLLDDNTLHLWEIGQREQCSSLEEVCSFTIPCRTVIESTSATRVTVLLP-KLSCD----LLAVGTE----------GGGVHFLELPSLTLLDKSLFQDEIMQSVPDEYKCGKSLGPVESLQEHPQHPDKILIGYSRGLVVL 217          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Cavefish
Match: llgl1 (LLGL scribble cell polarity complex component 1 [Source:NCBI gene;Acc:103037820])

HSP 1 Score: 97.0561 bits (240), Expect = 1.026e-19
Identity = 104/392 (26.53%), Postives = 181/392 (46.17%), Query Frame = 1
Query: 1354 FNLTILMAHSNEKNILIVLKDDSKSTEIKTPSNIVDF--VLTTNNFSELSKQSHTLLILCESQLXXXXXXXXXXXXXXCPYLSLNNTSHITSLTSIIQVPPSLFPNASTVNE------LFKNWPF-RNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFDKEGIIWNDCE-IPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATKHTYTVN 2484
            F+  +  A   +++ L +L+D S+   +   S ++DF  V  T+  SE    S  L++L E +L+ ID+++     I  PYL+  ++S IT    I  VP  L+       +         NWP    +N A +  + EL++    +GH DGT++ W    SGV L  L K+ ++ IF       ++ +Q+        ++VGC    S+D  L I  I L  +S       +A ++          VL    + +D+  D+  +    D+EG  W   + +P    S   +   Q +  +V+  P   VTA+     W  ++ G ++G  L D+H+   V +  T+      S A + PL+  + LKKS+RQSFR+++K + + K    V+
Sbjct:  277 FSGGMPRASYGDRHCLTILQD-SQHVTLDFTSRVIDFFTVHCTDAHSEFDDPS-ALVVLLEEELVVIDLQTAGWPTIPAPYLAPLHSSAITCSYHISNVPTKLWERVVGAGQQQGSLQTHTNWPICGGKNLAPDPKQQELML----TGHEDGTVRFWDA--SGVSLRPLYKLSTANIFQTDCDHNDSLTQAGEEEWPPFRKVGCFDPYSDDPRLGIQKICLCKYSGKLVVAGTAGQVI---------VLYLSDEKSDHMIDVATVDLLQDREGFTWKGHDRLPPKSGSVVFAPGFQPV-VLVQCMPPAAVTAVTLHAEWNLIAFGTSHGFGLFDYHRRSPVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRVLVS 648          

HSP 2 Score: 76.6406 bits (187), Expect = 1.986e-13
Identity = 54/191 (28.27%), Postives = 93/191 (48.69%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEY--KIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDL-----SIDSDHVISKIQDLDKT-YDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            +D +L L A+GTK G IK+YGSPG+ +T ++     +  + FL GQGR++S+ ++N + LWE   + + S+ E + S ++         +A  ++     K + D    LL VG+           G   HF +   L     S+  D ++  + D  K    LG V+ +Q +P       I YS G++++
Sbjct:   16 YDPKLQLMAIGTKSGAIKVYGSPGVEFTGLHKDTATVTQMHFLHGQGRILSLLDDNTLHLWEIGQREQCSSLEEVCSFTIPCRTVIESTSATRVTVLLP-KLSCD----LLAVGTE----------GGGVHFLELPSLTLLDKSLFQDEIMQSVPDEYKCGKSLGPVESLQEHPQHPDKILIGYSRGLVVL 191          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Cavefish
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:103026969])

HSP 1 Score: 74.7146 bits (182), Expect = 8.686e-13
Identity = 73/306 (23.86%), Postives = 130/306 (42.48%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELF------KNWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFD----KEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            PYL   + S IT    +  +P  L+       ++       K WP    +N A +  + +LL+    +GH DGT++ W    SGV L  + K+ ++ +FH      +  +Q         ++VGC    S+D  L I  I L  +S            +     + G +LV + +  D + + T  +   D    +EG  W      +L               +V+  P   VTA+A    W+ ++ G ++G  + D+ Q   V    T+    + +  G  PL+  + +KKS+RQSFR++++ +
Sbjct:  375 PYLVPLHCSAITCSHHVSSIPLKLWERVQAAGKVQNTHYSKKPWPINGGQNLAPDPPQRDLLL----TGHEDGTVRFWDA--SGVCLYPMYKLSTAMVFHTDADPNDNMNQGTEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-----------YLTVAGTAGQILVLEIN--DEEAEQTVEATVVDLLQGQEGFRWKGQARLDLREEPVTFPPGFQPFALVQCQPPAVVTAIALHSEWKLVAFGTSHGFGVYDYQQKNNVMVKCTLNPNDQVALEG--PLSRVKSIKKSLRQSFRRIRRSR 659          

HSP 2 Score: 61.6178 bits (148), Expect = 7.032e-9
Identity = 44/184 (23.91%), Postives = 90/184 (48.91%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKI-QDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            F   L L A+GT+ G IK+YG+PG+ +  ++     +  + FL  Q  L+++ ++N + +W  +      E+   + +  +  TG   AI  S +      +    ELL++G+    +F + + G    F + ++ +I  + V S++ ++     +L  V+ +Q NP       I YS G++++
Sbjct:   40 FSPSLELLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPRQVELVTLLDDNSLHMWTLRAHKGVSEL---LEIGRFTLTGPPGAIP-SVTRVTAVLAHSSGELLLLGTEGGHVFVVEVPG----FRELEENNISVEDVQSRVPEEYVGRRNLECVEALQENPLNPRQVLIGYSRGLMVL 215          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Cavefish
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:103026969])

HSP 1 Score: 74.3294 bits (181), Expect = 1.149e-12
Identity = 73/304 (24.01%), Postives = 129/304 (42.43%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELF------KNWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFD----KEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKK 2448
            PYL   + S IT    +  +P  L+       ++       K WP    +N A +  + +LL+    +GH DGT++ W    SGV L  + K+ ++ +FH      +  +Q         ++VGC    S+D  L I  I L  +S            +     + G +LV + +  D + + T  +   D    +EG  W      +L               +V+  P   VTA+A    W+ ++ G ++G  + D+ Q   V    T+    + +  G  PL+  + +KKS+RQSFR++++
Sbjct:  375 PYLVPLHCSAITCSHHVSSIPLKLWERVQAAGKVQNTHYSKKPWPINGGQNLAPDPPQRDLLL----TGHEDGTVRFWDA--SGVCLYPMYKLSTAMVFHTDADPNDNMNQGTEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-----------YLTVAGTAGQILVLEIN--DEEAEQTVEATVVDLLQGQEGFRWKGQARLDLREEPVTFPPGFQPFALVQCQPPAVVTAIALHSEWKLVAFGTSHGFGVYDYQQKNNVMVKCTLNPNDQVALEG--PLSRVKSIKKSLRQSFRRIRR 657          

HSP 2 Score: 61.6178 bits (148), Expect = 7.703e-9
Identity = 44/184 (23.91%), Postives = 90/184 (48.91%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKI-QDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            F   L L A+GT+ G IK+YG+PG+ +  ++     +  + FL  Q  L+++ ++N + +W  +      E+   + +  +  TG   AI  S +      +    ELL++G+    +F + + G    F + ++ +I  + V S++ ++     +L  V+ +Q NP       I YS G++++
Sbjct:   40 FSPSLELLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPRQVELVTLLDDNSLHMWTLRAHKGVSEL---LEIGRFTLTGPPGAIP-SVTRVTAVLAHSSGELLLLGTEGGHVFVVEVPG----FRELEENNISVEDVQSRVPEEYVGRRNLECVEALQENPLNPRQVLIGYSRGLMVL 215          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003126.1 (pep scaffold:Pmarinus_7.0:GL479844:18893:28646:-1 gene:ENSPMAG00000002854.1 transcript:ENSPMAT00000003126.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 5.843e-16
Identity = 76/307 (24.76%), Postives = 126/307 (41.04%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFK------NWP-FRNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGVLNLLIKVESSEIFHQAVSEVNACSQSNGISK----------QVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKK 2448
            PYLS  ++S IT    +  VP  L+   S      +      +WP     N   E  E  LL+    +GH DGT++ W    +G+  L I + ++ +F Q   E      S G+            +VGC    S+D  L I  I L   S              + G +   VL+ +        ++  ++ +   ++EG  W   E   +               ++++ P   VTAL     W  L+ G ++G  L D+ +   VF+  T+      + A + PL+  + LKKS+RQSFR+++K
Sbjct:    6 PYLSPLHSSAITCSCHVAAVPLRLWERVSATGRAQRALAPSASWPILGGRNLLPEPSERNLLL----TGHEDGTVRFWDASGAGLTPLYI-LSTAPLF-QTDGE-----HSEGLGPASDDEWPPFVKVGCFDPYSDDPRLGIQKISLCKFSGR----------LLVAGTAGQVVLIMELGDEAAVQEIAVVTVDLLKEREGFAWKGHERLVVRPGPRTLPAGYRPGLLLQVLPPAAVTALVLHAEWRLLAFGTSHGFGLFDYQKAHVVFARCTLH--PSETLALEGPLSRVKSLKKSLRQSFRRIRK 289          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003125.1 (pep scaffold:Pmarinus_7.0:GL479844:12808:29279:-1 gene:ENSPMAG00000002854.1 transcript:ENSPMAT00000003125.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 3.637e-15
Identity = 77/318 (24.21%), Postives = 128/318 (40.25%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFKN-----------WP-FRNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGVLNLLIKVESSEIFHQAVSEVNACSQSNGISK----------QVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANF--DKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATK 2466
            PYLS  ++S IT    +  VP  L+   S      +            WP     N   E  E  LL+    +GH DGT++ W    +G+  L I + ++ +F Q   E      S G+            +VGC    S+D  L I  I L   S              + G +   VL+ +        ++  ++ +   ++EG  W   E   +               ++++ P   VTAL     W  L+ G ++G  L D+ +   VF+  T+      + A + PL+  + LKKS+RQSFR+++K + + K
Sbjct:   85 PYLSPLHSSAITCSCHVAAVPLRLWERVSATGRAQRALAPSAVSSASSWPILGGRNLLPEPSERNLLL----TGHEDGTVRFWDASGAGLTPLYI-LSTAPLF-QTDGE-----HSEGLGPASDDEWPPFVKVGCFDPYSDDPRLGIQKISLCKFSGR----------LLVAGTAGQVVLIMELGDEAAVQEIAVVTVDLLKEREGFAWKGHERLVVRPGPRTLPAGYRPGLLLQVLPPAAVTALVLHAEWRLLAFGTSHGFGLFDYQKAHVVFARCTLH--PSETLALEGPLSRVKSLKKSLRQSFRRIRKSRVSGK 379          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003932.1 (pep scaffold:Pmarinus_7.0:GL482330:1953:13145:-1 gene:ENSPMAG00000003602.1 transcript:ENSPMAT00000003932.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 1.428e-11
Identity = 25/62 (40.32%), Postives = 42/62 (67.74%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWE 387
            +D +L L A+GTK G +KIYG+PG+ +T ++  +  +  L FL GQ R++S+ ++  + LWE
Sbjct:   16 YDPDLRLMAIGTKSGAVKIYGAPGVEFTGLHRDIAIVTQLHFLPGQARVVSLLDDGSLHLWE 77          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Nematostella
Match: EDO48036 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKR7])

HSP 1 Score: 79.7221 bits (195), Expect = 6.799e-15
Identity = 115/487 (23.61%), Postives = 209/487 (42.92%), Query Frame = 1
Query: 1150 KYVFSGKKILAVNWANDKIAVAQE-----DSESICFYDIGSDNFKISESEKTVT----IPENFQTSLAKFSFCNLKNFNLTILMAHSN--------------EKNILIVLKDDSKSTEIKTPSNIVDFV----LTTNNFSELSKQSHTLLILCESQLXXXXXXXXXXXXXXC--PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNE-------LFKNWPFRNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIF---HQAVSEVNACSQSNGIS--KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDL--TEISANFDKEGIIWND---CEIPELLSSTDIS-EKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATK 2466
            K +   KK L V W ++  +V Q      D ES+ ++  G D F  + ++ ++T    + ++  T      F       +T +  H N              +KN + +++  +        S ++DF+    LTT  F     +   L +LCE +L+ ID+++++        PYL+  ++S IT+       P  L+       +         ++WP        E  E +   DI  +GH DG+++ W V  S V + L+  + +S++F   H+         +  G    K+VG     S+D    +  I L           + N +  + GN  G +LV++ +  +   +L  TEI    DKE + W       + E    T    + +Q + +I    P+  +++LA  P W  L+ G  +G  L+D +  K V +  T+   S+  +A   P++  + LKKSIR SFR+L++ +  T+
Sbjct:  203 KILIGYKKGLTVLWNHESCSVQQTFPNSIDLESLSWHH-GGDKFISAHADGSLTEYTIVSDSETTGETSTPFGPFPCKAITKIEWHDNSVFFAGGMPRASYGDKNCISLVQGSTTQVVFDFTSRVIDFITVIPLTTVGFL---AEPACLAVLCEQELVVIDLKTKEQGYPTFMKPYLTCLHSSPITTSYHCHGCPSQLWNQICAAGKDQIQSEYSHESWPITGGKTLVEDAETK---DILITGHEDGSVQFWDV--SQVEMQLMYTLSTSKMFISDHEGHDNGTQEVEEEGWPPFKKVGNFDPFSDDPRFAVQKILL----------STENNMLTIAGNG-GQILVYEINDQEKDIELQVTEIDLVEDKEKLQWKGHGPLAVKEGAVCTPRGFQPVQGVQFI----PAAAISSLAVCPKWGALAAGTCHGFALLDTNTKKVVTTKCTVS--SEELSATGEPISRKKSLKKSIRDSFRRLRRSRKGTR 663          

HSP 2 Score: 63.1586 bits (152), Expect = 9.267e-10
Identity = 56/187 (29.95%), Postives = 88/187 (47.06%), Query Frame = 1
Query:  205 DNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISV---NNENEISLWEY--KIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            D +L L A+GT+ G ++I+G PG+  T  +     I  L FL  QGR+ISV     +N I LWE   K   S  E + + +L      G+  A       S KT        L++G+    I+ + I  N F      +  I  D V+  +Q+  KT + G V+ IQ +P+ ++   I Y  G+ ++
Sbjct:   46 DPKLNLLAIGTEDGTLRIFGRPGVQLTACHDNQTRIQELHFLPEQGRVISVCDDGEQNSIHLWEVNKKDGKSVLEEVKTCTLE-----GRCEARICICCLSMKTNR------LLLGTEGGNIYLLDI--NSFEL---QEYVIYQDVVMQSVQEDSKT-NAGSVEAIQEHPNDSNKILIGYKKGLTVL 215          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Medaka
Match: LLGL1 (LLGL scribble cell polarity complex component 1 [Source:NCBI gene;Acc:101167542])

HSP 1 Score: 89.3521 bits (220), Expect = 2.781e-17
Identity = 82/307 (26.71%), Postives = 137/307 (44.63%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFP---NASTVNE----LFKNWPF-RNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS---KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFDKEGIIWNDCE-IPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATK 2466
            PYL+  ++S IT    +  V   L+    NA    +      + WP    +N A    + ELL+    +GH DGT++ W    SGV L  L K+ ++ +FH    +     +        ++VGC    S+D  L I  I L  +S       +A ++  L  N          + +D+  D++ +    D+EG  W   + +   L         Q L  +  L P+  VTA+A    W  ++ G ++G  L D+H+   V +  T+      S A + PL+  + LKKS+RQSFR+++K + + K
Sbjct:  389 PYLAPLHSSAITCSCHVTNVSTKLWERLINAGKAQQSRRHTHRKWPICGGKNLAPPPRQQELLL----TGHEDGTVRFWDA--SGVALTPLYKLSTANVFHTDEMQQQQEEEEEEEWPPFRKVGCFDPYSDDPRLGIQKISLCKYSNKLVVAGTAGQVIVLGLND---------ERSDHLVDVSVMDLLQDREGFTWKGHDRLEPRLKPAPFLPGFQPLVLLQCLPPA-SVTAVALHTEWNLVAFGTSHGFGLFDYHRRNAVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGK 677          

HSP 2 Score: 66.6254 bits (161), Expect = 2.246e-10
Identity = 55/192 (28.65%), Postives = 91/192 (47.40%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWE--------MISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKT-YDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            FD +L L A+GTK G IKIYG+PG+ +T ++     +  + FL G+G L+SV ++N I  WE   E ST E        ++S   + +Y   G+      S +           +LL +G+    ++ + +   R    +   L    DHV   + D  +    LG V+ +Q +P Q     I YS G++++
Sbjct:   42 FDPKLQLMAIGTKSGAIKIYGAPGVEFTGLHKDTTAVTQILFLPGRGCLLSVLDDNTIHRWELVAE-STREVGGVKKEGVVSLREVDSYSLPGRPGIESSSATRVTVLLLLKSCDLLCMGTEGGGVYVLEL--PRLSLKENQTLL--QDHVTQSLPDDYRCGKSLGPVESLQEHPQQAGKILIGYSRGLVVL 228          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Medaka
Match: LLGL1 (LLGL scribble cell polarity complex component 1 [Source:NCBI gene;Acc:101167542])

HSP 1 Score: 85.1149 bits (209), Expect = 5.247e-16
Identity = 82/321 (25.55%), Postives = 137/321 (42.68%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFP---NASTVNE----LFKNWPF-RNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS-----------------KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFDKEGIIWNDCE-IPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATK 2466
            PYL+  ++S IT    +  V   L+    NA    +      + WP    +N A    + ELL+    +GH DGT++ W    SGV L  L K+ ++ +FH     ++                          ++VGC    S+D  L I  I L  +S       +A ++  L  N          + +D+  D++ +    D+EG  W   + +   L         Q L  +  L P+  VTA+A    W  ++ G ++G  L D+H+   V +  T+      S A + PL+  + LKKS+RQSFR+++K + + K
Sbjct:  391 PYLAPLHSSAITCSCHVTNVSTKLWERLINAGKAQQSRRHTHRKWPICGGKNLAPPPRQQELLL----TGHEDGTVRFWDA--SGVALTPLYKLSTANVFHTDGDPIDDPHDPCDDPEMQQQQEEEEEEEWPPFRKVGCFDPYSDDPRLGIQKISLCKYSNKLVVAGTAGQVIVLGLND---------ERSDHLVDVSVMDLLQDREGFTWKGHDRLEPRLKPAPFLPGFQPLVLLQCLPPA-SVTAVALHTEWNLVAFGTSHGFGLFDYHRRNAVLARCTLH--PNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGK 693          

HSP 2 Score: 67.3958 bits (163), Expect = 1.438e-10
Identity = 55/192 (28.65%), Postives = 91/192 (47.40%), Query Frame = 1
Query:  202 FDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWE--------MISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKT-YDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            FD +L L A+GTK G IKIYG+PG+ +T ++     +  + FL G+G L+SV ++N I  WE   E ST E        ++S   + +Y   G+      S +           +LL +G+    ++ + +   R    +   L    DHV   + D  +    LG V+ +Q +P Q     I YS G++++
Sbjct:   42 FDPKLQLMAIGTKSGAIKIYGAPGVEFTGLHKDTTAVTQILFLPGRGCLLSVLDDNTIHRWELVAE-STREVGGVKKEGVVSLREVDSYSLPGRPGIESSSATRVTVLLLLKSCDLLCMGTEGGGVYVLEL--PRLSLKENQTLL--QDHVTQSLPDDYRCGKSLGPVESLQEHPQQAGKILIGYSRGLVVL 228          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Medaka
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:101172480])

HSP 1 Score: 79.7221 bits (195), Expect = 2.464e-14
Identity = 77/307 (25.08%), Postives = 133/307 (43.32%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELF------KNWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFD----KEGIIW-NDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            PYL   ++S IT    +  +P  L+   S    L       K WP R  +N A +  + +LL+    +GH DGT++ W    SGV L+ + K+ ++ +FH      +  + S        ++VGC    S+D  L I  I L  +S            +     + G ++V + +  D   + T  +   D    +EG  W    ++             Q    +V+  P   VTAL     W+ ++ G ++G  L D+ Q K V    T+    + +  G  PL+  + +KKS+RQSFR++++ +
Sbjct:  393 PYLVPLHSSAITCSHHVSAIPLKLWERISAAGALQSTHYSKKLWPIRGGQNLAPDPPQRDLLL----TGHEDGTVRFWDA--SGVCLSPVYKLSTAAVFHTDADPNDNMNHSTEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-----------YLTVAGTAGQIMVLELN--DEAAEQTVEAQVVDLLQGQEGFRWKGHTQLDVREDPVQFPPGFQPFT-LVQCQPPAVVTALILHSEWKLVAFGTSHGFGLFDYQQKKNVLVKCTLNPSDQLAMEG--PLSRVKSIKKSLRQSFRRIRRSR 677          

HSP 2 Score: 65.0846 bits (157), Expect = 6.490e-10
Identity = 43/180 (23.89%), Postives = 88/180 (48.89%), Query Frame = 1
Query:  214 LYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQD-LDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            L L A+GT+ G IK+YG+PG+ +  ++     +  + FL  Q  L+++ ++N + +W  K      E+   + +  ++ TG   A+      +    +    ELL++G+    +F + + G    F + ++ +I  + V S++ D      +L  V+ +Q NP   +   I Y  G+L++
Sbjct:   64 LQLLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPHQVELVTLLDDNSLHMWTLKGHKGVSEL---LEIGRFVLTGPPGALPSVTRIT-AVLAHSSGELLLLGTEGGHVFVVEVPG----FRELEERNISLEQVTSRVPDNYIGRRNLEHVEALQENPADANQVVIGYGRGVLVV 235          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Medaka
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:101172480])

HSP 1 Score: 79.337 bits (194), Expect = 2.753e-14
Identity = 77/307 (25.08%), Postives = 133/307 (43.32%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELF------KNWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFD----KEGIIW-NDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLK 2454
            PYL   ++S IT    +  +P  L+   S    L       K WP R  +N A +  + +LL+    +GH DGT++ W    SGV L+ + K+ ++ +FH      +  + S        ++VGC    S+D  L I  I L  +S            +     + G ++V + +  D   + T  +   D    +EG  W    ++             Q    +V+  P   VTAL     W+ ++ G ++G  L D+ Q K V    T+    + +  G  PL+  + +KKS+RQSFR++++ +
Sbjct:  393 PYLVPLHSSAITCSHHVSAIPLKLWERISAAGALQSTHYSKKLWPIRGGQNLAPDPPQRDLLL----TGHEDGTVRFWDA--SGVCLSPVYKLSTAAVFHTDADPNDNMNHSTEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-----------YLTVAGTAGQIMVLELN--DEAAEQTVEAQVVDLLQGQEGFRWKGHTQLDVREDPVQFPPGFQPFT-LVQCQPPAVVTALILHSEWKLVAFGTSHGFGLFDYQQKKNVLVKCTLNPSDQLAMEG--PLSRVKSIKKSLRQSFRRIRRSR 677          

HSP 2 Score: 64.6994 bits (156), Expect = 7.907e-10
Identity = 43/180 (23.89%), Postives = 88/180 (48.89%), Query Frame = 1
Query:  214 LYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQD-LDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            L L A+GT+ G IK+YG+PG+ +  ++     +  + FL  Q  L+++ ++N + +W  K      E+   + +  ++ TG   A+      +    +    ELL++G+    +F + + G    F + ++ +I  + V S++ D      +L  V+ +Q NP   +   I Y  G+L++
Sbjct:   64 LQLLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPHQVELVTLLDDNSLHMWTLKGHKGVSEL---LEIGRFVLTGPPGALPSVTRIT-AVLAHSSGELLLLGTEGGHVFVVEVPG----FRELEERNISLEQVTSRVPDNYIGRRNLEHVEALQENPADANQVVIGYGRGVLVV 235          
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Medaka
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:101172480])

HSP 1 Score: 79.337 bits (194), Expect = 3.097e-14
Identity = 77/305 (25.25%), Postives = 132/305 (43.28%), Query Frame = 1
Query: 1585 PYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELF------KNWPFRN-ENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGV-LNLLIKVESSEIFHQAVSEVNACSQSNGIS----KQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFD----KEGIIW-NDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKK 2448
            PYL   ++S IT    +  +P  L+   S    L       K WP R  +N A +  + +LL+    +GH DGT++ W    SGV L+ + K+ ++ +FH      +  + S        ++VGC    S+D  L I  I L  +S            +     + G ++V + +  D   + T  +   D    +EG  W    ++             Q    +V+  P   VTAL     W+ ++ G ++G  L D+ Q K V    T+    + +  G  PL+  + +KKS+RQSFR++++
Sbjct:  423 PYLVPLHSSAITCSHHVSAIPLKLWERISAAGALQSTHYSKKLWPIRGGQNLAPDPPQRDLLL----TGHEDGTVRFWDA--SGVCLSPVYKLSTAAVFHTDADPNDNMNHSTEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-----------YLTVAGTAGQIMVLELN--DEAAEQTVEAQVVDLLQGQEGFRWKGHTQLDVREDPVQFPPGFQPFT-LVQCQPPAVVTALILHSEWKLVAFGTSHGFGLFDYQQKKNVLVKCTLNPSDQLAMEG--PLSRVKSIKKSLRQSFRRIRR 705          

HSP 2 Score: 64.6994 bits (156), Expect = 8.174e-10
Identity = 43/182 (23.63%), Postives = 89/182 (48.90%), Query Frame = 1
Query:  208 NELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQD-LDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLI 750
            + L L A+GT+ G IK+YG+PG+ +  ++     +  + FL  Q  L+++ ++N + +W  K      E+   + +  ++ TG   A+      +    +    ELL++G+    +F + + G    F + ++ +I  + V S++ D      +L  V+ +Q NP   +   I Y  G+L++
Sbjct:   62 SSLQLLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPHQVELVTLLDDNSLHMWTLKGHKGVSEL---LEIGRFVLTGPPGALPSVTRIT-AVLAHSSGELLLLGTEGGHVFVVEVPG----FRELEERNISLEQVTSRVPDNYIGRRNLEHVEALQENPADANQVVIGYGRGVLVV 235          
BLAST of LLGL scribble cell polarity complex component 2 vs. Planmine SMEST
Match: SMESG000018172.1 (SMESG000018172.1)

HSP 1 Score: 2511.1 bits (6507), Expect = 0.000e+0
Identity = 1374/1402 (98.00%), Postives = 1383/1402 (98.64%), Query Frame = 1
Query:   58 MASKLFAPFKKFPQQLPIXXXXXXXXXXASMANYNSICGMLDDVTCNCFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLILXXXXXXXXXXXXXXXXXXXXXHDEKLIVTGTTEEESKKPSEATNELKLPESEDITSSEVPKIDENKEQGEKTDEAEEVAKSEIVKSKADEEIQKLDEAKPEVQKSEDIKPEIKKLKESTQVPYAHVELPAITKYVFSGKKILAVNWANDKIAVAQEDSESICFYDIGSDNFKISESEKTVTIPENFQTSLAKFSFCNLKNFNLTILMAHSNEKNILIVLKDDSKSTEIKTPSNIVDFVLTTNNFSELSKQSHTLLILCESQLXXXXXXXXXXXXXXCPYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFKNWPFRNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGVLNLLIKVESSEIFHQAVSEVNACSQSNGISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATKHTYTVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLKETQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKERPLSTVGSLLIVYTSLSSSNKVPCLFAGTNAGAIFAFEISFEDNTDEMVKVKLSKELHLQHKAPILLLSITNSNHVPFINPADQIGSYQRKFKNSDNLXXXXXXXXXXXXXXTKIADVEIGPSGDSENKEDAKQKSGTLPSPVVQEEIIEPTDGVRRSIDSSKDKINPTNINMKKSGTLPASFLQAIGKSQGSSDSHEFLVVSEEQVKIFSLPSLKAKYKYKVVDTGHHFSHSKTAAGSQEPEQAQDKKNDNATTEVQIENANLKAPIRRISSVGLCKVRGLKSTGDKWSVSLALTNGEIVVLHISNLKKYLSNVFNHFSSNILAGISNGEMNLIISYSHKFNVQITDFSQNNFHRFEPSVSIQIPKSARPVVEVKAETDTKPTEAVEVKSETVEIEPIVNGHGHEVVNGHEDDEEKDQMGDEAVVQNASAVHHGDITMDSIKEYITNIDGNVTIKTFESSKEKQINVDGGQIVTTIHEKQIKDGEIIKDDIVKITSDTRESNELLLKE 4263
            MASKLFAPFKKFPQQLPIFKKSSDKFKDASMANYNSICGMLDDVTCNCFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSF WKTTSDDL+ELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVI KIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLILESKVKEEKDENKENEVTETKSHDEKLIVTGTTEEES+KPSEATNELKLPESEDITSSEVPKIDENKEQGEKTDEAEEVAKSEIVKSKAD+EIQKLDEAKPEVQKSEDIKPEIKKLKESTQVPYAHVELPAITKYVFSGKKILAVNWANDKIAVAQEDSESICFYD+GSDNFKISESEKTVTIPENFQTSLAKFSFCNLKNFNLTILMAHSNEKNILIVLKDDSKSTEIKTPSNIVDFVLTTNNFSELSKQSHTLLILCESQLIAIDIESEDLIEIDCPYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFKNWPFRNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGVLNLLIKVESSEIFHQAVSEVNACSQSNGISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLT+QRISKASNAGQ PLTVGQQLKKSIRQSFRKLKKLKPATKHTYTVNEEKAKDKEEAKSAEKEEEKEIVKPDDKEENL ETQQEDGENIEEKDKEEVKEHVD+TDNAVVASETV               KERPLSTVGSLLIVYTSLSSSNKVPCLFAGTNAGAIFAFEISFEDNTDEMVKVKLSKELHLQHKAPILLLSITNSNHVPFINPADQIGSYQRKFK+SDNLKSEEEKVEEDVHSETKIADVEIGPSGDSENKEDAKQKSGTLPSPVVQEEIIEPTDGVRRSIDSSKDKINPTNINMKKSGTLPASFLQAIGKSQGSSDSHEFLVVSEEQVKIFSLPSLKAKYKYKVVDTGHHFSHSKTAAGSQEPEQAQDKKNDNATTEVQIENANLKAPIRRISSVGLCKVRGLKSTGDKWSV++ALTNGEIVVLHISNLKKYLSNVFNHFSSNILAGISNGEMNLIISYSHKFNVQITDFSQNNFHRFEPSVSIQIPKSARPVVEVKAETDTKPTEAVEVKSETVEIEPIVNGHGHEVVNGHEDDEEKDQMGDEAVVQNASAVHHGDITMDSIKEYITNIDGNVTIKTFESSKEKQINVDGGQIVTTIHEKQIKDGEIIKDDIVKITSDTRESNELLLKE
Sbjct:    1 MASKLFAPFKKFPQQLPIFKKSSDKFKDASMANYNSICGMLDDVTCNCFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFPWKTTSDDLMELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVIPKIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLILESKVKEEKDENKENEVTETKSHDEKLIVTGTTEEESEKPSEATNELKLPESEDITSSEVPKIDENKEQGEKTDEAEEVAKSEIVKSKADDEIQKLDEAKPEVQKSEDIKPEIKKLKESTQVPYAHVELPAITKYVFSGKKILAVNWANDKIAVAQEDSESICFYDVGSDNFKISESEKTVTIPENFQTSLAKFSFCNLKNFNLTILMAHSNEKNILIVLKDDSKSTEIKTPSNIVDFVLTTNNFSELSKQSHTLLILCESQLIAIDIESEDLIEIDCPYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFKNWPFRNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGVLNLLIKVESSEIFHQAVSEVNACSQSNGISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTMQRISKASNAGQVPLTVGQQLKKSIRQSFRKLKKLKPATKHTYTVNEEKAKDKEEAKSAEKEEEKEIVKPDDKEENLNETQQEDGENIEEKDKEEVKEHVDETDNAVVASETVSPV------------KERPLSTVGSLLIVYTSLSSSNKVPCLFAGTNAGAIFAFEISFEDNTDEMVKVKLSKELHLQHKAPILLLSITNSNHVPFINPADQIGSYQRKFKSSDNLKSEEEKVEEDVHSETKIADVEIGPSGDSENKEDAKQKSGTLPSPVVQEEIIEPTDGVRRSIDSSKDKINPTNINMKKSGTLPASFLQAIGKSQGSSDSHEFLVVSEEQVKIFSLPSLKAKYKYKVVDTGHHFSHSKTAAGSQEPEQAQDKKNDNATTEVQIENANLKAPIRRISSVGLCKVRGLKSTGDKWSVAVALTNGEIVVLHISNLKKYLSNVFNHFSSNILAGISNGEMNLIISYSHKFNVQITDFSQNNFHRFEPSVSIQIPKSARPVVEVKAETDTKPTEAVEVKSETVEIEPIVNGHGHEVVNGHEDDEEKDQMGDEAVVQNASAVHHGDITMDSIKEYITNIDGNVTIKTFESSKEKQINVDGGQIVTTIHEKQIKDGEIIKDDIVKITSDTRESNELLLKE 1390          
BLAST of LLGL scribble cell polarity complex component 2 vs. Planmine SMEST
Match: SMESG000018172.1 (SMESG000018172.1)

HSP 1 Score: 2510.33 bits (6505), Expect = 0.000e+0
Identity = 1373/1402 (97.93%), Postives = 1382/1402 (98.57%), Query Frame = 1
Query:   58 MASKLFAPFKKFPQQLPIXXXXXXXXXXASMANYNSICGMLDDVTCNCFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTSDDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLILXXXXXXXXXXXXXXXXXXXXXHDEKLIVTGTTEEESKKPSEATNELKLPESEDITSSEVPKIDENKEQGEKTDEAEEVAKSEIVKSKADEEIQKLDEAKPEVQKSEDIKPEIKKLKESTQVPYAHVELPAITKYVFSGKKILAVNWANDKIAVAQEDSESICFYDIGSDNFKISESEKTVTIPENFQTSLAKFSFCNLKNFNLTILMAHSNEKNILIVLKDDSKSTEIKTPSNIVDFVLTTNNFSELSKQSHTLLILCESQLXXXXXXXXXXXXXXCPYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFKNWPFRNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGVLNLLIKVESSEIFHQAVSEVNACSQSNGISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKPATKHTYTVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLKETQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKERPLSTVGSLLIVYTSLSSSNKVPCLFAGTNAGAIFAFEISFEDNTDEMVKVKLSKELHLQHKAPILLLSITNSNHVPFINPADQIGSYQRKFKNSDNLXXXXXXXXXXXXXXTKIADVEIGPSGDSENKEDAKQKSGTLPSPVVQEEIIEPTDGVRRSIDSSKDKINPTNINMKKSGTLPASFLQAIGKSQGSSDSHEFLVVSEEQVKIFSLPSLKAKYKYKVVDTGHHFSHSKTAAGSQEPEQAQDKKNDNATTEVQIENANLKAPIRRISSVGLCKVRGLKSTGDKWSVSLALTNGEIVVLHISNLKKYLSNVFNHFSSNILAGISNGEMNLIISYSHKFNVQITDFSQNNFHRFEPSVSIQIPKSARPVVEVKAETDTKPTEAVEVKSETVEIEPIVNGHGHEVVNGHEDDEEKDQMGDEAVVQNASAVHHGDITMDSIKEYITNIDGNVTIKTFESSKEKQINVDGGQIVTTIHEKQIKDGEIIKDDIVKITSDTRESNELLLKE 4263
            MASKLFAPFKKFPQQLPIFKKSSDKFKDASMANYNSICGMLDDVTCNCFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSF WKTTSDDL+ELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVI KIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLILESKVKEEKDENKENEVTETKSHDEKLIVTGTTEEES+KPSEATNELKLPESEDITSSEVPKIDENKEQGEKTDEAEEVAKSEIVKSKAD+EIQKLDEAKPEVQKSEDIKPEIKKLKESTQVPYAHVELPAITKYVFSGKKILAVNWANDKIAVAQEDSESICFYD+GSDNFKISESEKTVTIPENFQTSLAKFSFCNLKNFNLTILMAHSNEKNILIVLKDDSKSTEIKTPSNIVDFVLTTNNFSELSKQSHTLLILCESQLIAIDIESEDLIEIDCPYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFKNWPFRNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGVLNLLIKVESSEIFHQAVSEVNACSQSNGISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLT+QRISKASNAGQ PLTVGQQLKKSIRQSFRKLKKLKPATKHTYTVNEEKAKDKEEAKSAEKEEEKEIVKPDDKEENL ETQQEDGENIEEKDKEEVKEHVD+TDNAVVASET                KERPLSTVGSLLIVYTSLSSSNKVPCLFAGTNAGAIFAFEISFEDNTDEMVKVKLSKELHLQHKAPILLLSITNSNHVPFINPADQIGSYQRKFK+SDNLKSEEEKVEEDVHSETKIADVEIGPSGDSENKEDAKQKSGTLPSPVVQEEIIEPTDGVRRSIDSSKDKINPTNINMKKSGTLPASFLQAIGKSQGSSDSHEFLVVSEEQVKIFSLPSLKAKYKYKVVDTGHHFSHSKTAAGSQEPEQAQDKKNDNATTEVQIENANLKAPIRRISSVGLCKVRGLKSTGDKWSV++ALTNGEIVVLHISNLKKYLSNVFNHFSSNILAGISNGEMNLIISYSHKFNVQITDFSQNNFHRFEPSVSIQIPKSARPVVEVKAETDTKPTEAVEVKSETVEIEPIVNGHGHEVVNGHEDDEEKDQMGDEAVVQNASAVHHGDITMDSIKEYITNIDGNVTIKTFESSKEKQINVDGGQIVTTIHEKQIKDGEIIKDDIVKITSDTRESNELLLKE
Sbjct:    1 MASKLFAPFKKFPQQLPIFKKSSDKFKDASMANYNSICGMLDDVTCNCFDNELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISVNNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFPWKTTSDDLMELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVIPKIQDLDKTYDLGGVDKIQFNPDQNSLFYISYSNGMLLILESKVKEEKDENKENEVTETKSHDEKLIVTGTTEEESEKPSEATNELKLPESEDITSSEVPKIDENKEQGEKTDEAEEVAKSEIVKSKADDEIQKLDEAKPEVQKSEDIKPEIKKLKESTQVPYAHVELPAITKYVFSGKKILAVNWANDKIAVAQEDSESICFYDVGSDNFKISESEKTVTIPENFQTSLAKFSFCNLKNFNLTILMAHSNEKNILIVLKDDSKSTEIKTPSNIVDFVLTTNNFSELSKQSHTLLILCESQLIAIDIESEDLIEIDCPYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFKNWPFRNENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGVLNLLIKVESSEIFHQAVSEVNACSQSNGISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEPSANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFDKEGIIWNDCEIPELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLVDFHQNKCVFSHLTMQRISKASNAGQVPLTVGQQLKKSIRQSFRKLKKLKPATKHTYTVNEEKAKDKEEAKSAEKEEEKEIVKPDDKEENLNETQQEDGENIEEKDKEEVKEHVDETDNAVVASETSPV-------------KERPLSTVGSLLIVYTSLSSSNKVPCLFAGTNAGAIFAFEISFEDNTDEMVKVKLSKELHLQHKAPILLLSITNSNHVPFINPADQIGSYQRKFKSSDNLKSEEEKVEEDVHSETKIADVEIGPSGDSENKEDAKQKSGTLPSPVVQEEIIEPTDGVRRSIDSSKDKINPTNINMKKSGTLPASFLQAIGKSQGSSDSHEFLVVSEEQVKIFSLPSLKAKYKYKVVDTGHHFSHSKTAAGSQEPEQAQDKKNDNATTEVQIENANLKAPIRRISSVGLCKVRGLKSTGDKWSVAVALTNGEIVVLHISNLKKYLSNVFNHFSSNILAGISNGEMNLIISYSHKFNVQITDFSQNNFHRFEPSVSIQIPKSARPVVEVKAETDTKPTEAVEVKSETVEIEPIVNGHGHEVVNGHEDDEEKDQMGDEAVVQNASAVHHGDITMDSIKEYITNIDGNVTIKTFESSKEKQINVDGGQIVTTIHEKQIKDGEIIKDDIVKITSDTRESNELLLKE 1389          
BLAST of LLGL scribble cell polarity complex component 2 vs. Planmine SMEST
Match: SMESG000019444.1 (SMESG000019444.1)

HSP 1 Score: 53.9138 bits (128), Expect = 9.328e-7
Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = 1
Query: 1252 GSDNFKISESEKTVTIPENFQTSLAKFSFCNLK 1350
            GSDNFK+ +S+KTVTI ENFQ SL KFSFC+LK
Sbjct:  298 GSDNFKVFKSDKTVTISENFQISLDKFSFCSLK 330          
The following BLAST results are available for this feature:
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LLGL19.943e-1524.20LLGL scribble cell polarity complex component 1 [S... [more]
LLGL19.943e-1524.20LLGL scribble cell polarity complex component 1 [S... [more]
LLGL15.533e-1324.52LLGL scribble cell polarity complex component 1 [S... [more]
LLGL15.533e-1324.52LLGL scribble cell polarity complex component 1 [S... [more]
LLGL29.771e-1124.19LLGL scribble cell polarity complex component 2 [S... [more]
back to top
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l(2)gl5.040e-1225.27gene:FBgn0002121 transcript:FBtr0078166[more]
l(2)gl5.271e-1225.27gene:FBgn0002121 transcript:FBtr0306592[more]
l(2)gl5.271e-1225.27gene:FBgn0002121 transcript:FBtr0306590[more]
l(2)gl5.271e-1225.27gene:FBgn0002121 transcript:FBtr0306589[more]
l(2)gl5.271e-1225.27gene:FBgn0002121 transcript:FBtr0306591[more]
back to top
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
llgl14.539e-2327.48LLGL scribble cell polarity complex component 1 [S... [more]
llgl14.634e-2327.48LLGL scribble cell polarity complex component 1 [S... [more]
llgl23.525e-1322.93LLGL scribble cell polarity complex component 2 [S... [more]
llgl23.525e-1322.93LLGL scribble cell polarity complex component 2 [S... [more]
llgl23.713e-1322.93LLGL scribble cell polarity complex component 2 [S... [more]
back to top
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LLGL14.405e-1829.58LLGL1, scribble cell polarity complex component [S... [more]
LLGL15.514e-1829.58LLGL1, scribble cell polarity complex component [S... [more]
LLGL15.753e-1829.58LLGL1, scribble cell polarity complex component [S... [more]
LLGL16.777e-1829.58LLGL1, scribble cell polarity complex component [S... [more]
LLGL17.793e-1829.58LLGL1, scribble cell polarity complex component [S... [more]
back to top
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Llgl15.783e-1524.35LLGL1 scribble cell polarity complex component [So... [more]
Llgl16.161e-1524.35LLGL1 scribble cell polarity complex component [So... [more]
Llgl23.919e-1024.72LLGL2 scribble cell polarity complex component [So... [more]
Llgl24.374e-1024.72LLGL2 scribble cell polarity complex component [So... [more]
Llgl29.411e-722.95LLGL2 scribble cell polarity complex component [So... [more]
back to top
BLAST of LLGL scribble cell polarity complex component 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K4K5|L2GL1_RAT1.743e-1524.52Lethal(2) giant larvae protein homolog 1 OS=Rattus... [more]
sp|Q8MKF0|L2GL1_BOVIN3.944e-1424.35Lethal(2) giant larvae protein homolog 1 OS=Bos ta... [more]
sp|Q80Y17|L2GL1_MOUSE4.046e-1424.35Lethal(2) giant larvae protein homolog 1 OS=Mus mu... [more]
sp|Q15334|L2GL1_HUMAN4.775e-1424.20Lethal(2) giant larvae protein homolog 1 OS=Homo s... [more]
sp|Q08470|L2GL_DROPS1.303e-1223.77Protein lethal(2) giant larvae OS=Drosophila pseud... [more]
back to top
BLAST of LLGL scribble cell polarity complex component 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U3N6C33.141e-3422.74Lethal giant larvae protein OS=Schistosoma japonic... [more]
A0A4Z2CPT01.374e-3322.74Lethal(2) giant larvae protein 1 OS=Schistosoma ja... [more]
A0A504YG943.677e-2928.17Putative Neurocalcin OS=Fasciola gigantica OX=4683... [more]
A0A5K4FD991.369e-2828.25Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A1S8WTN03.115e-2832.47LLGL domain-containing protein OS=Opisthorchis viv... [more]
back to top
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
llgl19.756e-2026.53LLGL scribble cell polarity complex component 1 [S... [more]
llgl11.026e-1926.53LLGL scribble cell polarity complex component 1 [S... [more]
llgl28.686e-1323.86LLGL scribble cell polarity complex component 2 [S... [more]
llgl21.149e-1224.01LLGL scribble cell polarity complex component 2 [S... [more]
back to top
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000003126.15.843e-1624.76pep scaffold:Pmarinus_7.0:GL479844:18893:28646:-1 ... [more]
ENSPMAT00000003125.13.637e-1524.21pep scaffold:Pmarinus_7.0:GL479844:12808:29279:-1 ... [more]
ENSPMAT00000003932.11.428e-1140.32pep scaffold:Pmarinus_7.0:GL482330:1953:13145:-1 g... [more]
back to top
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO480366.799e-1523.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LLGL scribble cell polarity complex component 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LLGL12.781e-1726.71LLGL scribble cell polarity complex component 1 [S... [more]
LLGL15.247e-1625.55LLGL scribble cell polarity complex component 1 [S... [more]
llgl22.464e-1425.08LLGL scribble cell polarity complex component 2 [S... [more]
llgl22.753e-1425.08LLGL scribble cell polarity complex component 2 [S... [more]
llgl23.097e-1425.25LLGL scribble cell polarity complex component 2 [S... [more]
back to top
BLAST of LLGL scribble cell polarity complex component 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000018172.10.000e+098.00SMESG000018172.1[more]
SMESG000018172.10.000e+097.93SMESG000018172.1[more]
SMESG000019444.19.328e-775.76SMESG000019444.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035336 ID=SMED30035336|Name=LLGL scribble cell polarity complex component 2|organism=Schmidtea mediterranea sexual|type=transcript|length=4995bp
CTTGAAAGAAAATTTAATTATTCTTTGTTTATCTGCGTTATCTAAACAAT
TTATCTTATGGCGTCAAAATTATTTGCTCCATTTAAGAAATTTCCTCAAC
AGTTACCAATTTTTAAGAAATCTAGTGACAAATTTAAAGATGCTTCAATG
GCAAATTATAATTCAATATGTGGAATGTTAGACGATGTTACATGTAATTG
TTTTGATAATGAGTTATATTTATTTGCCGTTGGCACAAAGAAGGGAGAAA
TTAAAATATATGGATCTCCTGGAATTGCTTATACACTTATCAACAGTCCA
CTGAAACCAATAAATTTTCTAAAATTTCTCAAAGGCCAAGGTCGACTAAT
ATCAGTTAATAATGAAAATGAAATATCATTATGGGAATATAAAATTGAAT
TGTCGACTTGGGAAATGATATCATCTATTTCATTATCTGCTTATATAAAC
ACAGGAAAAATAACAGCTATAGATATTAGTCAGTCTTTTTCCTGGAAGAC
AACTTCTGATGATTTATTGGAATTATTAGTTGTTGGTTCAAGCACTAATA
AAATTTTTCAAATTTTAATTATTGGCAATCGCTTTCATTTTTACGACGGC
GATGATCTGTCTATTGATTCAGATCATGTTATATCAAAAATTCAAGATTT
GGACAAAACTTATGATTTGGGAGGAGTAGATAAAATACAATTTAATCCCG
ATCAAAATTCATTGTTTTACATTTCATATTCCAATGGCATGCTACTTATA
TTGGAGAGTAAAGTTAAAGAAGAAAAGGACGAAAATAAGGAAAATGAAGT
CACAGAAACCAAATCTCATGATGAGAAATTAATTGTTACCGGTACTACTG
AAGAAGAAAGTAAAAAACCTTCAGAAGCTACTAATGAATTAAAATTGCCG
GAATCTGAAGATATAACCAGTAGTGAAGTTCCTAAAATTGATGAAAATAA
AGAACAAGGTGAGAAAACTGATGAAGCGGAGGAAGTAGCAAAATCTGAGA
TTGTTAAATCAAAGGCAGACGAAGAAATTCAAAAATTGGATGAGGCTAAA
CCAGAAGTTCAAAAATCTGAGGATATTAAACCAGAAATTAAGAAATTGAA
AGAATCGACTCAAGTGCCTTATGCTCATGTCGAATTACCCGCTATTACAA
AATATGTTTTTTCCGGCAAGAAAATATTAGCTGTTAACTGGGCAAATGAT
AAAATCGCAGTAGCGCAAGAAGATTCTGAATCTATTTGTTTCTATGACAT
TGGTAGTGATAATTTCAAAATATCTGAATCTGAAAAGACCGTTACTATTC
CCGAAAATTTTCAAACTTCGCTAGCCAAATTTTCGTTTTGCAATCTAAAA
AATTTTAATCTTACAATATTAATGGCACATTCAAACGAAAAAAATATTTT
AATTGTTCTTAAAGATGATAGTAAATCTACTGAAATAAAAACTCCTAGCA
ATATTGTAGATTTTGTACTTACAACAAATAATTTTTCAGAACTTTCAAAA
CAATCGCATACATTATTAATTCTCTGTGAATCTCAGTTAATTGCAATTGA
TATTGAAAGTGAAGATTTGATTGAAATTGACTGTCCTTATTTATCATTAA
ACAATACCAGTCATATTACCTCATTGACAAGTATAATACAGGTTCCTCCA
TCGCTTTTTCCAAATGCATCGACAGTAAATGAGTTGTTCAAAAACTGGCC
TTTTAGAAATGAAAATTGTGCAAACGAAAAACACGAAGATGAGTTACTAA
TTGACATATTCGGTAGCGGTCATGCAGATGGAACTATTAAAATATGGCAA
GTGTTGCCTTCTGGAGTGTTAAATTTACTCATCAAAGTAGAAAGTTCCGA
AATTTTTCACCAAGCAGTTTCTGAAGTAAATGCTTGTTCACAATCGAATG
GAATCAGTAAACAAGTCGGGTGTCATTTAACAGATTCTGAAGATAATTTA
TTACAAATAACAAACATTCAATTAATGTTGCATTCTACCAACAGTTTTTC
TGAACCTTCAGCAAATGAGTTATTCTGTTTAACTGGCAATTCTTGTGGGA
CAGTTCTGGTTTTCAAGTACGATGGAACTGACAATAAAGGTGATTTAACT
GAAATATCTGCCAATTTCGACAAAGAAGGTATTATATGGAATGATTGTGA
AATACCTGAATTATTGAGTAGCACTGATATTAGTGAGAAGCTACAGAATT
TGAATTATATCGTCAAACTCAATCCATCGCTACCTGTTACTGCTTTAGCG
TTTCAACCTGCTTGGGAATTCCTTAGTGTCGGATGTACAAATGGCTTGGT
ATTGGTGGATTTTCATCAGAATAAATGTGTTTTCTCCCATCTTACTATAC
AAAGAATTTCAAAAGCTAGTAATGCTGGCCAAGCCCCACTGACTGTTGGA
CAGCAGCTTAAAAAATCAATTCGGCAGTCATTTAGAAAACTCAAAAAATT
AAAACCAGCAACAAAGCATACTTATACAGTAAATGAAGAAAAGGCAAAAG
ATAAAGAGGAGGCTAAATCAGCGGAAAAGGAGGAAGAAAAAGAAATTGTG
AAACCAGATGATAAAGAAGAAAATCTAAAAGAAACCCAGCAAGAAGATGG
AGAAAATATTGAAGAAAAAGATAAAGAGGAAGTTAAAGAACATGTTGATG
ATACGGATAATGCTGTAGTAGCAAGTGAAACTGTTGTAGAGACAACCGAG
AACGAATTATTGACAATTGAAGTCACCCGAAAAGAACGTCCGCTTTCAAC
AGTTGGATCACTGCTGATTGTATATACCAGTTTGTCGTCATCTAATAAAG
TACCTTGCTTATTTGCCGGTACAAATGCTGGAGCTATATTTGCATTTGAA
ATCTCATTCGAGGACAATACAGACGAAATGGTGAAAGTAAAGCTATCAAA
GGAATTGCATTTGCAACACAAAGCACCAATTCTTCTATTGTCAATCACGA
ATTCCAATCATGTTCCGTTTATAAATCCTGCTGATCAAATCGGTTCTTAT
CAGAGAAAATTTAAAAATTCTGATAATTTGAAAAGTGAAGAGGAAAAAGT
TGAAGAAGATGTACATTCAGAAACAAAAATTGCAGATGTTGAAATCGGTC
CGTCCGGAGATTCAGAAAATAAGGAAGATGCTAAACAAAAATCTGGAACT
CTTCCATCACCTGTTGTACAAGAAGAAATTATAGAACCAACTGATGGTGT
TAGAAGGAGTATTGATTCAAGCAAAGATAAAATAAATCCTACAAATATCA
ATATGAAAAAATCAGGAACTTTGCCAGCATCATTTTTACAGGCAATTGGA
AAATCTCAGGGTTCTAGTGATTCTCATGAATTTCTAGTTGTCTCCGAAGA
ACAAGTTAAAATTTTCAGTTTGCCATCATTAAAGGCAAAGTATAAATATA
AAGTGGTAGATACAGGACATCATTTCAGTCATTCAAAAACAGCCGCCGGT
TCACAAGAACCAGAACAAGCACAGGATAAAAAAAATGATAATGCAACTAC
TGAAGTTCAAATTGAAAATGCGAATTTAAAAGCACCTATCCGTAGAATAT
CTTCTGTTGGCTTGTGTAAAGTGCGAGGTTTGAAATCAACAGGAGATAAA
TGGAGTGTGTCATTAGCACTTACGAATGGAGAAATCGTAGTTTTACACAT
CAGCAATCTTAAAAAATATTTATCAAATGTTTTCAATCATTTTTCAAGTA
ATATTTTAGCGGGAATTTCGAACGGAGAAATGAATTTAATAATTTCATAT
TCTCATAAATTTAATGTTCAAATAACAGATTTTAGTCAAAATAATTTCCA
TCGTTTTGAGCCATCTGTAAGCATACAGATTCCGAAATCGGCGCGACCAG
TTGTTGAAGTAAAAGCTGAAACAGACACAAAGCCGACCGAAGCTGTTGAA
GTCAAATCAGAGACTGTAGAAATTGAACCAATAGTCAATGGACATGGTCA
TGAAGTGGTTAATGGCCATGAAGATGATGAAGAAAAAGATCAAATGGGTG
ATGAAGCAGTAGTTCAAAATGCAAGCGCTGTTCATCATGGTGATATAACT
ATGGATTCGATTAAGGAATATATAACTAATATTGATGGCAATGTAACTAT
TAAAACATTCGAAAGTTCTAAAGAAAAGCAAATAAATGTTGATGGTGGAC
AAATCGTCACAACAATCCATGAAAAACAAATAAAAGACGGTGAAATTATC
AAAGATGATATTGTGAAGATAACTTCAGATACTCGTGAATCTAACGAACT
GTTATTGAAAGAATAAAGAATAATACCGGTAGGAATTGCAGAATTTCATT
TTTCTTGAGTTTTCTGATCATGACATTTTAGAATTGAGAGAAAAGTTTTG
ATTTTTCTCAATGTGAATTGTAAATTATTTTTATTTTTTCTAAATTTTGG
TTTTACAGAATGTTGTTAACTGTTTTGTTATTTTATTTTCGTTTTTTTTT
TACTAATTGAATTAACTGATTAATTATGTTAACGATCATTTTTAAATGGG
AATCCTTTACACATTTCCAAATCTATATTATATATATATGTTTGTAGGTG
TGTACTTGGTTATTATTATTATTATTGTGTGTTTGAATTTTCATAAATTT
ATTTTATGCCATTTTGTTTTGAGAATATTTATTTTATACATGTAATCCTA
TTGATATTATAATTTTGATATTACAATTATTTTATATAATTGTCGATAAC
CAGCACGTTTGATTTTACACAATATATATCTCCATTAGAATATTGATTGT
AGATTTATTGAAATTTTTGATTTTTATTGTAGACGAAATTCTACACATAT
ATAATATATATATGAATATAAGGGTCCACTTGAAATTGCTATTATTAAAG
TTTATTACTCTCCTATGCTTATGAACATTTATTTACAAAAAAACTAGTCA
TTCTTGGGAGTGGAATATTTTTTTCAGATCTTCTATTTACTTTGGTGTTG
AATATTTATTTAATGGTAATTTAGTTGAATATGTTAATACTTGTG
back to top

protein sequence of SMED30035336-orf-1

>SMED30035336-orf-1 ID=SMED30035336-orf-1|Name=SMED30035336-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1403bp
MASKLFAPFKKFPQQLPIFKKSSDKFKDASMANYNSICGMLDDVTCNCFD
NELYLFAVGTKKGEIKIYGSPGIAYTLINSPLKPINFLKFLKGQGRLISV
NNENEISLWEYKIELSTWEMISSISLSAYINTGKITAIDISQSFSWKTTS
DDLLELLVVGSSTNKIFQILIIGNRFHFYDGDDLSIDSDHVISKIQDLDK
TYDLGGVDKIQFNPDQNSLFYISYSNGMLLILESKVKEEKDENKENEVTE
TKSHDEKLIVTGTTEEESKKPSEATNELKLPESEDITSSEVPKIDENKEQ
GEKTDEAEEVAKSEIVKSKADEEIQKLDEAKPEVQKSEDIKPEIKKLKES
TQVPYAHVELPAITKYVFSGKKILAVNWANDKIAVAQEDSESICFYDIGS
DNFKISESEKTVTIPENFQTSLAKFSFCNLKNFNLTILMAHSNEKNILIV
LKDDSKSTEIKTPSNIVDFVLTTNNFSELSKQSHTLLILCESQLIAIDIE
SEDLIEIDCPYLSLNNTSHITSLTSIIQVPPSLFPNASTVNELFKNWPFR
NENCANEKHEDELLIDIFGSGHADGTIKIWQVLPSGVLNLLIKVESSEIF
HQAVSEVNACSQSNGISKQVGCHLTDSEDNLLQITNIQLMLHSTNSFSEP
SANELFCLTGNSCGTVLVFKYDGTDNKGDLTEISANFDKEGIIWNDCEIP
ELLSSTDISEKLQNLNYIVKLNPSLPVTALAFQPAWEFLSVGCTNGLVLV
DFHQNKCVFSHLTIQRISKASNAGQAPLTVGQQLKKSIRQSFRKLKKLKP
ATKHTYTVNEEKAKDKEEAKSAEKEEEKEIVKPDDKEENLKETQQEDGEN
IEEKDKEEVKEHVDDTDNAVVASETVVETTENELLTIEVTRKERPLSTVG
SLLIVYTSLSSSNKVPCLFAGTNAGAIFAFEISFEDNTDEMVKVKLSKEL
HLQHKAPILLLSITNSNHVPFINPADQIGSYQRKFKNSDNLKSEEEKVEE
DVHSETKIADVEIGPSGDSENKEDAKQKSGTLPSPVVQEEIIEPTDGVRR
SIDSSKDKINPTNINMKKSGTLPASFLQAIGKSQGSSDSHEFLVVSEEQV
KIFSLPSLKAKYKYKVVDTGHHFSHSKTAAGSQEPEQAQDKKNDNATTEV
QIENANLKAPIRRISSVGLCKVRGLKSTGDKWSVSLALTNGEIVVLHISN
LKKYLSNVFNHFSSNILAGISNGEMNLIISYSHKFNVQITDFSQNNFHRF
EPSVSIQIPKSARPVVEVKAETDTKPTEAVEVKSETVEIEPIVNGHGHEV
VNGHEDDEEKDQMGDEAVVQNASAVHHGDITMDSIKEYITNIDGNVTIKT
FESSKEKQINVDGGQIVTTIHEKQIKDGEIIKDDIVKITSDTRESNELLL
KE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016323basolateral plasma membrane
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
GO:0007049cell cycle
GO:0051301cell division
GO:0003407neural retina development
GO:0008593regulation of Notch signaling pathway
GO:0048919posterior lateral line neuromast development
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000110pharynx progenitor cell
PLANA:0000418head
PLANA:0000428musculature system
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0000478pharynx musculature
PLANA:0000484secretory system
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000664Lethal2_giant
IPR013577LLGL2
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding