MFS transporter

Overview
NameMFS transporter
Smed IDSMED30035333
Length (bp)1428
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MFS transporter (SMED30035333) t-SNE clustered cells

Violin plots show distribution of expression levels for MFS transporter (SMED30035333) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MFS transporter (SMED30035333) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MFS transporter (SMED30035333) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035333

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035333h1SMcG0017158 PL030010A20F04smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035333h1SMcG0017158 Contig2353GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30035333h1SMcG0017158 dd_Smed_v4_10656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035333h1SMcG0017158 dd_Smed_v4_10656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035333h1SMcG0017158 dd_Smed_v4_10656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035333h1SMcG0017158 dd_Smed_v4_10656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035333h1SMcG0017158 dd_Smed_v4_10656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MFS transporter vs. Ensembl Zebrafish
Match: slc16a9b (solute carrier family 16 member 9b [Source:ZFIN;Acc:ZDB-GENE-040801-69])

HSP 1 Score: 50.447 bits (119), Expect = 3.044e-6
Identity = 22/78 (28.21%), Postives = 43/78 (55.13%), Query Frame = 2
Query:  299 YGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLL 532
            +G R       V+++ G++++ F    ++ +F+YG + G G GL+++ ++   CQ+F   +   L IV +G S G  L
Sbjct:   79 FGARPVTIFSGVMVSGGLMLSAFAPNVQFLIFSYGIVVGLGCGLVYAATVTITCQYFDKRRGLALGIVTTGTSVGGFL 156          
BLAST of MFS transporter vs. Ensembl Zebrafish
Match: slc16a9a (solute carrier family 16 member 9a [Source:ZFIN;Acc:ZDB-GENE-040426-1364])

HSP 1 Score: 49.6766 bits (117), Expect = 6.248e-6
Identity = 22/75 (29.33%), Postives = 40/75 (53.33%), Query Frame = 2
Query:  299 YGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFG 523
            +G R       V++  G++++ F     + +F+YG + G G GL+++ +L   CQ+F   +   L IV +G S G
Sbjct:   79 FGARPVTIFSGVMVAGGLMLSAFAPNISFLIFSYGIVVGMGCGLVYAATLTITCQYFDKRRGLALGIVTTGTSVG 153          
BLAST of MFS transporter vs. TrEMBL
Match: A0A0H3YF10 (Slc16a-10 OS=Schmidtea mediterranea OX=79327 GN=slc16a-10 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.593e-24
Identity = 113/383 (29.50%), Postives = 181/383 (47.26%), Query Frame = 2
Query:  107 LTVLGGFILEAAIGGAYSYDSIFD---QYNN-ETIKTRSFEKYKLD-IFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSR--WYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFG----KLLVQFTI-------RFMNPSWXXXXXXXXXXX--XXXXXXXXXMQTPKKDSSEIEKLLLSINDSDQDLDIQPHIMIMEFDFWIIWLIFYLN-AFGSLFIRLQ--YQIYSSISNEQNGLSIYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQ--QIET----YEYFYYMIYPSQ--FWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTS 1162
            + V GGF++  ++GG ++Y S+F    QY N      R      +  I  +  FG  ASM LGGF+    G   TI  G  IM+FG I+T F           +YG I G G G+ + V++    QWF  +      I+LSGF  G     L+  + I         +NPS    S I +     +IQ+I   L++ P+     + +  L+I      ++++PH +I   +FWIIW+ + LN AF  LFI LQ  +  Y  IS+ +  ++     +F + G+ IWG  +DR   K V  T  L  + M+    +  +  ++ T      +  Y+I+     F  +G   I P +  K FG ++F  N+G+ +T Y+F  ++T 
Sbjct:   14 VAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPGLLSGIILSGFGIGSVGFDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITP 396          
BLAST of MFS transporter vs. TrEMBL
Match: A0A1I8I9K5 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.301e-18
Identity = 108/416 (25.96%), Postives = 176/416 (42.31%), Query Frame = 2
Query:   71 PRRNCGEILLMLLTVLGGFILEAAIGGAYSYDSIFDQYNNETIK--TRSFE-KYKLD--IFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSRWYL--FTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLL---------------VQFTIRFMN-----------PSWXXXXXXXXXXXXXXXXXXXXMQTPKKDSSEIEKLLLSINDSDQD------------LDIQPHIMIMEFDFWIIWLIFYLNAFGSLFIRLQYQ---IYSSISNEQNGLSIYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTSQLTK 1174
            P + C       L + GGFI+   +G  Y++ ++ + Y    +K  ++S E  Y     IFSL L G   SM LGG + T  G R T   GS  M+ G+I+++   KS + L   TYG + G G G+ +SV++A A +WF   K     IV +GF  G L+                 +T+   N           PS  I          +    L+    P   S + ++  L +  S ++            L + P  ++ +  FWI+WL F +NA   ++I  QY+   +Y    +    ++  + S+F    + +WG+  D L           G++ +   L   Y       YF Y+     F+  G   + P    K FG K+F++NYG+ +T    + IL + LT 
Sbjct:    4 PLKGC-------LAIFGGFIIHFTLGTVYTFGNM-NPYLTSYMKFYSKSPEINYPQSTWIFSLSLAGQGFSMALGGLIETRIGARFTALFGSWFMSLGVILSSLTVKSYFVLISLTYGVMFGVGTGVAYSVAIAAAMKWFPSRKGLVGGIVAAGFGGGSLVFNQLQTFYINPDNVKANYTLDGDNYFDQPEILDRVPSCFIVLGSTYAAMQLLGALLLFPVPPVGHSPDDQQQPLILPQSSEEHQHSRQSQEQQQLQLSPRQLVKKPIFWILWLTFLVNAQSLVYISSQYKAYGLYRQFDDHFLAITGSVSSVFNSGTRVVWGLGHDLLGYWRPMLALCTGAAVL---LATFYLSSSAAFYFIYVCLMFAFFA-GNFALFPAACAKLFGSKFFSVNYGLIFTGNAISAILGAILTS 407          
BLAST of MFS transporter vs. TrEMBL
Match: A0A1I8J070 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.492e-18
Identity = 109/416 (26.20%), Postives = 176/416 (42.31%), Query Frame = 2
Query:   71 PRRNCGEILLMLLTVLGGFILEAAIGGAYSYDSIFDQYNNETIK--TRSFE-KYKLD--IFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSRWYL--FTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLLV-QFTIRFMNP---------------SWXXXXXXXXXXXXXXXXXXXXMQ----------TPKKDSSEIEKLLLSINDSDQD------------LDIQPHIMIMEFDFWIIWLIFYLNAFGSLFIRLQYQ---IYSSISNEQNGLSIYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTSQLTK 1174
            P + C       L + GGFI+   +G  Y++ ++ + Y    +K  ++S E  Y     IFSL L G   SM LGG + T  G R T   GS  M+ G+I+++   KS + L   TYG + G G G+ +SV++A A +WF   K     IV +GF  G L+  Q    ++NP                           FI+       MQ           P   S + ++  L +  S ++            L + P  ++ +  FWI+WL F +NA   ++I  QY+   +Y    +    ++  + S+F    + +WG+  D L           G++ +   L   Y       YF Y+     F+  G   + P    K FG K+F++NYG+ +T    + IL + LT 
Sbjct:    4 PLKGC-------LAIFGGFIIHFTLGTVYTFGNM-NPYLTSYMKFYSKSPEINYPQSTWIFSLSLAGQGFSMALGGLIETRIGARFTALFGSWFMSLGVILSSLTVKSYFVLISLTYGVMFGVGTGVAYSVAIAAAMKWFPSRKGLVGGIVAAGFGGGSLVFNQLQTFYINPDNVKANYTLDGDNYFDQPEILDRVPSCFIVLGSTYAAMQLLGALLLFPVPPVGHSPDDQQQPLILPQSSEEHQHSRQSQEQQQLQLSPRQLVKKPIFWILWLTFLVNAQSLVYISSQYKAYGLYRQFDDHFLAITGSVSSVFNSGTRVVWGLGHDLLGYWRPMLALCTGAAVL---LATFYLSSSAAFYFIYVCLMFAFFA-GNFALFPAACAKLFGSKFFSVNYGLIFTGNAISAILGAILTS 407          
BLAST of MFS transporter vs. TrEMBL
Match: A0A1I8HNT4 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.622e-18
Identity = 109/416 (26.20%), Postives = 176/416 (42.31%), Query Frame = 2
Query:   71 PRRNCGEILLMLLTVLGGFILEAAIGGAYSYDSIFDQYNNETIK--TRSFE-KYKLD--IFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSRWYL--FTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLLV-QFTIRFMNP---------------SWXXXXXXXXXXXXXXXXXXXXMQ----------TPKKDSSEIEKLLLSINDSDQD------------LDIQPHIMIMEFDFWIIWLIFYLNAFGSLFIRLQYQ---IYSSISNEQNGLSIYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTSQLTK 1174
            P + C       L + GGFI+   +G  Y++ ++ + Y    +K  ++S E  Y     IFSL L G   SM LGG + T  G R T   GS  M+ G+I+++   KS + L   TYG + G G G+ +SV++A A +WF   K     IV +GF  G L+  Q    ++NP                           FI+       MQ           P   S + ++  L +  S ++            L + P  ++ +  FWI+WL F +NA   ++I  QY+   +Y    +    ++  + S+F    + +WG+  D L           G++ +   L   Y       YF Y+     F+  G   + P    K FG K+F++NYG+ +T    + IL + LT 
Sbjct:    4 PLKGC-------LAIFGGFIIHFTLGTVYTFGNM-NPYLTSYMKFYSKSPEINYPQSTWIFSLSLAGQGFSMALGGLIETRIGARFTALFGSWFMSLGVILSSLTVKSYFVLISLTYGVMFGVGTGVAYSVAIAAAMKWFPSRKGLVGGIVAAGFGGGSLVFNQLQTFYINPDNVKANYTLDGDNYFDQPEILDRVPSCFIVLGSTYAAMQLLGALLLFPVPPVGHSPDDQQQPLILPQSSEEHQHSRQSQEQQQLQLSPRQLVKKPIFWILWLTFLVNAQSLVYISSQYKAYGLYRQFDDHFLAITGSVSSVFNSGTRVVWGLGHDLLGYWRPMLALCTGAAVL---LATFYLSSSAAFYFIYVCLMFAFFA-GNFALFPAACAKLFGSKFFSVNYGLIFTGNAISAILGAILTS 407          
BLAST of MFS transporter vs. TrEMBL
Match: A0A1I8H205 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.243e-18
Identity = 94/414 (22.71%), Postives = 177/414 (42.75%), Query Frame = 2
Query:  110 TVLGGFILEAAIGGAYSYDSIFDQYNNETIKTRSFEKY-----KLDIFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSRWYLF--TYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLLV-QFTIRFMNPSWXXXXXXXXXXXXXXXXXXXXMQTP----------------------KKDSSEIEKLLLSINDSDQD------------------------LDIQPHIMIMEFDFWIIWLIFYLNAFGSLFIRLQYQIYSSISNEQNGLSIYII----SLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQ--NGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTSQLT 1171
             V+GGF++   +G  Y++ ++   Y    ++  S  K+        IF L +FG  ASM  GG +    G R T  LGS IM+ G++++ F  KS   L   TYG + G G G+ ++V++A +  WF   +     IV++GF  G L+  QF   ++NP     ++             I+ + P                      +  ++E+E+    + ++  D                        +D  P  M+ +  FW++W  F +N+   ++I  QY+ +  +S   N   + I+    + F    + +WG   DR++ + +    +      +G+ +L+     +   +YY+++    +    G   + P    K +GQ    +NYG+ +TA   +GI+ + LT
Sbjct:   10 AVIGGFLIHFTLGTLYTFGNM-SPYVVSYMRLHSHSKWIGYPDATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPRAWKPRRRMDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSF-GLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLS------FGMAVLMSTFTLSGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALLT 415          
BLAST of MFS transporter vs. Ensembl Cavefish
Match: slc16a9b (solute carrier family 16 member 9 [Source:NCBI gene;Acc:103031440])

HSP 1 Score: 50.8322 bits (120), Expect = 2.436e-6
Identity = 22/78 (28.21%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  299 YGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLL 532
            +G R       V+++ G++++ F     + +F+YG + G G GL+++ ++   CQ+F   +   L IV +G S G  L
Sbjct:   79 FGARPVTIFSGVMISGGLMLSAFAPSVHFLMFSYGIVVGLGCGLLYAATVTITCQYFDKRRGLALGIVTTGTSVGGFL 156          
BLAST of MFS transporter vs. Ensembl Cavefish
Match: slc16a9a (monocarboxylate transporter 9-like [Source:NCBI gene;Acc:103027375])

HSP 1 Score: 50.0618 bits (118), Expect = 3.510e-6
Identity = 23/78 (29.49%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  299 YGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLL 532
            +G R       V++  G++++ F     + +F+YG + G G GL+++ +L   CQ+F   +   L IV +G S G  L
Sbjct:   74 FGARPVTIFSGVMVAGGLMLSAFAPNVSFLIFSYGIVVGMGCGLVYAATLTITCQYFDKRRGLALGIVTTGTSAGGFL 151          
BLAST of MFS transporter vs. Ensembl Medaka
Match: slc16a9a (solute carrier family 16 member 9 [Source:NCBI gene;Acc:101165170])

HSP 1 Score: 52.7582 bits (125), Expect = 5.327e-7
Identity = 24/78 (30.77%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  299 YGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLL 532
            +G R   F   V++  G++++ F     + +F+YG + G G GL++S +L   CQ+F   +   L IV +G S G  +
Sbjct:   77 FGARPVTFFSGVMVAGGLMLSAFAPNVPFLMFSYGIVVGLGCGLVYSATLTITCQYFDKRRGLALGIVTTGTSIGAFI 154          
BLAST of MFS transporter vs. Planmine SMEST
Match: SMESG000061401.1 (SMESG000061401.1)

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 420/420 (100.00%), Postives = 420/420 (100.00%), Query Frame = 2
Query:   65 MDPRRNCGEILLMLLTVLGGFILEAAIGGAYSYDSIFDQYNNETIKTRSFEKYKLDIFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLLVQFTIRFMNPSWXXXXXXXXXXXXXXXXXXXXMQTPKKDSSEIEKLLLSINDSDQDLDIQPHIMIMEFDFWIIWLIFYLNAFGSLFIRLQYQIYSSISNEQNGLSIYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTSQLTKXXXXXXXXXXXXXXXXXXXXXXXXXYAGNTKRIDNIFWKYTNMLLKCIIF 1324
            MDPRRNCGEILLMLLTVLGGFILEAAIGGAYSYDSIFDQYNNETIKTRSFEKYKLDIFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLLVQFTIRFMNPSWSIFSIIGIEFFIIQIIGLILMQTPKKDSSEIEKLLLSINDSDQDLDIQPHIMIMEFDFWIIWLIFYLNAFGSLFIRLQYQIYSSISNEQNGLSIYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTSQLTKFINNVVVSLSVFSVLSFISFLLVLFYAGNTKRIDNIFWKYTNMLLKCIIF
Sbjct:    1 MDPRRNCGEILLMLLTVLGGFILEAAIGGAYSYDSIFDQYNNETIKTRSFEKYKLDIFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLLVQFTIRFMNPSWSIFSIIGIEFFIIQIIGLILMQTPKKDSSEIEKLLLSINDSDQDLDIQPHIMIMEFDFWIIWLIFYLNAFGSLFIRLQYQIYSSISNEQNGLSIYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTSQLTKFINNVVVSLSVFSVLSFISFLLVLFYAGNTKRIDNIFWKYTNMLLKCIIF 420          
BLAST of MFS transporter vs. Planmine SMEST
Match: SMESG000061401.1 (SMESG000061401.1)

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 375/420 (89.29%), Postives = 375/420 (89.29%), Query Frame = 2
Query:   65 MDPRRNCGEILLMLLTVLGGFILEAAIGGAYSYDSIFDQYNNETIKTRSFEKYKLDIFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLLVQFTIRFMNPSWXXXXXXXXXXXXXXXXXXXXMQTPKKDSSEIEKLLLSINDSDQDLDIQPHIMIMEFDFWIIWLIFYLNAFGSLFIRLQYQIYSSISNEQNGLSIYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTSQLTKXXXXXXXXXXXXXXXXXXXXXXXXXYAGNTKRIDNIFWKYTNMLLKCIIF 1324
            MDPRRNCGEILLMLLTVLGGFILEAAIGGAYSYDSIFDQYNNETIKTRSFEKYKLDIFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLLVQFTIR                                             DSDQDLDIQPHIMIMEFDFWIIWLIFYLNAFGSLFIRLQYQIYSSISNEQNGLSIYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTSQLTKFINNVVVSLSVFSVLSFISFLLVLFYAGNTKRIDNIFWKYTNMLLKCIIF
Sbjct:    1 MDPRRNCGEILLMLLTVLGGFILEAAIGGAYSYDSIFDQYNNETIKTRSFEKYKLDIFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLLVQFTIR---------------------------------------------DSDQDLDIQPHIMIMEFDFWIIWLIFYLNAFGSLFIRLQYQIYSSISNEQNGLSIYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTSQLTKFINNVVVSLSVFSVLSFISFLLVLFYAGNTKRIDNIFWKYTNMLLKCIIF 375          
BLAST of MFS transporter vs. Planmine SMEST
Match: SMESG000061394.1 (SMESG000061394.1)

HSP 1 Score: 182.956 bits (463), Expect = 1.929e-52
Identity = 128/375 (34.13%), Postives = 204/375 (54.40%), Query Frame = 2
Query:  104 LLTVLGGFILEAAIGGAYSYDSIFDQYNNETIKTRSFEKYKLDIFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLLVQFTIRFMNPSWXXXXXXXXXXXXX-------XXXXXXXMQTPKKD------SSEIEKLLLSINDSDQDLDIQPHIMIMEFDFWIIWLIFYLNAFGSLFI----RLQYQIYSSISNEQNGLS-----IYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTS 1162
            L +V+G F+++  +GGAY+Y+     +  E + T++ +K +  IF +G+FGLS+SMG GG+M T +     I  GS IMN G+IIT+F   + W + TYGFICG GAGL++SV LA   + F  +    L +++SGFS G +L+    +++        I  I   I+         +  I ++  KK+      S  ++  +  +   +   D++PH M++++ FWI+W++F +N+FG++ I    R+   I   +S  QN  S     +Y  S     G+ IWG     L  K VF     GSS +Y + +  +Q  + YE    ++     W +G   IIP  ++KRFG  +FA N+GI WT+Y+FAGILTS
Sbjct:   10 LSSVIGSFLIQLTLGGAYAYNEFSYYFATENV-TQNIQKAQF-IFGVGMFGLSSSMGFGGYMETSFNPCLIILTGSFIMNLGLIITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFLPPKIVFMFMCFGSSVIYFVSVSFFQTQKKYE---IIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTS 379          
BLAST of MFS transporter vs. Planmine SMEST
Match: SMESG000061394.1 (SMESG000061394.1)

HSP 1 Score: 182.956 bits (463), Expect = 2.536e-52
Identity = 128/375 (34.13%), Postives = 204/375 (54.40%), Query Frame = 2
Query:  104 LLTVLGGFILEAAIGGAYSYDSIFDQYNNETIKTRSFEKYKLDIFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLLVQFTIRFMNPSWXXXXXXXXXXXXX-------XXXXXXXMQTPKKD------SSEIEKLLLSINDSDQDLDIQPHIMIMEFDFWIIWLIFYLNAFGSLFI----RLQYQIYSSISNEQNGLS-----IYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTS 1162
            L +V+G F+++  +GGAY+Y+     +  E + T++ +K +  IF +G+FGLS+SMG GG+M T +     I  GS IMN G+IIT+F   + W + TYGFICG GAGL++SV LA   + F  +    L +++SGFS G +L+    +++        I  I   I+         +  I ++  KK+      S  ++  +  +   +   D++PH M++++ FWI+W++F +N+FG++ I    R+   I   +S  QN  S     +Y  S     G+ IWG     L  K VF     GSS +Y + +  +Q  + YE    ++     W +G   IIP  ++KRFG  +FA N+GI WT+Y+FAGILTS
Sbjct:   12 LSSVIGSFLIQLTLGGAYAYNEFSYYFATENV-TQNIQKAQF-IFGVGMFGLSSSMGFGGYMETSFNPCLIILTGSFIMNLGLIITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFLPPKIVFMFMCFGSSVIYFVSVSFFQTQKKYE---IIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTS 381          
BLAST of MFS transporter vs. Planmine SMEST
Match: SMESG000061394.1 (SMESG000061394.1)

HSP 1 Score: 180.644 bits (457), Expect = 2.045e-51
Identity = 134/386 (34.72%), Postives = 208/386 (53.89%), Query Frame = 2
Query:  104 LLTVLGGFILEAAIGGAYSYDSIFDQYNNETIKTRSFEKYKLDIFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLLVQFTIRFM---NPSWXXXXXXXXXXXXXXXXXXXXMQTPKKDSSEI----------EKLLLSINDSDQD-----------LDIQPHIMIMEFDFWIIWLIFYLNAFGSLFI----RLQYQIYSSISNEQNGLS-----IYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTS 1162
            L +V+G F+++  +GGAY+Y+     +  E + T++ +K +  IF +G+FGLS+SMG GG+M T +     I  GS IMN G+IIT+F   + W + TYGFICG GAGL++SV LA   + F  +    L +++SGFS G +L+    +++        IF I  +    IQ +G+ L+    K S +I          E   + ++D   D            D++PH M++++ FWI+W++F +N+FG++ I    R+   I   +S  QN  S     +Y  S     G+ IWG     L  K VF     GSS +Y + +  +Q  + YE    ++     W +G   IIP  ++KRFG  +FA N+GI WT+Y+FAGILTS
Sbjct:   10 LSSVIGSFLIQLTLGGAYAYNEFSYYFATENV-TQNIQKAQF-IFGVGMFGLSSSMGFGGYMETSFNPCLIILTGSFIMNLGLIITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFLPPKIVFMFMCFGSSVIYFVSVSFFQTQKKYE---IIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTS 390          
The following BLAST results are available for this feature:
BLAST of MFS transporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc16a9b3.044e-628.21solute carrier family 16 member 9b [Source:ZFIN;Ac... [more]
slc16a9a6.248e-629.33solute carrier family 16 member 9a [Source:ZFIN;Ac... [more]
back to top
BLAST of MFS transporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF102.593e-2429.50Slc16a-10 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A1I8I9K51.301e-1825.96MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8J0701.492e-1826.20MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8HNT41.622e-1826.20MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8H2052.243e-1822.71MFS domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of MFS transporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc16a9b2.436e-628.21solute carrier family 16 member 9 [Source:NCBI gen... [more]
slc16a9a3.510e-629.49monocarboxylate transporter 9-like [Source:NCBI ge... [more]
back to top
BLAST of MFS transporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc16a9a5.327e-730.77solute carrier family 16 member 9 [Source:NCBI gen... [more]
back to top
BLAST of MFS transporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061401.10.000e+0100.00SMESG000061401.1[more]
SMESG000061401.10.000e+089.29SMESG000061401.1[more]
SMESG000061394.11.929e-5234.13SMESG000061394.1[more]
SMESG000061394.12.536e-5234.13SMESG000061394.1[more]
SMESG000061394.12.045e-5134.72SMESG000061394.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035333 ID=SMED30035333|Name=MFS transporter|organism=Schmidtea mediterranea sexual|type=transcript|length=1428bp
TCTATATAAATCTTATATGATAGTAAAATAGAGATTATTAAAATTTGGTT
TTCATACATATTTCATGGATCCTCGGAGAAACTGCGGTGAAATTCTGCTG
ATGCTTTTAACTGTTTTAGGAGGCTTTATACTAGAAGCTGCTATTGGTGG
AGCTTATTCATACGATTCTATATTTGATCAATATAACAATGAAACAATAA
AGACACGTTCATTTGAAAAGTACAAATTAGACATTTTTAGTCTTGGCCTG
TTTGGTCTGAGTGCGTCAATGGGTTTAGGAGGTTTCATGTCCACAATATA
TGGACATCGGAAAACCATATTTCTAGGAAGTGTTATTATGAATTTTGGAA
TAATTATTACTACATTTGTTGCCAAAAGTAGATGGTACTTATTTACTTAT
GGATTTATCTGTGGTTCTGGTGCTGGACTCATGTTCTCGGTTTCCTTAGC
AACAGCTTGTCAATGGTTTAAATTTTACAAAAGTTTTGGATTGAGTATTG
TTTTATCGGGTTTCTCTTTTGGTAAACTTCTTGTTCAGTTTACTATACGC
TTTATGAATCCTTCTTGGTCTATATTTTCTATTATTGGTATTGAATTTTT
TATTATTCAAATTATTGGTTTAATACTTATGCAAACACCAAAAAAGGATA
GTTCTGAAATTGAAAAATTACTTCTGTCAATTAATGATTCTGACCAAGAT
TTAGATATTCAACCCCATATAATGATTATGGAGTTTGATTTTTGGATAAT
ATGGCTTATTTTTTATTTGAATGCCTTTGGAAGTCTTTTTATAAGATTAC
AATATCAGATTTATAGTTCAATTTCAAATGAACAGAATGGTCTCTCTATT
TATATAATAAGTTTATTTATTGTCATTGGACAAGGGATTTGGGGCATTTC
AAGTGATCGCCTGTCAATGAAAACGGTTTTTTGTACATTTGCTTTGGGAT
CGTCTTTTATGTACGGAATTCTATTGCTTCTTTATCAACAAATTGAAACA
TATGAATACTTTTATTATATGATCTACCCATCTCAGTTTTGGCAGAATGG
AATTATGGTGATAATACCGGGACTGATTGTCAAGCGATTTGGGCAAAAGT
ATTTTGCTATAAATTATGGAATTACATGGACTGCCTATACATTTGCTGGA
ATCTTGACAAGCCAACTTACAAAATTTATCAACAATGTGGTTGTATCCCT
TTCTGTCTTTTCAGTTCTGTCTTTTATAAGTTTTCTTCTGGTATTATTTT
ATGCTGGTAACACAAAACGAATTGACAATATTTTTTGGAAGTATACTAAT
ATGTTACTTAAATGTATTATATTTTGATTTCAACAGATATCATGCAAATT
TCAGTTTTAATTACAAAAAAATTTTGAGTATGAAATTTAAAAGTTTAATA
TTTTTGTGTAATTTTGCATCAATTATTT
back to top

protein sequence of SMED30035333-orf-1

>SMED30035333-orf-1 ID=SMED30035333-orf-1|Name=SMED30035333-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=421bp
MDPRRNCGEILLMLLTVLGGFILEAAIGGAYSYDSIFDQYNNETIKTRSF
EKYKLDIFSLGLFGLSASMGLGGFMSTIYGHRKTIFLGSVIMNFGIIITT
FVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGF
SFGKLLVQFTIRFMNPSWSIFSIIGIEFFIIQIIGLILMQTPKKDSSEIE
KLLLSINDSDQDLDIQPHIMIMEFDFWIIWLIFYLNAFGSLFIRLQYQIY
SSISNEQNGLSIYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMY
GILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAIN
YGITWTAYTFAGILTSQLTKFINNVVVSLSVFSVLSFISFLLVLFYAGNT
KRIDNIFWKYTNMLLKCIIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 220..403
e-value: 1.5E-7
score: 32.9
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 9..211
e-value: 2.1E-10
score: 42.4
NoneNo IPR availablePANTHERPTHR11360:SF3OXALATE/FORMATE ANTIPORTERcoord: 15..396
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 15..396
NoneNo IPR availableCDDcd17353MFS_OFA_likecoord: 15..364
e-value: 2.61739E-35
score: 132.349
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 375..397
NoneNo IPR availableTMHMMTMhelixcoord: 346..365
NoneNo IPR availableTMHMMTMhelixcoord: 226..245
NoneNo IPR availableTMHMMTMhelixcoord: 167..189
NoneNo IPR availableTMHMMTMhelixcoord: 107..129
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 320..339
NoneNo IPR availableTMHMMTMhelixcoord: 86..103
NoneNo IPR availableTMHMMTMhelixcoord: 260..279
NoneNo IPR availableTMHMMTMhelixcoord: 141..163
NoneNo IPR availableTMHMMTMhelixcoord: 288..310
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 27..364
e-value: 8.7E-18
score: 64.4
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 18..403