EOG090X0AVI

Overview
NameEOG090X0AVI
Smed IDSMED30035323
Length (bp)1401
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EOG090X0AVI (SMED30035323) t-SNE clustered cells

Violin plots show distribution of expression levels for EOG090X0AVI (SMED30035323) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EOG090X0AVI (SMED30035323) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EOG090X0AVI (SMED30035323) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035323

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035323SMESG000010474.1 SmedASXL_012110SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035323SMESG000010474.1 SmedASXL_012110SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30035323SMESG000010474.1 dd_Smed_v4_15022_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035323SMESG000010474.1 SMED_37584_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035323SMESG000010474.1 SMED_37584_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035323SMESG000010474.1 SMED_28958_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035323SMESG000010474.1 SMED_28958_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035323SMESG000010474.1 SmWIOct06_026476GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035323 SMED_17325_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30035323 SMED_37583_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EOG090X0AVI vs. Ensembl Human
Match: ORC2 (origin recognition complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:8488])

HSP 1 Score: 129.413 bits (324), Expect = 1.102e-31
Identity = 115/403 (28.54%), Postives = 192/403 (47.64%), Query Frame = 2
Query:  107 NAVTRSKSVMVNNNKASDHSNKIVASTKLT-DEIKDLQLSFHKQISLKCRIDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTE--QINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFN----DVIDSLGMAAPTQGKSPLSLATAIRDSLSC-----KSRHNYRLYFVISNIERLAIHSSLDSLVI--LAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFDE 1261
            NAV  S+ +   N   S    K   S ++  D+  DL             +++YF  HS  +++++S ++L  L  +KL       L++K+  +   E  Q+N +     EK F +    L  GFN++ +G GSK  L+ERF    L     +VI GF   +++  V N    +V+D +G               +I D L       K   +  L+ +I N++   +       +I  L+   N+ + A++DH  A  +   +K  +F W++ + TT  PY +ETS  +S  + Q+ S+ L SL  V  SL  NA+ +F LL K QL+N  N +  G+   +     +++ LV +++ LR  LTEF+DHKLI+ K   DG  Y+ I +D   +  F+   +E
Sbjct:  203 NAVIFSQKIQAQNRVVSAPVGKETPSKRMKRDKTSDL-------------VEEYFEAHS-SSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQY----EKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVLDHMGTFR------------SILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYLIASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEE 575          
BLAST of EOG090X0AVI vs. Ensembl Celegans
Match: orc-2 (Origin recognition complex subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:Q21037])

HSP 1 Score: 67.0106 bits (162), Expect = 9.291e-12
Identity = 72/295 (24.41%), Postives = 134/295 (45.42%), Query Frame = 2
Query:  398 QINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQ-GKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLV-ILAKCPNVSIFATVDHRFA-----ERLLSKFEIFWVFCDWTTLLPYCQETSDSSSRFI-----SQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENTNQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFV 1246
            +   RL  L +  F +    L  GFN+L HG GSK  ++  F N         V    DG +N+  +   + +++ +    + G+S +S A +IR  ++ +     +L  +I NIE     S  ++   +L    +V + ATVDH ++      R LS      +  + T  +P  QE     SR +     S  +S  + SL     SL  N++++F L  ++  +      + +   +L   +KD  + + +  LR  L EFKDH++++     DG+  +  +++  L+ +F+
Sbjct:  135 EFEKRLEHLADNDFGKWKLYLAAGFNILLHGVGSKRDVLTEFENELSDYTYMRVDARKDG-LNVKVLLGAINENMKLNCNVKRGQSTISWARSIRRKMNSQ-----QLILIIDNIEAPDWRSDQEAFCELLENRDSVKLIATVDHIYSTFIWNSRQLSSLSFVHITIN-TFEIP-LQELMTGDSRLLGLDARSNQSSHTMSSLDVFWKSLAVNSQKLFRLFFQMYFDTK----KPVKFWDLFNAAKDDFIASTDAALRTQLVEFKDHRVLKWTRGDDGNDQLSGIVELRLVTEFL 417          
BLAST of EOG090X0AVI vs. Ensembl Fly
Match: Orc2 (gene:FBgn0015270 transcript:FBtr0082866)

HSP 1 Score: 133.65 bits (335), Expect = 2.205e-33
Identity = 97/344 (28.20%), Postives = 180/344 (52.33%), Query Frame = 2
Query:  257 DQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTE-QINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATA---IRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVI--LAKCPNVSIFATVDH-----RFAERLLSKFEIFWVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVND 1252
            D YF  H+  ++I++S  +L  L   +L       L++++  +A  E  INA + E     F +   +L  GFN+L +G GSK  L++ F    L+ +  +V+ GF  ++ +     D++DS+       G SP +   A   I +  +     +  L+ ++ N++   + +     ++  LA+ PN+ + A++DH      + +  L  F   W  C  TT+LPY  ET+  +S  +  +  + L S++SV +SL  N++ +++L+ K QL+N  N   +GM   +L    +++ LV++++ LR  LTEF DHKL++ K   DGS  + I +D  L+++F+ +
Sbjct:  281 DGYFHSHA-SSKILTSDHTLDRLKNPRLAADRVFSLLSEIKTSAEHEGSINAIMEEYR-SYFPKWMCILNEGFNILLYGLGSKHQLLQSFHREVLHKQTVLVVNGFFPSLTI----KDMLDSITSDILDAGISPANPHEAVDMIEEEFALIPETH--LFLIVHNLDGAMLRNVKAQAILSRLARIPNIHLLASIDHINTPLLWDQGKLCSFNFSWWDC--TTMLPYTNETAFENSLLVQNSGELALSSMRSVFSSLTTNSRGIYMLIVKYQLKNKGNATYQGMPFRDLYSSCREAFLVSSDLALRAQLTEFLDHKLVKSKRSVDGSEQLTIPIDGALLQQFLEE 614          
BLAST of EOG090X0AVI vs. Ensembl Zebrafish
Match: orc2 (origin recognition complex, subunit 2 [Source:ZFIN;Acc:ZDB-GENE-061013-682])

HSP 1 Score: 122.479 bits (306), Expect = 1.275e-29
Identity = 91/291 (31.27%), Postives = 151/291 (51.89%), Query Frame = 2
Query:  416 AELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFN----DVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLD--SLVILAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFD 1258
            +++ E+ F ++   L  GFN+L +G GSK  L+E+F +  L   + +V+ GF  ++ L  + N    DV +  G       ++P      I  +L     ++  ++ +I+NI+   +    +  +L  LA  PN+ + A++DH  A  +   +K  +F W++ + TT   Y +ETS  +S  + Q  ++ L SL  V  SL  NA+ +F LLA+ QLEN  N    G+   +     ++S LV ++I LR  LTEFKDHKLI+ K   DG  Y+ I +D   +  F+   D
Sbjct:  267 SKISEEYFQQLVESLTMGFNILLYGLGSKQLLLEKFRSSMLSDYDHVVVNGFFPSITLKSILNSITVDVFEHQG-----SFRNPAEQMDFITRTLRGDPSNH--VFLIINNIDGPMLRGDRNQQALGQLAALPNMHLLASIDHINAPLVWDHAKMSMFNWLWFESTTYRSYTEETSYENSLLVQQTGALALSSLTHVLRSLTPNARGIFRLLAEFQLENKDNPAYSGLSFQDFYQRCRESFLVNSDITLRTQLTEFKDHKLIRNKKGADGVEYLLIPVDNGTLSDFLEKND 550          
BLAST of EOG090X0AVI vs. Ensembl Xenopus
Match: orc2 (origin recognition complex subunit 2 [Source:NCBI gene;Acc:780267])

HSP 1 Score: 131.339 bits (329), Expect = 6.753e-33
Identity = 105/352 (29.83%), Postives = 173/352 (49.15%), Query Frame = 2
Query:  227 HKQISLKC------RIDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVI--LAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFV 1246
            H +I L C       +++YF  HS  +++++S ++L  L   KL      +L+ + P A   E    R++   E  F +    L  GFN++  G GSK  L+E+F    L     IV+ GF  ++ +  + N + +   +  P   +SPL     I      K   +  LY +I N++   +       V+  LA  PN  + A+VDH  A  +   SK  ++ W++ + TT   Y +ETS  +S  + ++ ++ L SL  V  SL  NA+ +F LLA+ QL N  N +  G+   +     +++ LV +++ LR  LTEF+DHKLI+ K   DG  Y+ I LD   +  F+
Sbjct:  109 HIRIGLHCIHHISNLVEEYFEAHS-SSKVLTSDRTLQRLQTPKLDQETLRKLLDQTPLAFAGEL--CRMSVQHEALFYKWMLQLHLGFNIILFGLGSKQNLIEKFRTSLLQDSLNIVVNGFFPSITVKSILNSITEE-ALGHPGTFRSPLDQMDFILQRF--KEDPSLELYLLIHNLDSQMLRGEKCQQVLGQLASIPNFHLLASVDHINAPLMWDQSKQSLYNWLWYETTTFNSYVEETSYENSLLVKRSGALALSSLTHVLRSLTPNARGIFRLLAEYQLANKDNPSYTGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGVDGVEYLLIPLDLGTLTDFL 454          
BLAST of EOG090X0AVI vs. Ensembl Xenopus
Match: orc2 (origin recognition complex subunit 2 [Source:NCBI gene;Acc:780267])

HSP 1 Score: 129.798 bits (325), Expect = 2.894e-32
Identity = 101/337 (29.97%), Postives = 168/337 (49.85%), Query Frame = 2
Query:  254 IDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVI--LAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFV 1246
            +++YF  HS  +++++S ++L  L   KL      +L+ + P A   E    R++   E  F +    L  GFN++  G GSK  L+E+F    L     IV+ GF  ++ +  + N + +   +  P   +SPL     I      K   +  LY +I N++   +       V+  LA  PN  + A+VDH  A  +   SK  ++ W++ + TT   Y +ETS  +S  + ++ ++ L SL  V  SL  NA+ +F LLA+ QL N  N +  G+   +     +++ LV +++ LR  LTEF+DHKLI+ K   DG  Y+ I LD   +  F+
Sbjct:  144 VEEYFEAHS-SSKVLTSDRTLQRLQTPKLDQETLRKLLDQTPLAFAGEL--CRMSVQHEALFYKWMLQLHLGFNIILFGLGSKQNLIEKFRTSLLQDSLNIVVNGFFPSITVKSILNSITEE-ALGHPGTFRSPLDQMDFILQRF--KEDPSLELYLLIHNLDSQMLRGEKCQQVLGQLASIPNFHLLASVDHINAPLMWDQSKQSLYNWLWYETTTFNSYVEETSYENSLLVKRSGALALSSLTHVLRSLTPNARGIFRLLAEYQLANKDNPSYTGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGVDGVEYLLIPLDLGTLTDFL 474          
BLAST of EOG090X0AVI vs. Ensembl Xenopus
Match: orc2 (origin recognition complex subunit 2 [Source:NCBI gene;Acc:780267])

HSP 1 Score: 129.413 bits (324), Expect = 4.318e-32
Identity = 101/337 (29.97%), Postives = 168/337 (49.85%), Query Frame = 2
Query:  254 IDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVI--LAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFV 1246
            +++YF  HS  +++++S ++L  L   KL      +L+ + P A   E    R++   E  F +    L  GFN++  G GSK  L+E+F    L     IV+ GF  ++ +  + N + +   +  P   +SPL     I      K   +  LY +I N++   +       V+  LA  PN  + A+VDH  A  +   SK  ++ W++ + TT   Y +ETS  +S  + ++ ++ L SL  V  SL  NA+ +F LLA+ QL N  N +  G+   +     +++ LV +++ LR  LTEF+DHKLI+ K   DG  Y+ I LD   +  F+
Sbjct:  144 VEEYFEAHS-SSKVLTSDRTLQRLQTPKLDQETLRKLLDQTPLAFAGEL--CRMSVQHEALFYKWMLQLHLGFNIILFGLGSKQNLIEKFRTSLLQDSLNIVVNGFFPSITVKSILNSITEE-ALGHPGTFRSPLDQMDFILQRF--KEDPSLELYLLIHNLDSQMLRGEKCQQVLGQLASIPNFHLLASVDHINAPLMWDQSKQSLYNWLWYETTTFNSYVEETSYENSLLVKRSGALALSSLTHVLRSLTPNARGIFRLLAEYQLANKDNPSYTGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGVDGVEYLLIPLDLGTLTDFL 474          
BLAST of EOG090X0AVI vs. Ensembl Xenopus
Match: orc2 (origin recognition complex subunit 2 [Source:NCBI gene;Acc:780267])

HSP 1 Score: 129.798 bits (325), Expect = 4.474e-32
Identity = 101/337 (29.97%), Postives = 168/337 (49.85%), Query Frame = 2
Query:  254 IDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVI--LAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFV 1246
            +++YF  HS  +++++S ++L  L   KL      +L+ + P A   E    R++   E  F +    L  GFN++  G GSK  L+E+F    L     IV+ GF  ++ +  + N + +   +  P   +SPL     I      K   +  LY +I N++   +       V+  LA  PN  + A+VDH  A  +   SK  ++ W++ + TT   Y +ETS  +S  + ++ ++ L SL  V  SL  NA+ +F LLA+ QL N  N +  G+   +     +++ LV +++ LR  LTEF+DHKLI+ K   DG  Y+ I LD   +  F+
Sbjct:  173 VEEYFEAHS-SSKVLTSDRTLQRLQTPKLDQETLRKLLDQTPLAFAGEL--CRMSVQHEALFYKWMLQLHLGFNIILFGLGSKQNLIEKFRTSLLQDSLNIVVNGFFPSITVKSILNSITEE-ALGHPGTFRSPLDQMDFILQRF--KEDPSLELYLLIHNLDSQMLRGEKCQQVLGQLASIPNFHLLASVDHINAPLMWDQSKQSLYNWLWYETTTFNSYVEETSYENSLLVKRSGALALSSLTHVLRSLTPNARGIFRLLAEYQLANKDNPSYTGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGVDGVEYLLIPLDLGTLTDFL 503          
BLAST of EOG090X0AVI vs. Ensembl Xenopus
Match: orc2 (origin recognition complex subunit 2 [Source:NCBI gene;Acc:780267])

HSP 1 Score: 128.642 bits (322), Expect = 1.528e-31
Identity = 101/337 (29.97%), Postives = 168/337 (49.85%), Query Frame = 2
Query:  254 IDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVI--LAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFV 1246
            +++YF  HS  +++++S ++L  L   KL      +L+ + P A   E    R++   E  F +    L  GFN++  G GSK  L+E+F    L     IV+ GF  ++ +  + N + +   +  P   +SPL     I      K   +  LY +I N++   +       V+  LA  PN  + A+VDH  A  +   SK  ++ W++ + TT   Y +ETS  +S  + ++ ++ L SL  V  SL  NA+ +F LLA+ QL N  N +  G+   +     +++ LV +++ LR  LTEF+DHKLI+ K   DG  Y+ I LD   +  F+
Sbjct:  221 VEEYFEAHS-SSKVLTSDRTLQRLQTPKLDQETLRKLLDQTPLAFAGEL--CRMSVQHEALFYKWMLQLHLGFNIILFGLGSKQNLIEKFRTSLLQDSLNIVVNGFFPSITVKSILNSITEE-ALGHPGTFRSPLDQMDFILQRF--KEDPSLELYLLIHNLDSQMLRGEKCQQVLGQLASIPNFHLLASVDHINAPLMWDQSKQSLYNWLWYETTTFNSYVEETSYENSLLVKRSGALALSSLTHVLRSLTPNARGIFRLLAEYQLANKDNPSYTGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGVDGVEYLLIPLDLGTLTDFL 551          
BLAST of EOG090X0AVI vs. Ensembl Mouse
Match: Orc2 (origin recognition complex, subunit 2 [Source:MGI Symbol;Acc:MGI:1328306])

HSP 1 Score: 119.398 bits (298), Expect = 1.219e-28
Identity = 96/346 (27.75%), Postives = 172/346 (49.71%), Query Frame = 2
Query:  254 IDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFN----DVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVI--LAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENTNQNTE-GMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFDE 1261
            +++YF  HS  +++++S ++L  L  +++       L+ K   +   E    RL +  EK F +    L  GFN++ +G GSK  L+E+F    L     +VI G+   V++  + N    DV+  +G       +    +     DS       +  L+ +I N++   +       ++  L+   NV + A++DH  A  +   +K  ++ W++ + TT  PY +ETS  +S  + Q+ S+ L SL  V  SL  NA+ +F LL K QL+N +  +  G+   +     +++ LV +++ LR  LTEF+DHKLI+ K   DG  Y+ I +D  ++  F+   +E
Sbjct:  191 VEEYFEAHS-SSKVLTSDRTLQRLRRARVDQKTLHNLLRKFVPSFSAEI--ERLNQQHEKLFHKWMLQLHLGFNIVLYGLGSKRDLLEKFRTTMLQDSIHVVINGYFPGVSVKSILNSITEDVLSHVGTFQSVLDQRDWIINRFKEDS-------SLELFLLIHNLDSQMLRGDNSQQILGQLSSLHNVYLIASIDHLNAPLMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHVLRSLTPNARGIFRLLMKFQLDNQDSPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDSGILADFLEKEEE 526          
BLAST of EOG090X0AVI vs. Ensembl Mouse
Match: Orc2 (origin recognition complex, subunit 2 [Source:MGI Symbol;Acc:MGI:1328306])

HSP 1 Score: 119.398 bits (298), Expect = 1.699e-28
Identity = 99/346 (28.61%), Postives = 173/346 (50.00%), Query Frame = 2
Query:  254 IDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFN----DVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIER--LAIHSSLDSLVILAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENTNQNTE-GMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFDE 1261
            +++YF  HS  +++++S ++L  L  +++       L+ K   +   E    RL +  EK F +    L  GFN++ +G GSK  L+E+F    L     +VI G+   V++  + N    DV+  +G       +    +     DS       +  L+ +I N++   L   +S   L  L+   NV + A++DH  A  +   +K  ++ W++ + TT  PY +ETS  +S  + Q+ S+ L SL  V  SL  NA+ +F LL K QL+N +  +  G+   +     +++ LV +++ LR  LTEF+DHKLI+ K   DG  Y+ I +D  ++  F+   +E
Sbjct:  239 VEEYFEAHS-SSKVLTSDRTLQRLRRARVDQKTLHNLLRKFVPSFSAEI--ERLNQQHEKLFHKWMLQLHLGFNIVLYGLGSKRDLLEKFRTTMLQDSIHVVINGYFPGVSVKSILNSITEDVLSHVGTFQSVLDQRDWIINRFKEDS-------SLELFLLIHNLDSQMLRGDNSQQILGQLSSLHNVYLIASIDHLNAPLMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHVLRSLTPNARGIFRLLMKFQLDNQDSPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDSGILADFLEKEEE 574          
BLAST of EOG090X0AVI vs. UniProt/SwissProt
Match: sp|Q24168|ORC2_DROME (Origin recognition complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=Orc2 PE=1 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 2.210e-32
Identity = 97/344 (28.20%), Postives = 180/344 (52.33%), Query Frame = 2
Query:  257 DQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTE-QINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATA---IRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVI--LAKCPNVSIFATVDH-----RFAERLLSKFEIFWVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVND 1252
            D YF  H+  ++I++S  +L  L   +L       L++++  +A  E  INA + E     F +   +L  GFN+L +G GSK  L++ F    L+ +  +V+ GF  ++ +     D++DS+       G SP +   A   I +  +     +  L+ ++ N++   + +     ++  LA+ PN+ + A++DH      + +  L  F   W  C  TT+LPY  ET+  +S  +  +  + L S++SV +SL  N++ +++L+ K QL+N  N   +GM   +L    +++ LV++++ LR  LTEF DHKL++ K   DGS  + I +D  L+++F+ +
Sbjct:  281 DGYFHSHA-SSKILTSDHTLDRLKNPRLAADRVFSLLSEIKTSAEHEGSINAIMEEYR-SYFPKWMCILNEGFNILLYGLGSKHQLLQSFHREVLHKQTVLVVNGFFPSLTI----KDMLDSITSDILDAGISPANPHEAVDMIEEEFALIPETH--LFLIVHNLDGAMLRNVKAQAILSRLARIPNIHLLASIDHINTPLLWDQGKLCSFNFSWWDC--TTMLPYTNETAFENSLLVQNSGELALSSMRSVFSSLTTNSRGIYMLIVKYQLKNKGNATYQGMPFRDLYSSCREAFLVSSDLALRAQLTEFLDHKLVKSKRSVDGSEQLTIPIDGALLQQFLEE 614          
BLAST of EOG090X0AVI vs. UniProt/SwissProt
Match: sp|Q13416|ORC2_HUMAN (Origin recognition complex subunit 2 OS=Homo sapiens OX=9606 GN=ORC2 PE=1 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 5.293e-31
Identity = 115/403 (28.54%), Postives = 192/403 (47.64%), Query Frame = 2
Query:  107 NAVTRSKSVMVNNNKASDHSNKIVASTKLT-DEIKDLQLSFHKQISLKCRIDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTE--QINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFN----DVIDSLGMAAPTQGKSPLSLATAIRDSLSC-----KSRHNYRLYFVISNIERLAIHSSLDSLVI--LAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFDE 1261
            NAV  S+ +   N   S    K   S ++  D+  DL             +++YF  HS  +++++S ++L  L  +KL       L++K+  +   E  Q+N +     EK F +    L  GFN++ +G GSK  L+ERF    L     +VI GF   +++  V N    +V+D +G               +I D L       K   +  L+ +I N++   +       +I  L+   N+ + A++DH  A  +   +K  +F W++ + TT  PY +ETS  +S  + Q+ S+ L SL  V  SL  NA+ +F LL K QL+N  N +  G+   +     +++ LV +++ LR  LTEF+DHKLI+ K   DG  Y+ I +D   +  F+   +E
Sbjct:  203 NAVIFSQKIQAQNRVVSAPVGKETPSKRMKRDKTSDL-------------VEEYFEAHS-SSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQY----EKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVLDHMGTFR------------SILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYLIASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEE 575          
BLAST of EOG090X0AVI vs. UniProt/SwissProt
Match: sp|Q91628|ORC2_XENLA (Origin recognition complex subunit 2 OS=Xenopus laevis OX=8355 GN=orc2 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.745e-30
Identity = 100/337 (29.67%), Postives = 168/337 (49.85%), Query Frame = 2
Query:  254 IDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVI--LAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFV 1246
            +++YF  HS  +++++S ++L  L   KL      +L+ + P A   E    R+++  E  F +    L  GFN++  G GSK  L+E+F    L     IVI  F  ++    + N + +   +  P   +SPL     I      K   +  LY +I N++   +       V+  LA  PN+ + A+VDH  A  +   SK  ++ W++ + TT   Y +ETS  +S  + ++ ++ L SL  V  SL  NA+ +F LLA+ Q+ N  N +  G+   +     +++ LV +++ LR  LTEF+DHKLI+ K   DG  Y+ I LD   +  F+
Sbjct:  221 VEEYFEAHS-SSKVLTSDRTLQRLQTPKLDQETLRKLLDQTPSAFADEL--HRISKKHEALFYKWMLQLHLGFNIILFGLGSKQSLIEKFRTSLLQDSLHIVINEFFPSITAKSILNSITEE-ALGHPGAFRSPLDQMDFILQRF--KDDPSLELYLLIHNLDSQMLRGEKCQQVLGQLASIPNLHLLASVDHINAPLMWDQSKQSLYNWLWYETTTFGSYIEETSYENSLLVKRSGALALSSLTHVLRSLTPNARGIFRLLAEYQMANKDNPSYTGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGMDGVEYLLIPLDLGTLTDFL 551          
BLAST of EOG090X0AVI vs. UniProt/SwissProt
Match: sp|A6QNM3|ORC2_BOVIN (Origin recognition complex subunit 2 OS=Bos taurus OX=9913 GN=ORC2 PE=2 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 1.238e-28
Identity = 101/344 (29.36%), Postives = 177/344 (51.45%), Query Frame = 2
Query:  254 IDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCI--VIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVI--LAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFDE 1261
            +++YF  HS  +++++S ++L  L  +KL       L++K+  +   E    +L +  E+ F +    L  GFN++ +G GSK  L+ERF  R    ++CI  VI GF   +++  V N V + L        +S L     I +    K   +  L+ +I N++   +       +I  L+   N+ + A++DH  A  +   +K  ++ W++ + TT   Y +ETS  +S  + Q+ S+ L SL  V  SL  NA+ +F LL K QL+N  N +  G+   +     +++ LV +++ LR  LTEF+DHKLI+ K   DG  Y+ I +D  ++  F+ + +E
Sbjct:  241 VEKYFEAHS-SSKVLTSDRTLQKLKRAKLDQQTLHNLLSKVSPSFSAEL--KQLNQQHEQLFHKWMLQLHLGFNIVLYGLGSKRDLLERF--RTTMLQDCIHIVINGFFPGISVKSVLNSVTEVLDHVGTF--RSVLDQLEWITNKF--KEDSSLELFLLIHNLDSQMLRGDKSQQIIGQLSSLRNIYLIASIDHLNAPLMWDHAKQSLYNWLWYETTTYSHYTEETSYENSLLVKQSGSLPLSSLIHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLCFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGILTDFLENEEE 575          
BLAST of EOG090X0AVI vs. UniProt/SwissProt
Match: sp|Q75PQ8|ORC2_RAT (Origin recognition complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Orc2 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.148e-28
Identity = 98/341 (28.74%), Postives = 173/341 (50.73%), Query Frame = 2
Query:  254 IDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFN----DVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIER--LAIHSSLDSLVILAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENTN-QNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFV 1246
            +++YF  HS  +++++S ++L  L  +++       L++K   +  TE    +L +  E+ F +    LR GFN++ +G GSK  L+E+F    L     +VI GF   +++  + N    DV+  +G       +    +     DS       +  L+ +I N++   L   +S   L  L+   NV + A++DH  A  +   +K  ++ W++ + TT  PY +ETS  +S  + Q+ S+ L SL  V  SL  NA+ +F LL K QL+N +  +  G+   +     +++ LV +++ LR  LTEF+DHKLI+ K   DG  Y+ I +D   +  F+
Sbjct:  238 VEEYFEAHS-SSKVLTSDRTLQKLRRARVDQKTLRNLLSKFVPSFSTEI--GQLNQQHERLFDKWILQLRLGFNIVLYGLGSKRDLLEKFRTTMLQDSIHVVINGFFPGISVKSILNSITEDVLSHMGTFQSVLDQRDWIMNRFKEDS-------SLELFLLIHNLDSQMLRGDNSQQILGQLSSLRNVYLIASIDHLNAPLMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHVLRSLTPNARGIFRLLMKYQLDNQDCPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDSGTLADFL 568          
BLAST of EOG090X0AVI vs. TrEMBL
Match: A0A195EXS6 (Origin recognition complex subunit 2 OS=Trachymyrmex septentrionalis OX=34720 GN=ALC56_12976 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.299e-42
Identity = 116/343 (33.82%), Postives = 190/343 (55.39%), Query Frame = 2
Query:  251 RIDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEE--KSFAEVFN-LLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVI-DSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHS--SLDSLVILAKCPNVSIFATVDHRFAERLL-----SKFEIFWVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENTNQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFV 1246
            + D+YF+  S+KT  ++S  +L  L  ++LT     +L+      + T +   R+  L E  +SF  ++  +L  G+++L HG GSK  L+  F N  +     +VI GF  ++ L  + +++I D L +  PT     L L   +          + RLY +I NI+ + + S  + + L  LA  PN+ I A+VDH  A  L      SKF  +W   D TTLLPY  ETS  SS  + Q++ + L SL++V  SL +NA+ ++L+L + QL N+N+N  GM   +L   +++  LV++++ LR  LTEF DHKL++IK   DG+ ++ I LD+ L+++F+
Sbjct:  217 QTDEYFASQSEKT--VTSDHTLERLKNTRLTEESLGKLLINQSHISTTHK--KRICSLTENCRSFFPMWQFILEEGYSLLLHGVGSKRNLINDFHNEIIKDHPTLVINGFFPSLTLKDILDNIIMDLLDLNCPTNLNDCLELIETV-----MGDNPDDRLYLLIHNIDGVMLRSNKAQNILASLATIPNIHILASVDHINAPLLWDHVKRSKFNFYW--WDATTLLPYQAETSYESSLLVQQSSGLALSSLQNVFLSLTSNARAIYLILVEYQLSNSNRNFTGMPFKDLYRTAREQFLVSSDLTLRAQLTEFIDHKLLRIKRTVDGAEHLTIPLDKSLLKQFI 548          
BLAST of EOG090X0AVI vs. TrEMBL
Match: A0A151WQ46 (Origin recognition complex subunit 2 OS=Trachymyrmex zeteki OX=64791 GN=ALC60_10944 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.343e-40
Identity = 117/358 (32.68%), Postives = 196/358 (54.75%), Query Frame = 2
Query:  227 HKQISLK---CRIDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEE--KSFAEVFN-LLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVI-DSLGMAAPTQGKSPLSL-ATAIRDSLSCKSRHNYRLYFVISNIERLAIHS--SLDSLVILAKCPNVSIFATVDHRFAERLL-----SKFEIFWVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENTNQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDF 1255
            HK ++ K    + D+YF   S+KT  ++S ++L  L  ++LT     +L+      +   +    +  L E  +SF  ++  +L  G+++L HG GSK  L+  F N  +     ++I GF  ++ L  + +++I D L +  PT     L L  T +RD+       N RLY +I NI+ + + S  + + L  LA  PN+ + A+VDH  A  L      +KF  +W   D TTLL Y  ETS  SS  + Q++ + L SL++V  SL +NA+ ++L+L K QL N++ N  GM   +L   +++  LV++++ LR  LTEF DHKL++IK   DG+ ++ I LD+ L+++F+  +
Sbjct:  208 HKTVAYKDYHIKTDEYFESQSEKT--VTSDRTLERLKNARLTEESLGKLLINQSHISTIHK--KHICSLTENCRSFFPMWQFILEEGYSLLLHGVGSKRNLINDFHNEIIRDHPTLIINGFFPSLTLKDILDNIITDLLDLNCPTNLNDCLELIETVMRDN------PNDRLYLIIHNIDGIMLRSNKAQNILASLAAIPNIHVLASVDHINAPLLWDHVKRAKFNFYW--WDATTLLSYQAETSYESSLLVQQSSGLVLSSLQNVFLSLTSNARAIYLILVKYQLNNSSSNFTGMPFRDLYRAAREQFLVSSDLALRAQLTEFIDHKLLRIKRTVDGAEHLMIPLDKPLLKQFMEQY 553          
BLAST of EOG090X0AVI vs. TrEMBL
Match: A0A0J7KDY3 (Origin recognition complex subunit 2 OS=Lasius niger OX=67767 GN=RF55_11807 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.614e-39
Identity = 94/271 (34.69%), Postives = 155/271 (57.20%), Query Frame = 2
Query:  458 LRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVI-DSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSS--LDSLVILAKCPNVSIFATVDHRFAERLL-----SKFEIFWVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENTNQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFV 1246
            +  G+++L HG GSK  L+  F N  +     +VI GF  ++++  + +++I D LG++ PT     L L   I      +   + RLY +I NI+ + + SS   + L  LA  PN+ I A+VDH  A  L      +KF  +W   D TT LPY  ET+  +S  + Q+  + L SL++V  SL +NA+ ++L+L K QL+N++ N  GM   +L   +++  LV++++ LR  LTEF DHKL++ K   DG+ ++ I LD+ L+++F+
Sbjct:    1 MEEGYSLLIHGLGSKRNLINDFHNEIIADHPTLVINGFFPSLSIKDILDNIIVDLLGLSCPTNSNDCLELIEKI-----LRDNPDDRLYLIIHNIDGIMLRSSKAQNVLAGLAAIPNIRIIASVDHINAPLLWDHIKRAKFNFYW--WDATTFLPYQAETAYENSLLVQQSGGLALSSLQNVFLSLTSNARTIYLILVKYQLDNSSNNFTGMPFKDLYRAAREQFLVSSDLALRAQLTEFIDHKLVRTKRTFDGAEHLTIPLDKSLLKQFM 264          
BLAST of EOG090X0AVI vs. TrEMBL
Match: F4WTE7 (Origin recognition complex subunit 2 OS=Acromyrmex echinatior OX=103372 GN=G5I_09105 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 3.444e-39
Identity = 113/343 (32.94%), Postives = 188/343 (54.81%), Query Frame = 2
Query:  251 RIDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEK--SFAEVFN-LLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVI-DSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHS--SLDSLVILAKCPNVSIFATVDHRFAERLL-----SKFEIFWVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENTNQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFV 1246
            + D+YF   S+KT  ++S ++L  L  ++LT     +L+      +   +   R+  L E   SF  ++  +L  G+++L HG GSK  L+  F N+ +     +VI GF  ++ L  + +++I D L +  PT     L L   +          + RLY +I NI+ + + S  + + L  LA  PN+ I A+VDH  A  L      +KF  +W   D TTLLPY  ETS  SS  + Q++ + L SL++V  SL +NA+ ++L+L + QL N++ N  GM   +L   +++  LV++++ LR  LTEF DHKL++IK   DG+ ++ I LD+ L+++F+
Sbjct:  218 QTDEYFEFQSEKT--VTSDRTLERLKNARLTEESLGKLLINQSHISTIHK--KRICSLTENCTSFFPMWQFILEEGYSLLLHGVGSKRNLINDFHNKIIEDHPTLVINGFFPSLTLKDILDNIIMDLLDLNCPTNLNDCLELIETV-----MGDNPDDRLYLLIHNIDGVMLRSNKAQNILANLAAIPNIHILASVDHINAPLLWDHVKCAKFNFYW--WDATTLLPYQAETSYESSLLVQQSSGLVLSSLQNVFLSLTSNARAIYLILVEYQLSNSSSNFTGMPFRDLYRAAREQFLVSSDLTLRAQLTEFIDHKLLRIKRTADGAEHLTIPLDKSLLKQFM 549          
BLAST of EOG090X0AVI vs. TrEMBL
Match: A0A158NMX6 (Uncharacterized protein OS=Atta cephalotes OX=12957 GN=105622060 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.883e-38
Identity = 114/343 (33.24%), Postives = 187/343 (54.52%), Query Frame = 2
Query:  251 RIDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEK--SFAEVFN-LLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVI-DSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHS--SLDSLVILAKCPNVSIFATVDHRFAERLL-----SKFEIFWVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENTNQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFV 1246
            + D+YF   S+K  II+S ++L  L  ++LT     +L+      +   +   R+  L E   SF  ++  +L  G+++L HG GSK  L+  F N  +     +VI GF  ++ L  + +++I D L +  PT     L L   +          + RLY +I NI+ + + S  + + L  LA  PN+ I A+VDH  A  L      +KF  +W   D TTLLPY  ETS  SS  + Q++ + L SL++V  SL +NA+ ++L+L + QL N++ N  GM   +L   +++  LV++++ LR  LTEF DHKL++IK   DG+ ++ I LD+ L+++F+
Sbjct:  218 QTDEYFESQSEK--IITSDRTLERLKNTRLTKESLGKLLINQNHISTIHK--NRICSLTENCTSFFPMWQFILEEGYSLLLHGVGSKRNLINDFHNEIIEDYPTLVINGFFPSLTLKDILDNIIIDLLDLNCPTNLNDCLELIETV-----MGDNPDDRLYLLIHNIDGVMLRSNKAQNILASLAAIPNIHILASVDHINAPLLWDHVKCAKFNFYW--WDATTLLPYQAETSYESSLLVQQSSGLMLSSLQNVFLSLTSNARAIYLILVEYQLSNSSSNFTGMPFRDLYRAAREQFLVSSDLTLRAQLTEFIDHKLLRIKRTVDGAEHLTIPLDKSLLKQFM 549          
BLAST of EOG090X0AVI vs. Ensembl Cavefish
Match: orc2 (origin recognition complex subunit 2 [Source:NCBI gene;Acc:103036654])

HSP 1 Score: 146.747 bits (369), Expect = 4.165e-38
Identity = 103/341 (30.21%), Postives = 178/341 (52.20%), Query Frame = 2
Query:  254 IDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLD--SLVILAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFD 1258
            +++YF  HS  +++++S ++L  L   KL     +RL+   P  +C     ++L    EK+F++    L+ GFN+L +G GSK  L+E+F    L     +V+ GF  ++ L  + N +   + +      ++P+     +  +L      +Y  Y +I N++   +    +  +L  LA  PN+ + A++DH  A  +   SK  +F W++ + T+ LPY +ETS  +S  + Q  ++ L SL  V  SL  NA+ +F LLA+ QLEN  N +  G+   +     +++ LV ++I LR  LTEF+DHKLI+ K   DG  Y+ I +D   +  F+   D
Sbjct:  233 VEEYFEAHSS-SKVLTSDRTLQKLQTPKLDRETLLRLLDGKP--SCYVDEISQLNRKHEKNFSKWMLQLQMGFNILLYGLGSKKFLLEKFRTTMLSDSVHLVVNGFFPSITLKSILNAITGEM-LEHDGSFRTPMDQIDFVVKTLKNDPDSHY--YVIIHNLDGPMLRGEKNQQALGQLASIPNMHLLASIDHINAPLVWDHSKMSLFNWLWYETTSFLPYTEETSYENSLLVQQTGALALSSLTHVLRSLTPNARGIFRLLAEFQLENKDNPSYTGLSFQDFYQRCREAFLVNSDITLRTQLTEFRDHKLIRTKKGADGVEYLLIPVDAGTLTDFLEKED 567          
BLAST of EOG090X0AVI vs. Ensembl Cavefish
Match: orc2 (origin recognition complex subunit 2 [Source:NCBI gene;Acc:103036654])

HSP 1 Score: 146.747 bits (369), Expect = 5.720e-38
Identity = 103/341 (30.21%), Postives = 178/341 (52.20%), Query Frame = 2
Query:  254 IDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLD--SLVILAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFD 1258
            +++YF  HS  +++++S ++L  L   KL     +RL+   P  +C     ++L    EK+F++    L+ GFN+L +G GSK  L+E+F    L     +V+ GF  ++ L  + N +   + +      ++P+     +  +L      +Y  Y +I N++   +    +  +L  LA  PN+ + A++DH  A  +   SK  +F W++ + T+ LPY +ETS  +S  + Q  ++ L SL  V  SL  NA+ +F LLA+ QLEN  N +  G+   +     +++ LV ++I LR  LTEF+DHKLI+ K   DG  Y+ I +D   +  F+   D
Sbjct:  239 VEEYFEAHSS-SKVLTSDRTLQKLQTPKLDRETLLRLLDGKP--SCYVDEISQLNRKHEKNFSKWMLQLQMGFNILLYGLGSKKFLLEKFRTTMLSDSVHLVVNGFFPSITLKSILNAITGEM-LEHDGSFRTPMDQIDFVVKTLKNDPDSHY--YVIIHNLDGPMLRGEKNQQALGQLASIPNMHLLASIDHINAPLVWDHSKMSLFNWLWYETTSFLPYTEETSYENSLLVQQTGALALSSLTHVLRSLTPNARGIFRLLAEFQLENKDNPSYTGLSFQDFYQRCREAFLVNSDITLRTQLTEFRDHKLIRTKKGADGVEYLLIPVDAGTLTDFLEKED 573          
BLAST of EOG090X0AVI vs. Ensembl Cavefish
Match: orc2 (origin recognition complex subunit 2 [Source:NCBI gene;Acc:103036654])

HSP 1 Score: 146.747 bits (369), Expect = 7.304e-38
Identity = 103/341 (30.21%), Postives = 178/341 (52.20%), Query Frame = 2
Query:  254 IDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLD--SLVILAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFD 1258
            +++YF  HS  +++++S ++L  L   KL     +RL+   P  +C     ++L    EK+F++    L+ GFN+L +G GSK  L+E+F    L     +V+ GF  ++ L  + N +   + +      ++P+     +  +L      +Y  Y +I N++   +    +  +L  LA  PN+ + A++DH  A  +   SK  +F W++ + T+ LPY +ETS  +S  + Q  ++ L SL  V  SL  NA+ +F LLA+ QLEN  N +  G+   +     +++ LV ++I LR  LTEF+DHKLI+ K   DG  Y+ I +D   +  F+   D
Sbjct:  285 VEEYFEAHSS-SKVLTSDRTLQKLQTPKLDRETLLRLLDGKP--SCYVDEISQLNRKHEKNFSKWMLQLQMGFNILLYGLGSKKFLLEKFRTTMLSDSVHLVVNGFFPSITLKSILNAITGEM-LEHDGSFRTPMDQIDFVVKTLKNDPDSHY--YVIIHNLDGPMLRGEKNQQALGQLASIPNMHLLASIDHINAPLVWDHSKMSLFNWLWYETTSFLPYTEETSYENSLLVQQTGALALSSLTHVLRSLTPNARGIFRLLAEFQLENKDNPSYTGLSFQDFYQRCREAFLVNSDITLRTQLTEFRDHKLIRTKKGADGVEYLLIPVDAGTLTDFLEKED 619          
BLAST of EOG090X0AVI vs. Ensembl Sea Lamprey
Match: orc2 (origin recognition complex, subunit 2 [Source:ZFIN;Acc:ZDB-GENE-061013-682])

HSP 1 Score: 124.79 bits (312), Expect = 6.286e-33
Identity = 91/275 (33.09%), Postives = 142/275 (51.64%), Query Frame = 2
Query:  467 GFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVI-----DSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVI--LAKCPNVSIFATVDHRFAERLL--SKFEIF-WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLEN-TNQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFD 1258
            GFNVL +G GSK  L+E F    L     +VI G+  ++ +  V N +I     D +G+  P +      + T  R   S +      LY VI NI+   + +  +  V+  LA  PNV + A+VDH     +   SK   F W++C+ TT  PY +ETS  +S  + Q++S+ L SL  V  SL  NA+ +F LL + +++N  N +  G+   +     + + LV +++ LR  LTEF+DHKLI+ K   DG  Y+ I +D   +  F+ + D
Sbjct:    8 GFNVLLYGLGSKRNLLEDFRCSLLPNRCHVVINGYFPSITIKMVLNSIISEFLEDGIGIRNPMEQLD--YICTRFRQDSSLE------LYLVIHNIDGEMLRAERNQRVLGQLASLPNVHLIASVDHINGPLIWEQSKVGWFNWLWCEVTTYEPYAEETSYENSLLVQQSDSLALSSLTHVLRSLTPNARGIFQLLVEHEIDNKNNPSNPGLSFQDFYERCRVAFLVNSDLTLRAQLTEFRDHKLIRTKKGADGVEYLSIPIDASTLSSFMENQD 274          
BLAST of EOG090X0AVI vs. Ensembl Yeast
Match: ORC2 (Subunit of the origin recognition complex (ORC); ORC directs DNA replication by binding to replication origins and is also involved in transcriptional silencing; interacts with Spp1p and with trimethylated histone H3; phosphorylated by Cdc28p [Source:SGD;Acc:S000000264])

HSP 1 Score: 70.4774 bits (171), Expect = 1.940e-13
Identity = 82/356 (23.03%), Postives = 155/356 (43.54%), Query Frame = 2
Query:  266 FSQHSDKTRII-SSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYC---------EN------------CIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPL---SLATAIRDSLSCKSRH--NYRLYFVISNIERLAIHSSL--DSLVILAKCPNVSIFATVDHRFAERLLSKFE---IFWVFCDWTTLLPYCQETS-DSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLEN-------------TNQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDG 1195
            F  + D+ +I+ ++ KS   +  +   T E   L++        ++   +L E+++K F + +  L  GF++L +G GSK   +E FA  +L           EN            C+++ G++ + N   VF ++ D L  A  T+ ++      +   I+  +        + +L  V+ N++  +I  +     L  L+    ++I A+ DH +A  L    +     +VF D +   P   E++     +    + S G E  K V  SL  N+K+++ LL + Q++N             T +    + + N LC +    + +NEI LR++L EF +HK+  I     G
Sbjct:  243 FEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANTGPKRGTQRTGVELKLFNHLCAA--DFIASNEIALRSMLREFIEHKMANITKNNSG 596          
BLAST of EOG090X0AVI vs. Ensembl Nematostella
Match: EDO42434 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C7])

HSP 1 Score: 136.732 bits (343), Expect = 1.716e-36
Identity = 101/342 (29.53%), Postives = 180/342 (52.63%), Query Frame = 2
Query:  254 IDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQIN-ARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDS--LVILAKCPNVSIFATVDH-----RFAERLLSKFEIFWVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVND 1252
            I +YF+ H   T+ ++S ++L+ LG   +   E   L   L + + T Q    +L       F++    +R+GFN+L +G GSK  LM++F +  L     +V+ GF  ++ + Q+ N + + + +      +S +   T IRD  + K +    LY +I NI+   + S      L +LA+ P + I A++DH      + + + S+F+  W++ D +T  PY +ETS  +S  + Q+ ++ L S+  V  SL  N + +FL++ K QLE   N +  G+ + +L    ++  LV +E  LR  LTEF+DHKLI+ +   DG  ++ I LD   +++F+ +
Sbjct:    2 IQEYFAVHHS-TKCLTSDRTLASLGAPLMDQEE---LSEHLQQVSATHQDECVKLYAKYRSFFSKWVFQIRHGFNLLFYGMGSKKVLMDQFRSSMLQGLTQLVVNGFFPSITIKQILNTITEEV-LEHDGAFRSVIDQTTFIRDMFN-KGKAPGSLYLIIHNIDGPMLRSKKTQTILSLLAESPLIHIIASIDHINAPLVWDQSMCSRFK--WLWNDVSTFEPYVEETSYENSLLVQQSGALALSSMAHVMRSLTPNGQGIFLVIVKKQLEEKDNSSYIGIAMHDLYTACRERFLVNSEQTLRAQLTEFRDHKLIRSRKGADGVEHLHIPLDTATLKQFLEE 335          
BLAST of EOG090X0AVI vs. Ensembl Nematostella
Match: EDO27801 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T893])

HSP 1 Score: 93.5893 bits (231), Expect = 2.923e-22
Identity = 60/190 (31.58%), Postives = 106/190 (55.79%), Query Frame = 2
Query:  716 LYFVISNIERLAIHSSLDS--LVILAKCPNVSIFATVDH-----RFAERLLSKFEIFWVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFDE 1261
            LY +I NI+   + S      L +LA+ P + I A++DH      + + + S+F+  W++ D +T  PY +ETS  +S  + Q+ ++ L S+  V  SL  N + +FL++ K QLE   N +  G+ + +L    ++  LV +E  LR  LTEF+DHKLI+ +   D   ++ I LD   +++F+ + ++
Sbjct:    1 LYLIIHNIDGPMLRSKKTQTILSLLAESPLIHIIASIDHINAPLVWDQSMCSRFK--WLWNDVSTFEPYVEETSYENSLLVQQSGALALSSMAHVMRSLTPNGQGIFLVIVKKQLEEKDNSSYIGIAMHDLYTACRERFLVNSEQTLRAQLTEFRDHKLIRSRKGADAVEHLHIPLDTATLKQFLEEQEQ 188          
BLAST of EOG090X0AVI vs. Ensembl Medaka
Match: orc2 (origin recognition complex subunit 2 [Source:NCBI gene;Acc:101159045])

HSP 1 Score: 132.109 bits (331), Expect = 7.809e-33
Identity = 100/340 (29.41%), Postives = 169/340 (49.71%), Query Frame = 2
Query:  257 DQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQG--KSPLSLATAIRDSLSCKSRHNYRLYFVISNIER--LAIHSSLDSLVILAKCPNVSIFATVDHRFAERLLSKFEIF---WVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENT-NQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVND 1252
            ++YF  H   +++++S ++L  L   KL     + L+   P  +C  +   +L    +K F +    L+ GF+VL +G GSK  L+E F    L  E  +V+ GF  ++ L  + N +   +      QG  ++P      I  +L  K R +  LY +I NI+   L    +  +L  LA   N+ + A++DH  A  +  +F++    W++ +  T  PY +ETS  +S  + Q  ++ L SL  V  SL  NA+ +F LL K QLEN  N    G    +     +++ LV +++ LR  LTEF+DHKLI+ +   DG  Y+ + +D   +  F+ +
Sbjct:  256 EEYFEAHGS-SKVLTSDRTLERLQTPKLDRETLVHLLEGKP--SCYSKEIQQLHNKNKKHFHKWMLQLQLGFSVLVYGLGSKKALLEDFRTSHLAHEIHLVVNGFFPSITLKTILNAITSEV---LEDQGSFRTPSDQIQFISQTL--KERPDLHLYLLIHNIDGPMLRGEKTQSALGQLASLSNLHLVASLDHINAPLVWDQFKVSQFNWLWWECVTFQPYAEETSYENSLLVQQTGALALSSLTHVLRSLTPNARGIFRLLVKFQLENKDNPLYTGFSFQDFYQRCREAFLVNSDLTLRTQLTEFRDHKLIRTRKGADGVEYLTVAVDASTLMDFLEN 587          
BLAST of EOG090X0AVI vs. Planmine SMEST
Match: SMESG000010474.1 (SMESG000010474.1)

HSP 1 Score: 752.666 bits (1942), Expect = 0.000e+0
Identity = 369/377 (97.88%), Postives = 372/377 (98.67%), Query Frame = 2
Query:  134 MVNNNKASDHSNKIVASTKLTDEIKDLQLSFHKQISLKCRIDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVILAKCPNVSIFATVDHRFAERLLSKFEIFWVFCDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKLQLENTNQNTEGMLIDNLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFDEF 1264
            MVNNNKASD+SNKIVASTKLTDE+KDLQLSFHKQISLKCRIDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLM KLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFL CENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVILAKCPNVSIFATVDHRFAERLLSKFEIFWVF DWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAK QLENTNQ TEGMLI+NLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFDEF
Sbjct:    1 MVNNNKASDNSNKIVASTKLTDEVKDLQLSFHKQISLKCRIDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEAIRLMPKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKLGLMERFANRFLSCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSPLSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVILAKCPNVSIFATVDHRFAERLLSKFEIFWVFFDWTTLLPYCQETSDSSSRFISQNNSVGLESLKSVSASLHNNAKQVFLLLAKFQLENTNQKTEGMLIENLLCLSKDSLLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDFDEF 377          
The following BLAST results are available for this feature:
BLAST of EOG090X0AVI vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ORC21.102e-3128.54origin recognition complex subunit 2 [Source:HGNC ... [more]
back to top
BLAST of EOG090X0AVI vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
orc-29.291e-1224.41Origin recognition complex subunit 2 [Source:UniP... [more]
back to top
BLAST of EOG090X0AVI vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Orc22.205e-3328.20gene:FBgn0015270 transcript:FBtr0082866[more]
back to top
BLAST of EOG090X0AVI vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
orc21.275e-2931.27origin recognition complex, subunit 2 [Source:ZFIN... [more]
back to top
BLAST of EOG090X0AVI vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
orc26.753e-3329.83origin recognition complex subunit 2 [Source:NCBI ... [more]
orc22.894e-3229.97origin recognition complex subunit 2 [Source:NCBI ... [more]
orc24.318e-3229.97origin recognition complex subunit 2 [Source:NCBI ... [more]
orc24.474e-3229.97origin recognition complex subunit 2 [Source:NCBI ... [more]
orc21.528e-3129.97origin recognition complex subunit 2 [Source:NCBI ... [more]
back to top
BLAST of EOG090X0AVI vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Orc21.219e-2827.75origin recognition complex, subunit 2 [Source:MGI ... [more]
Orc21.699e-2828.61origin recognition complex, subunit 2 [Source:MGI ... [more]
back to top
BLAST of EOG090X0AVI vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24168|ORC2_DROME2.210e-3228.20Origin recognition complex subunit 2 OS=Drosophila... [more]
sp|Q13416|ORC2_HUMAN5.293e-3128.54Origin recognition complex subunit 2 OS=Homo sapie... [more]
sp|Q91628|ORC2_XENLA6.745e-3029.67Origin recognition complex subunit 2 OS=Xenopus la... [more]
sp|A6QNM3|ORC2_BOVIN1.238e-2829.36Origin recognition complex subunit 2 OS=Bos taurus... [more]
sp|Q75PQ8|ORC2_RAT4.148e-2828.74Origin recognition complex subunit 2 OS=Rattus nor... [more]
back to top
BLAST of EOG090X0AVI vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A195EXS62.299e-4233.82Origin recognition complex subunit 2 OS=Trachymyrm... [more]
A0A151WQ461.343e-4032.68Origin recognition complex subunit 2 OS=Trachymyrm... [more]
A0A0J7KDY31.614e-3934.69Origin recognition complex subunit 2 OS=Lasius nig... [more]
F4WTE73.444e-3932.94Origin recognition complex subunit 2 OS=Acromyrmex... [more]
A0A158NMX61.883e-3833.24Uncharacterized protein OS=Atta cephalotes OX=1295... [more]
back to top
BLAST of EOG090X0AVI vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
orc24.165e-3830.21origin recognition complex subunit 2 [Source:NCBI ... [more]
orc25.720e-3830.21origin recognition complex subunit 2 [Source:NCBI ... [more]
orc27.304e-3830.21origin recognition complex subunit 2 [Source:NCBI ... [more]
back to top
BLAST of EOG090X0AVI vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
orc26.286e-3333.09origin recognition complex, subunit 2 [Source:ZFIN... [more]
back to top
BLAST of EOG090X0AVI vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ORC21.940e-1323.03Subunit of the origin recognition complex (ORC); O... [more]
back to top
BLAST of EOG090X0AVI vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO424341.716e-3629.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278012.923e-2231.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EOG090X0AVI vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
orc27.809e-3329.41origin recognition complex subunit 2 [Source:NCBI ... [more]
back to top
BLAST of EOG090X0AVI vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000010474.10.000e+097.88SMESG000010474.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035323 ID=SMED30035323|Name=EOG090X0AVI|organism=Schmidtea mediterranea sexual|type=transcript|length=1401bp
TCCGATCTTTTAAATATTAAGCTTTTAAAAATAAACTTCAATTTTTAATT
TAATTATGAATAAGAATGACAATATACAAAGAATTTCTAGTTTTCGCATA
CCTAAAAATGCCGTAACTCGTTCCAAATCAGTGATGGTAAACAATAACAA
GGCTTCTGATCATTCTAATAAAATTGTTGCTAGCACCAAATTAACCGATG
AAATTAAAGATTTGCAACTGAGTTTTCACAAGCAAATTTCATTAAAATGT
CGGATTGATCAATATTTCTCTCAACATTCCGACAAGACTCGAATAATTTC
TTCGAAGAAATCTCTGTCAGATTTAGGCGAATCCAAATTGACAACTGCCG
AAGCGATTCGATTAATGGCGAAATTGCCGCGCGCGGCTTGCACGGAGCAG
ATAAATGCGAGATTGGCAGAACTGGAGGAGAAATCGTTTGCGGAGGTTTT
CAATTTGTTGCGGAACGGGTTCAATGTGCTTGCTCACGGATTCGGATCGA
AACTTGGCCTGATGGAGCGATTTGCCAATCGATTTCTCTACTGCGAGAAT
TGCATTGTGATTCCGGGTTTCGATGGTGCCGTCAATTTGTGCCAGGTATT
CAATGACGTGATCGACTCGCTGGGAATGGCCGCGCCGACCCAGGGCAAAT
CGCCGTTGTCATTAGCAACCGCCATTCGGGACTCCCTCAGCTGCAAATCC
CGCCACAATTATCGATTATATTTCGTTATCAGCAACATCGAGCGGCTGGC
GATTCACTCGTCACTCGACTCGCTTGTTATTCTCGCTAAATGTCCGAATG
TTTCCATTTTTGCTACTGTCGATCACAGATTCGCCGAGCGCTTATTGAGC
AAGTTTGAAATATTTTGGGTATTTTGCGATTGGACAACGCTACTGCCGTA
TTGTCAGGAGACGAGCGACAGCAGCTCGCGTTTTATATCGCAGAATAACT
CAGTTGGTTTGGAATCCTTGAAATCTGTAAGCGCCAGCCTTCATAATAAT
GCCAAGCAAGTTTTCCTGCTTTTGGCAAAGTTGCAATTAGAAAATACAAA
TCAAAATACTGAAGGAATGTTAATTGATAATTTGCTCTGTCTCAGTAAGG
ATTCATTACTCGTTACGAATGAAATTGGGCTGAGGAATCTTCTCACGGAG
TTTAAAGATCATAAATTGATCCAGATAAAAATGATAGGTGACGGCTCGTG
TTATGTGAAAATATTGCTTGATCAGCATTTGATAGAGAAATTCGTCAACG
ATTTTGACGAGTTCTAAATATAACTTTGAATTGTCTTTATTTTCCATGAA
ATTAGTAGAGTGAGTCATTTCGCCACTATTTGTTACCTCGCATTAGTTAG
CAATACCTCGTTATCTATACCTCATAACAATTATCTATCGACCTCGTATC
A
back to top

protein sequence of SMED30035323-orf-1

>SMED30035323-orf-1 ID=SMED30035323-orf-1|Name=SMED30035323-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=404bp
MNKNDNIQRISSFRIPKNAVTRSKSVMVNNNKASDHSNKIVASTKLTDEI
KDLQLSFHKQISLKCRIDQYFSQHSDKTRIISSKKSLSDLGESKLTTAEA
IRLMAKLPRAACTEQINARLAELEEKSFAEVFNLLRNGFNVLAHGFGSKL
GLMERFANRFLYCENCIVIPGFDGAVNLCQVFNDVIDSLGMAAPTQGKSP
LSLATAIRDSLSCKSRHNYRLYFVISNIERLAIHSSLDSLVILAKCPNVS
IFATVDHRFAERLLSKFEIFWVFCDWTTLLPYCQETSDSSSRFISQNNSV
GLESLKSVSASLHNNAKQVFLLLAKLQLENTNQNTEGMLIDNLLCLSKDS
LLVTNEIGLRNLLTEFKDHKLIQIKMIGDGSCYVKILLDQHLIEKFVNDF
DEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR007220ORC2
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0000808origin recognition complex
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007220Origin recognition complex, subunit 2PFAMPF04084ORC2coord: 83..390
e-value: 5.5E-53
score: 180.0
IPR007220Origin recognition complex, subunit 2PANTHERPTHR14052ORIGIN RECOGNITION COMPLEX SUBUNIT 2coord: 63..400