SMED30035316

Overview
NameSMED30035316
Smed IDSMED30035316
Length (bp)2874
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30035316 (SMED30035316) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30035316 (SMED30035316) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30035316 (SMED30035316) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30035316 (SMED30035316) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035316

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30035316SMESG000072458.1 dd_Smed_v4_11336_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30035316 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001997:73762..95175 +14171
Homology
BLAST of SMED30035316 vs. Ensembl Human
Match: GSE1 (Gse1 coiled-coil protein [Source:HGNC Symbol;Acc:HGNC:28979])

HSP 1 Score: 56.6102 bits (135), Expect = 2.248e-7
Identity = 32/88 (36.36%), Postives = 47/88 (53.41%), Query Frame = 1
Query:   34 CFSCAE-IGNCSEL--YVRKPPDYYG----PYFPTFERFHPPSSSNAIS-SDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTKR 273
            CF C   IG   EL   V++P    G    P+FP  ++  P   +  +S +DG V VCA+C+ +L  QW  FE  +T   +R+Y+ KR
Sbjct:   30 CFICGGGIGRGKELKLQVKQPAAGAGTPAQPFFPFLQQQEPAPGARELSPADGCVLVCAVCRCFLGEQWAAFERARTPVDKRMYWLKR 117          
BLAST of SMED30035316 vs. Ensembl Fly
Match: px (gene:FBgn0003175 transcript:FBtr0331942)

HSP 1 Score: 56.6102 bits (135), Expect = 1.357e-7
Identity = 35/100 (35.00%), Postives = 42/100 (42.00%), Query Frame = 1
Query:   16 YAKMERCFSCAEIGNCSELYVRKPPDYYGP---YFPTFERFHPPSS-SNAISSDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTKRHDGINYTGND 303
            +  M  CF C   G+     +R   +   P   YFP  ER  PP+     +     V  C LC   LN QW  +E  K    QRIY  KR DG  Y G D
Sbjct:   98 HVPMTICFVCGGHGSFEPQPLRIRHNAERPSESYFPFLERHEPPNGVPGVVPGQEYVWACMLCFRSLNEQWDAYERQKKPLLQRIYHMKRVDGKGYIGAD 197          
BLAST of SMED30035316 vs. Ensembl Fly
Match: px (gene:FBgn0003175 transcript:FBtr0071838)

HSP 1 Score: 56.6102 bits (135), Expect = 1.376e-7
Identity = 35/100 (35.00%), Postives = 42/100 (42.00%), Query Frame = 1
Query:   16 YAKMERCFSCAEIGNCSELYVRKPPDYYGP---YFPTFERFHPPSS-SNAISSDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTKRHDGINYTGND 303
            +  M  CF C   G+     +R   +   P   YFP  ER  PP+     +     V  C LC   LN QW  +E  K    QRIY  KR DG  Y G D
Sbjct:   98 HVPMTICFVCGGHGSFEPQPLRIRHNAERPSESYFPFLERHEPPNGVPGVVPGQEYVWACMLCFRSLNEQWDAYERQKKPLLQRIYHMKRVDGKGYIGAD 197          
BLAST of SMED30035316 vs. Ensembl Zebrafish
Match: gse1 (Gse1 coiled-coil protein [Source:NCBI gene;Acc:567033])

HSP 1 Score: 54.6842 bits (130), Expect = 6.117e-7
Identity = 35/110 (31.82%), Postives = 47/110 (42.73%), Query Frame = 1
Query:   34 CFSCAE---IGNCSELYVRKPPDYYGPYFPTFERFHPPSSSNAISSDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTK----------------RHDGINYTGNDS 306
            CF C      G    L V+   +  GP+FP  +   P   +  I  DG   VCA+C  +L  QW +FE N+T   +R+Y+ K                R    NY GNDS
Sbjct:   44 CFICGSGVTAGKELSLQVKYQREKDGPFFPFLQGQDPAPGAPEIGPDGEALVCAVCHCFLREQWNSFERNRTPIEKRMYWLKRPYQCDLRNITYDLERRMSAGNYDGNDS 153          
BLAST of SMED30035316 vs. Ensembl Zebrafish
Match: gse1 (Gse1 coiled-coil protein [Source:NCBI gene;Acc:567033])

HSP 1 Score: 54.6842 bits (130), Expect = 6.117e-7
Identity = 35/110 (31.82%), Postives = 47/110 (42.73%), Query Frame = 1
Query:   34 CFSCAE---IGNCSELYVRKPPDYYGPYFPTFERFHPPSSSNAISSDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTK----------------RHDGINYTGNDS 306
            CF C      G    L V+   +  GP+FP  +   P   +  I  DG   VCA+C  +L  QW +FE N+T   +R+Y+ K                R    NY GNDS
Sbjct:   44 CFICGSGVTAGKELSLQVKYQREKDGPFFPFLQGQDPAPGAPEIGPDGEALVCAVCHCFLREQWNSFERNRTPIEKRMYWLKRPYQCDLRNITYDLERRMSAGNYDGNDS 153          
BLAST of SMED30035316 vs. Ensembl Xenopus
Match: GSE1 (Gse1 coiled-coil protein [Source:NCBI gene;Acc:100379977])

HSP 1 Score: 56.225 bits (134), Expect = 2.945e-7
Identity = 58/260 (22.31%), Postives = 105/260 (40.38%), Query Frame = 1
Query:   34 CFSCA---EIGNCSELYVRKPPDYYGPYFPTFERFHPPSSSNAISSDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTKR-----HDGINYTGNDSFNSHSESLIXXXXXXXXXXXXXXXXXXLNSESVNLSNKASLANTNSKNNLMEINNEKXXXXXXXXXDISFPGNNKQLTEHYICCFVCGLPCLKWHAKTAYSSQMLENKEYFPFFEKLDPPQSSIPLT-NGATKICIQCEADLSKQWDHYEKLGTDQMSRIY 786
            CF C      G    L VR P      +FP  ++  P   +  +S  G V+VCA+C+ +L +QW  FE ++T   +R+Y+ KR      DG      D +N + +S ++  S+   S+ E            N    AS   + +  +        ++ +  L  +     + ++       C++CG      H       +      +FPF     PP  +  +T  G+ + C +C + L +QW  ++      + R+Y
Sbjct:   38 CFICGGGVPRGREVRLPVRCPAREGCAFFPFLQQQEPAPGAEPLSPGGCVRVCAVCQRFLAAQWDAFERSRTPLEKRMYWLKRPYQCGGDGARNNPRD-WNPNYDSDLSDLSDNPLSEPEESGEARPEPTQGNRRQWASTVPSLAPQHCAPCRESPNDRARRLGSETDHQTHGRENGHLPGLCYICGGHSAG-HTIHVQKQEHTPETPFFPFLWLHTPPPGAQAITPGGSARACTRCFSSLMQQWHSFDVASVPVLQRLY 295          
BLAST of SMED30035316 vs. Ensembl Xenopus
Match: GSE1 (Gse1 coiled-coil protein [Source:NCBI gene;Acc:100379977])

HSP 1 Score: 56.225 bits (134), Expect = 2.984e-7
Identity = 58/260 (22.31%), Postives = 105/260 (40.38%), Query Frame = 1
Query:   34 CFSCA---EIGNCSELYVRKPPDYYGPYFPTFERFHPPSSSNAISSDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTKR-----HDGINYTGNDSFNSHSESLIXXXXXXXXXXXXXXXXXXLNSESVNLSNKASLANTNSKNNLMEINNEKXXXXXXXXXDISFPGNNKQLTEHYICCFVCGLPCLKWHAKTAYSSQMLENKEYFPFFEKLDPPQSSIPLT-NGATKICIQCEADLSKQWDHYEKLGTDQMSRIY 786
            CF C      G    L VR P      +FP  ++  P   +  +S  G V+VCA+C+ +L +QW  FE ++T   +R+Y+ KR      DG      D +N + +S ++  S+   S+ E            N    AS   + +  +        ++ +  L  +     + ++       C++CG      H       +      +FPF     PP  +  +T  G+ + C +C + L +QW  ++      + R+Y
Sbjct:   38 CFICGGGVPRGREVRLPVRCPAREGCAFFPFLQQQEPAPGAEPLSPGGCVRVCAVCQRFLAAQWDAFERSRTPLEKRMYWLKRPYQCGGDGARNNPRD-WNPNYDSDLSDLSDNPLSEPEESGEARPEPTQGNRRQWASTVPSLAPQHCAPCRESPNDRARRLGSETDHQTHGRENGHLPGLCYICGGHSAG-HTIHVQKQEHTPETPFFPFLWLHTPPPGAQAITPGGSARACTRCFSSLMQQWHSFDVASVPVLQRLY 295          
BLAST of SMED30035316 vs. Ensembl Mouse
Match: Gse1 (genetic suppressor element 1, coiled-coil protein [Source:MGI Symbol;Acc:MGI:1098275])

HSP 1 Score: 55.0694 bits (131), Expect = 4.441e-7
Identity = 29/83 (34.94%), Postives = 44/83 (53.01%), Query Frame = 1
Query:   34 CFSCAE-IGNCSELYVR-KPPDYYGPYFPTFERFHPPSSSNAISS-DGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTKR 273
            CF C   I    EL +  +P     P+FP  ++  P   +  +S+ DG V VCA+C+ +L  QW  FE  +T   +R+Y+ KR
Sbjct:   24 CFICGGGIARGKELKLPVRPAGPAQPFFPFLQQQEPAPGARGLSATDGCVLVCAVCRCFLAEQWAAFERARTPVDKRVYWLKR 106          
BLAST of SMED30035316 vs. TrEMBL
Match: V3ZF67 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_155782 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.305e-17
Identity = 73/278 (26.26%), Postives = 110/278 (39.57%), Query Frame = 1
Query:   34 CFSCAEIGNCSELYVRKPPDYYGPYFPTFERFHPPSSSNAISSDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTKRHD--------------------GINYTGNDSFNSHSESLIXXXXXXXXXXXXXXXXXXLNSESVNLSNKASLANTNSKNNLMEINNEKXXXXXXXXXDISFPGNNKQLTEHYICCFVCGLPCLKWHAKTAYSSQMLENKEYFPFFEKLDPPQSSIPLTN-GATKICIQCEADLSKQWDHYEKLGTDQMSRIYHITNDH 804
            CF C  IG    L +++     GPYFP  E+  PP  S    +DG V  C +C  +L  QW ++E NKT   +R+Y+ KR D                    G+ Y  ND +   S    +   +         +S    S+   +       N +   +L   N             +S         +    CF C L     + K   + +   N+ YFPF E L PP+ S PL + G T++C  C   L  QW  YE+ GT   +R+Y +  ++
Sbjct:    7 CFVCGNIGADLPLNIKQKDK--GPYFPFLEQHEPPKGSRLPGADGIVDSCKVCYSFLRQQWDSYERNKTPAIKRLYWLKRSDNGHFTGAEMKFQGEYMAQVMGLQYQTNDGYEPVSPEDASYSRDGLPRSQLPHQSQPSRSK---VYKDVPSNNPDGALDLSVTNKPSETRPNSSKGSLS--------QKDVFVCFTCALDSQLSNCKIVSAIKHAANEPYFPFLETLAPPRGSTPLNHQGVTRVCNGCFESLVTQWLSYERAGTPLSARLYKMKENY 271          
BLAST of SMED30035316 vs. TrEMBL
Match: A0A267F7Y0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034164g1 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.491e-15
Identity = 66/229 (28.82%), Postives = 103/229 (44.98%), Query Frame = 1
Query:  550 ICCFVCGLPCLKWHAKTAYSSQMLENKEYFPFFEKLDPPQSSIPLTNGATKICIQCEADLSKQWDHYEKLGTDQMSRIYHITNDHSTQFSITNPGRFITNSLTNTHHYSMLKLKNTVLKCSLCLNKIIDT-YRVSWNPRATCLCI----------PHLKNFQFPTDGVMVDRLAEETIICDVCHYFLSFQTQNCVLIPFHLREYKLPKVGYLPPMYSGSN-DNKTGSNP 1200
            I CF+C     K  AK  Y++++ +N E+FPF ++L PP  ++PLT GATK+C+QC + L++Q+ HYE + T Q SR+Y + ++           +F  N+ T +            L C LC +   DT   +SW P A+              P L         +++D+     + C  C   L  Q      +P   R Y+L +     P  +G       GSNP
Sbjct:  180 IRCFLCRKSMAKQDAKIVYATRVSDNCEHFPFLKQLVPPPEALPLTQGATKLCLQCHSSLAEQYRHYEMVKTPQDSRVYQVVSEGGQT-------KFYCNTGTLS------------LSCPLCGDSFKDTPIWLSWKPTASSTGGGGNSSSNPFYPLLSKVTCEYSHLLIDKQRGRLLACRTCCDHLHQQWTQQERLPPQSRYYQLRRTPPSQPSPAGGGVAGSPGSNP 389          

HSP 2 Score: 79.7221 bits (195), Expect = 2.635e-11
Identity = 55/169 (32.54%), Postives = 75/169 (44.38%), Query Frame = 1
Query: 1318 KTPIQQTIDQNRSNSIMKPS-----ISNQDQTVPG--PIIANCHICLHELRDPNNLKTLRATANEEYMDQPYFPFLKTLRANSM--KNYEFPVCLHCYYNMYGQWRMSQKASI---PIYGRKYNYNELMCTQCQRLCAQKSDTLILRDRLVCIACSE--NRNSDAAKSG 1782
            + P Q    Q R     +PS     ++    + PG  P+IA CH+CL  L +P  LK LR          PYFPFL  LR NS    N  FPVC  CY N+  QW     +S+   P         E +C+ C +L   K +  +  D L+C+ C+    R   +  SG
Sbjct:  356 RLPPQSRYYQLRRTPPSQPSPAGGGVAGSPGSNPGVRPMIAQCHVCLCALHNPETLKLLRHKPKSGRPASPYFPFLANLRHNSQASANGTFPVCDLCYTNLRWQWIRRSSSSVNSAPDAASASYQTEYICSGCLQLKTSKEEVRLQGDCLLCLDCATIGGRAGASGSSG 524          
BLAST of SMED30035316 vs. TrEMBL
Match: A0A267GF61 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015755g4 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.035e-15
Identity = 66/229 (28.82%), Postives = 104/229 (45.41%), Query Frame = 1
Query:  550 ICCFVCGLPCLKWHAKTAYSSQMLENKEYFPFFEKLDPPQSSIPLTNGATKICIQCEADLSKQWDHYEKLGTDQMSRIYHITNDHSTQFSITNPGRFITNSLTNTHHYSMLKLKNTVLKCSLCLNKIIDT-YRVSWNPRATCLCI----------PHLKNFQFPTDGVMVDRLAEETIICDVCHYFLSFQTQNCVLIPFHLREYKLPKVGYLPPMYSGSNDNKT-GSNP 1200
            I CF+C     K  AK  Y++++ +N E+FPF ++L PP  ++PLT GATK+C+QC + L++Q+ HYE + T Q SR+Y + ++           +F  N+ T +            L C LC +   DT   +SW P A+              P L         +++D+     + C  C   L  Q      +P   R Y+L +     P  +G     + GSNP
Sbjct:  186 IRCFLCRKSMAKQDAKIVYATRVSDNCEHFPFLKQLVPPPEALPLTQGATKLCLQCHSSLAEQYRHYEMVKTPQDSRVYQVVSEGGQT-------KFYCNTGTLS------------LSCPLCGDSFKDTPIWLSWKPTASSTGGGGNSSSTPFYPLLSKVTCEYSHLLIDKQRGRLLACRTCCDHLHQQWTQQERLPPQSRYYQLRRTPPSQPSPAGGGVAASPGSNP 395          

HSP 2 Score: 79.7221 bits (195), Expect = 2.757e-11
Identity = 47/132 (35.61%), Postives = 62/132 (46.97%), Query Frame = 1
Query: 1408 PIIANCHICLHELRDPNNLKTLRATANEEYMDQPYFPFLKTLRANSM--KNYEFPVCLHCYYNMYGQWRMSQKASI---PIYGRKYNYNELMCTQCQRLCAQKSDTLILRDRLVCIACSE--NRNSDAAKSG 1782
            P+IA CH+CL  L +P  LK LR          PYFPFL  LR NS    N  FPVC  CY N+  QW     +S+   P         E +C+ C +L   K +  +  D L+C+ C+    R   +  SG
Sbjct:  399 PMIAQCHVCLCALHNPETLKLLRHKPKSGRPASPYFPFLANLRHNSQASANGTFPVCDLCYTNLRWQWIRRSSSSVNSTPDAASASYQTEYICSGCLQLKTSKEEVRLQGDCLLCLDCATIGGRAGASGSSG 530          
BLAST of SMED30035316 vs. TrEMBL
Match: A0A267EW61 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015755g3 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.302e-15
Identity = 66/229 (28.82%), Postives = 104/229 (45.41%), Query Frame = 1
Query:  550 ICCFVCGLPCLKWHAKTAYSSQMLENKEYFPFFEKLDPPQSSIPLTNGATKICIQCEADLSKQWDHYEKLGTDQMSRIYHITNDHSTQFSITNPGRFITNSLTNTHHYSMLKLKNTVLKCSLCLNKIIDT-YRVSWNPRATCLCI----------PHLKNFQFPTDGVMVDRLAEETIICDVCHYFLSFQTQNCVLIPFHLREYKLPKVGYLPPMYSGSNDNKT-GSNP 1200
            I CF+C     K  AK  Y++++ +N E+FPF ++L PP  ++PLT GATK+C+QC + L++Q+ HYE + T Q SR+Y + ++           +F  N+ T +            L C LC +   DT   +SW P A+              P L         +++D+     + C  C   L  Q      +P   R Y+L +     P  +G     + GSNP
Sbjct:  182 IRCFLCRKSMAKQDAKIVYATRVSDNCEHFPFLKQLVPPPEALPLTQGATKLCLQCHSSLAEQYRHYEIVKTPQDSRVYQVVSEGGQT-------KFYCNTGTLS------------LSCPLCGDSFKDTPIWLSWKPTASSTGGGGNSSSTPFYPLLSKVTCEYSHLLIDKQRGRLLACRTCCDHLHQQWTQQERLPPQSRYYQLRRTPPSQPSPAGGGVAASPGSNP 391          

HSP 2 Score: 81.2629 bits (199), Expect = 9.651e-12
Identity = 50/132 (37.88%), Postives = 64/132 (48.48%), Query Frame = 1
Query: 1408 PIIANCHICLHELRDPNNLKTLRATANEEYMDQPYFPFLKTLRANSM--KNYEFPVCLHCYYNMYGQW-RMSQKA--SIPIYGRKYNYNELMCTQCQRLCAQKSDTLILRDRLVCIACSE--NRNSDAAKSG 1782
            P+IA CH+CL  L +P  LK LR          PYFPFL  LR NS    N  FPVC  CY N+  QW R S  +  SIP         E +C+ C +L   K +  +  D L+C+ C+    R   +  SG
Sbjct:  395 PMIAQCHVCLCALHNPETLKLLRHKPKSGRPASPYFPFLANLRHNSQASANGTFPVCDLCYTNLRWQWIRRSSSSVNSIPDAASASYQTEYICSGCLQLKTSKEEVRLQGDCLLCLDCATIGGRAGASGSSG 526          
BLAST of SMED30035316 vs. TrEMBL
Match: A0A1I8J3G1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 5.518e-15
Identity = 66/230 (28.70%), Postives = 104/230 (45.22%), Query Frame = 1
Query:  550 ICCFVCGLPCLKWHAKTAYSSQMLENKEYFPFFEKLDPPQSSIPLTNGATKICIQCEADLSKQWDHYEKLGTDQMSRIYHITNDHSTQFSITNPGRFITNSLTNTHHYSMLKLKNTVLKCSLCLNKIIDT-YRVSWNPRATCLCI----------PHLKNFQFPTDGVMVDRLAEETIICDVCHYFLSFQTQNCVLIPFHLREYKLPKVGYLPPMYSGSNDNKT-GSNPS 1203
            I CF+C     K  AK  Y++++ +N E+FPF ++L PP  ++PLT GATK+C+QC + L++Q+ HYE + T Q SR+Y + ++           +F  N+ T +            L C LC +   DT   +SW P A+              P L         +++D+     + C  C   L  Q      +P   R Y+L +     P  +G     + GSNP 
Sbjct:  432 IRCFLCRKSMAKQDAKIVYATRVSDNCEHFPFLKQLVPPPEALPLTQGATKLCLQCHSSLAEQYRHYEIVKTPQDSRVYQVVSEGGQT-------KFYCNTGTLS------------LSCPLCGDSFKDTPIWLSWKPTASSTGGGGNSSSTPFYPLLSKVTCEYSHLLIDKQRGRLLACRTCCDHLHQQWTQQERLPPQSRYYQLRRTPPSQPSPAGGGVAASPGSNPG 642          

HSP 2 Score: 80.1073 bits (196), Expect = 2.337e-11
Identity = 50/132 (37.88%), Postives = 64/132 (48.48%), Query Frame = 1
Query: 1408 PIIANCHICLHELRDPNNLKTLRATANEEYMDQPYFPFLKTLRANSM--KNYEFPVCLHCYYNMYGQW-RMSQKA--SIPIYGRKYNYNELMCTQCQRLCAQKSDTLILRDRLVCIACSE--NRNSDAAKSG 1782
            P+IA CH+CL  L +P  LK LR          PYFPFL  LR NS    N  FPVC  CY N+  QW R S  +  SIP         E +C+ C +L   K +  +  D L+C+ C+    R   +  SG
Sbjct:  645 PMIAQCHVCLCALHNPETLKLLRHKPKSGRPASPYFPFLANLRHNSQASANGTFPVCDLCYTNLRWQWIRRSSSSVNSIPDAASASYQTEYICSGCLQLKTSKEEVRLQGDCLLCLDCATIGGRAGASGSSG 776          
BLAST of SMED30035316 vs. Planmine SMEST
Match: SMESG000072458.1 (SMESG000072458.1)

HSP 1 Score: 1760.35 bits (4558), Expect = 0.000e+0
Identity = 930/930 (100.00%), Postives = 930/930 (100.00%), Query Frame = 1
Query:   25 MERCFSCAEIGNCSELYVRKPPDYYGPYFPTFERFHPPSSSNAISSDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTKRHDGINYTGNDSFNSHSESLIXXXXXXXXXXXXXXXXXXLNSESVNLSNKASLANTNSKNNLMEINNEKXXXXXXXXXDISFPGNNKQLTEHYICCFVCGLPCLKWHAKTAYSSQMLENKEYFPFFEKLDPPQSSIPLTNGATKICIQCEADLSKQWDHYEKLGTDQMSRIYHITNDHSTQFSITNPGRFITNSLTNTHHYSMLKLKNTVLKCSLCLNKIIDTYRVSWNPRATCLCIPHLKNFQFPTDGVMVDRLAEETIICDVCHYFLSFQTQNCVLIPFHLREYKLPKVGYLPPMYSGSNDNKTGSNPSRKQSLGSSLSAFLPADSYSQQANSQSKRSKTPNLKSRSKTPIQQTIDQNRSNSIMKPSISNQDQTVPGPIIANCHICLHELRDPNNLKTLRATANEEYMDQPYFPFLKTLRANSMKNYEFPVCLHCYYNMYGQWRMSQKASIPIYGRKYNYNELMCTQCQRLCAQKSDTLILRDRLVCIACSENRNSDAAKSGFNITNQDATDGGVQNLFXXXXXXXXXXXPISNELSIPSLASFNYAETMKQYSKTSISTVSTPSGINNSLGQFVDSFSRNTSVSSDLMYNSKNVFGKSIKRPVVAAVAPNQRQNTPHLQSDSNASQSDFSHMKMSDLANFPGNYYNHNSAFNPFTXXXXXXXXXXXXLPIFSSNNPFGIPSHSSIGRKHLXXXXXDRDYLLKHATNFSSSYLDPKTRINTLQNPVNPFINWXXXXXXXXSNVLESNPSFPFQSIPGLDSYNFGGXXXXXXXXXXXXXXXKEMEIAMKIWMSQQNSGDNNLKFPNLWPSNNSQLFDEMTSSYFQAVLSQSLAMANRDDIMTPNIGQ 2814
            MERCFSCAEIGNCSELYVRKPPDYYGPYFPTFERFHPPSSSNAISSDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTKRHDGINYTGNDSFNSHSESLINSKSNFSWSKSESQKSINLNSESVNLSNKASLANTNSKNNLMEINNEKSELSEELSLDISFPGNNKQLTEHYICCFVCGLPCLKWHAKTAYSSQMLENKEYFPFFEKLDPPQSSIPLTNGATKICIQCEADLSKQWDHYEKLGTDQMSRIYHITNDHSTQFSITNPGRFITNSLTNTHHYSMLKLKNTVLKCSLCLNKIIDTYRVSWNPRATCLCIPHLKNFQFPTDGVMVDRLAEETIICDVCHYFLSFQTQNCVLIPFHLREYKLPKVGYLPPMYSGSNDNKTGSNPSRKQSLGSSLSAFLPADSYSQQANSQSKRSKTPNLKSRSKTPIQQTIDQNRSNSIMKPSISNQDQTVPGPIIANCHICLHELRDPNNLKTLRATANEEYMDQPYFPFLKTLRANSMKNYEFPVCLHCYYNMYGQWRMSQKASIPIYGRKYNYNELMCTQCQRLCAQKSDTLILRDRLVCIACSENRNSDAAKSGFNITNQDATDGGVQNLFTMKTKTTVTVTPISNELSIPSLASFNYAETMKQYSKTSISTVSTPSGINNSLGQFVDSFSRNTSVSSDLMYNSKNVFGKSIKRPVVAAVAPNQRQNTPHLQSDSNASQSDFSHMKMSDLANFPGNYYNHNSAFNPFTSNSIANSNASFALPIFSSNNPFGIPSHSSIGRKHLSSSSSDRDYLLKHATNFSSSYLDPKTRINTLQNPVNPFINWQQPQQQHQSNVLESNPSFPFQSIPGLDSYNFGGNNNNNINNNNNNNSNKEMEIAMKIWMSQQNSGDNNLKFPNLWPSNNSQLFDEMTSSYFQAVLSQSLAMANRDDIMTPNIGQ
Sbjct:    1 MERCFSCAEIGNCSELYVRKPPDYYGPYFPTFERFHPPSSSNAISSDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTKRHDGINYTGNDSFNSHSESLINSKSNFSWSKSESQKSINLNSESVNLSNKASLANTNSKNNLMEINNEKSELSEELSLDISFPGNNKQLTEHYICCFVCGLPCLKWHAKTAYSSQMLENKEYFPFFEKLDPPQSSIPLTNGATKICIQCEADLSKQWDHYEKLGTDQMSRIYHITNDHSTQFSITNPGRFITNSLTNTHHYSMLKLKNTVLKCSLCLNKIIDTYRVSWNPRATCLCIPHLKNFQFPTDGVMVDRLAEETIICDVCHYFLSFQTQNCVLIPFHLREYKLPKVGYLPPMYSGSNDNKTGSNPSRKQSLGSSLSAFLPADSYSQQANSQSKRSKTPNLKSRSKTPIQQTIDQNRSNSIMKPSISNQDQTVPGPIIANCHICLHELRDPNNLKTLRATANEEYMDQPYFPFLKTLRANSMKNYEFPVCLHCYYNMYGQWRMSQKASIPIYGRKYNYNELMCTQCQRLCAQKSDTLILRDRLVCIACSENRNSDAAKSGFNITNQDATDGGVQNLFTMKTKTTVTVTPISNELSIPSLASFNYAETMKQYSKTSISTVSTPSGINNSLGQFVDSFSRNTSVSSDLMYNSKNVFGKSIKRPVVAAVAPNQRQNTPHLQSDSNASQSDFSHMKMSDLANFPGNYYNHNSAFNPFTSNSIANSNASFALPIFSSNNPFGIPSHSSIGRKHLSSSSSDRDYLLKHATNFSSSYLDPKTRINTLQNPVNPFINWQQPQQQHQSNVLESNPSFPFQSIPGLDSYNFGGNNNNNINNNNNNNSNKEMEIAMKIWMSQQNSGDNNLKFPNLWPSNNSQLFDEMTSSYFQAVLSQSLAMANRDDIMTPNIGQ 930          
BLAST of SMED30035316 vs. Planmine SMEST
Match: SMESG000072458.1 (SMESG000072458.1)

HSP 1 Score: 1755.73 bits (4546), Expect = 0.000e+0
Identity = 930/931 (99.89%), Postives = 930/931 (99.89%), Query Frame = 1
Query:   25 MERCFSCAEIGNCSELYVRKPPDYYGPYFPTFERFHPPSSSNAISSDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTKRHDGINYTGNDSFNSHSESLIXXXXXXXXXXXXXXXXXXLNSESVNLSNKASLANTNSKNNLMEINNEKXXXXXXXXXDISFPGNNKQLTEHYICCFVCGLPCLKWHAKTAYSSQMLENKEYFPFFEKLDPPQSSIPLTNGATKICIQCEADLSKQWDHYEKLGTDQMSRIYHITNDHSTQFSITNPGRFITNSLTNTHHYSMLKLKNTVLKCSLCLNKIIDTYRVSWNPRATCLCIPHLKNFQFPTDGVMVDRLAEETIICDVCHYFLSFQTQNCVLIPFHLREYKLPKVGYLPPMYSGSNDNKTGSNPSRKQSLGSSLSAFLPADSYSQQANSQSKRSKTPNLKSRSKTPIQQTIDQNRSNSIMKPSISNQDQTVPGPIIANCHICLHELRDPNNLKTLRATANEEYMDQPYFPFLKTLRANSMKNYEFPVCLHCYYNMYGQWRMSQKASIPIYGRKYNYNELMCTQCQRLCAQKSDTLILRDRLVCIACSENRNSDAAKSGFNITNQDATDGGVQNLFXXXXXXXXXXXPISNELSIPSLASFNYAETMKQYSKTSISTVSTPSGINNSLGQFVDSFSRNTSVSSDLMYNSKNVFGKSIKRPVVAAVAPNQRQ-NTPHLQSDSNASQSDFSHMKMSDLANFPGNYYNHNSAFNPFTXXXXXXXXXXXXLPIFSSNNPFGIPSHSSIGRKHLXXXXXDRDYLLKHATNFSSSYLDPKTRINTLQNPVNPFINWXXXXXXXXSNVLESNPSFPFQSIPGLDSYNFGGXXXXXXXXXXXXXXXKEMEIAMKIWMSQQNSGDNNLKFPNLWPSNNSQLFDEMTSSYFQAVLSQSLAMANRDDIMTPNIGQ 2814
            MERCFSCAEIGNCSELYVRKPPDYYGPYFPTFERFHPPSSSNAISSDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTKRHDGINYTGNDSFNSHSESLINSKSNFSWSKSESQKSINLNSESVNLSNKASLANTNSKNNLMEINNEKSELSEELSLDISFPGNNKQLTEHYICCFVCGLPCLKWHAKTAYSSQMLENKEYFPFFEKLDPPQSSIPLTNGATKICIQCEADLSKQWDHYEKLGTDQMSRIYHITNDHSTQFSITNPGRFITNSLTNTHHYSMLKLKNTVLKCSLCLNKIIDTYRVSWNPRATCLCIPHLKNFQFPTDGVMVDRLAEETIICDVCHYFLSFQTQNCVLIPFHLREYKLPKVGYLPPMYSGSNDNKTGSNPSRKQSLGSSLSAFLPADSYSQQANSQSKRSKTPNLKSRSKTPIQQTIDQNRSNSIMKPSISNQDQTVPGPIIANCHICLHELRDPNNLKTLRATANEEYMDQPYFPFLKTLRANSMKNYEFPVCLHCYYNMYGQWRMSQKASIPIYGRKYNYNELMCTQCQRLCAQKSDTLILRDRLVCIACSENRNSDAAKSGFNITNQDATDGGVQNLFTMKTKTTVTVTPISNELSIPSLASFNYAETMKQYSKTSISTVSTPSGINNSLGQFVDSFSRNTSVSSDLMYNSKNVFGKSIKRPVVAAVAPNQRQ NTPHLQSDSNASQSDFSHMKMSDLANFPGNYYNHNSAFNPFTSNSIANSNASFALPIFSSNNPFGIPSHSSIGRKHLSSSSSDRDYLLKHATNFSSSYLDPKTRINTLQNPVNPFINWQQPQQQHQSNVLESNPSFPFQSIPGLDSYNFGGNNNNNINNNNNNNSNKEMEIAMKIWMSQQNSGDNNLKFPNLWPSNNSQLFDEMTSSYFQAVLSQSLAMANRDDIMTPNIGQ
Sbjct:    1 MERCFSCAEIGNCSELYVRKPPDYYGPYFPTFERFHPPSSSNAISSDGTVKVCALCKIYLNSQWQNFEYNKTAECQRIYFTKRHDGINYTGNDSFNSHSESLINSKSNFSWSKSESQKSINLNSESVNLSNKASLANTNSKNNLMEINNEKSELSEELSLDISFPGNNKQLTEHYICCFVCGLPCLKWHAKTAYSSQMLENKEYFPFFEKLDPPQSSIPLTNGATKICIQCEADLSKQWDHYEKLGTDQMSRIYHITNDHSTQFSITNPGRFITNSLTNTHHYSMLKLKNTVLKCSLCLNKIIDTYRVSWNPRATCLCIPHLKNFQFPTDGVMVDRLAEETIICDVCHYFLSFQTQNCVLIPFHLREYKLPKVGYLPPMYSGSNDNKTGSNPSRKQSLGSSLSAFLPADSYSQQANSQSKRSKTPNLKSRSKTPIQQTIDQNRSNSIMKPSISNQDQTVPGPIIANCHICLHELRDPNNLKTLRATANEEYMDQPYFPFLKTLRANSMKNYEFPVCLHCYYNMYGQWRMSQKASIPIYGRKYNYNELMCTQCQRLCAQKSDTLILRDRLVCIACSENRNSDAAKSGFNITNQDATDGGVQNLFTMKTKTTVTVTPISNELSIPSLASFNYAETMKQYSKTSISTVSTPSGINNSLGQFVDSFSRNTSVSSDLMYNSKNVFGKSIKRPVVAAVAPNQRQVNTPHLQSDSNASQSDFSHMKMSDLANFPGNYYNHNSAFNPFTSNSIANSNASFALPIFSSNNPFGIPSHSSIGRKHLSSSSSDRDYLLKHATNFSSSYLDPKTRINTLQNPVNPFINWQQPQQQHQSNVLESNPSFPFQSIPGLDSYNFGGNNNNNINNNNNNNSNKEMEIAMKIWMSQQNSGDNNLKFPNLWPSNNSQLFDEMTSSYFQAVLSQSLAMANRDDIMTPNIGQ 931          
The following BLAST results are available for this feature:
BLAST of SMED30035316 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
GSE12.248e-736.36Gse1 coiled-coil protein [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of SMED30035316 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035316 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
px1.357e-735.00gene:FBgn0003175 transcript:FBtr0331942[more]
px1.376e-735.00gene:FBgn0003175 transcript:FBtr0071838[more]
back to top
BLAST of SMED30035316 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gse16.117e-731.82Gse1 coiled-coil protein [Source:NCBI gene;Acc:567... [more]
gse16.117e-731.82Gse1 coiled-coil protein [Source:NCBI gene;Acc:567... [more]
back to top
BLAST of SMED30035316 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
GSE12.945e-722.31Gse1 coiled-coil protein [Source:NCBI gene;Acc:100... [more]
GSE12.984e-722.31Gse1 coiled-coil protein [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of SMED30035316 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Gse14.441e-734.94genetic suppressor element 1, coiled-coil protein ... [more]
back to top
BLAST of SMED30035316 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035316 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZF671.305e-1726.26Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A267F7Y01.491e-1528.82Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GF612.035e-1528.82Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267EW613.302e-1528.82Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8J3G15.518e-1528.70Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30035316 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035316 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035316 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035316 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035316 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035316 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000072458.10.000e+0100.00SMESG000072458.1[more]
SMESG000072458.10.000e+099.89SMESG000072458.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035316 ID=SMED30035316|Name=SMED30035316|organism=Schmidtea mediterranea sexual|type=transcript|length=2874bp
TCTATATAAATCTTATATGCAAAAATGGAACGTTGTTTTTCATGCGCTGA
AATTGGAAATTGTTCAGAATTATATGTTCGAAAACCACCAGATTATTATG
GGCCTTATTTTCCTACTTTTGAGAGATTTCACCCACCTTCGAGTTCCAAT
GCCATTTCATCTGATGGCACTGTCAAGGTTTGCGCATTGTGCAAAATTTA
TTTAAATAGTCAGTGGCAAAATTTCGAATACAACAAAACCGCCGAATGTC
AACGGATTTATTTCACAAAAAGACACGATGGAATAAATTACACCGGCAAC
GATTCATTTAATTCTCATTCGGAATCATTGATCAATAGCAAATCGAATTT
CTCTTGGAGTAAATCTGAAAGTCAAAAATCAATAAATCTTAATTCAGAAT
CGGTTAATTTGTCCAATAAAGCATCTTTAGCGAATACAAACAGTAAAAAT
AATTTAATGGAAATTAATAATGAAAAATCCGAATTGTCTGAAGAATTATC
GTTAGATATAAGTTTTCCAGGAAATAATAAACAGCTAACCGAGCATTATA
TCTGCTGCTTTGTATGTGGATTGCCATGCTTGAAGTGGCATGCAAAAACG
GCATATTCGTCTCAAATGTTAGAAAATAAAGAATATTTTCCGTTTTTTGA
AAAACTTGACCCTCCTCAATCGTCCATTCCTCTAACAAATGGTGCCACGA
AAATTTGCATTCAATGTGAAGCAGATCTATCGAAACAATGGGATCACTAT
GAAAAATTGGGTACCGATCAAATGTCGCGGATTTATCACATAACCAATGA
TCACAGCACTCAGTTTTCAATAACGAATCCCGGTCGATTCATTACGAATT
CCCTAACAAACACTCATCACTATTCAATGCTCAAACTGAAGAACACAGTG
CTGAAATGTTCTCTTTGTCTTAATAAGATCATTGATACGTATCGAGTGTC
GTGGAATCCTCGGGCTACTTGCCTATGCATACCGCATTTAAAAAATTTTC
AATTTCCAACTGATGGAGTTATGGTTGATAGACTTGCTGAAGAAACTATA
ATCTGTGATGTGTGTCATTATTTTCTCTCTTTTCAAACTCAAAATTGTGT
TTTGATTCCATTTCATTTGCGAGAATATAAATTGCCAAAAGTTGGCTACT
TGCCACCGATGTATTCTGGATCAAATGACAATAAAACTGGTTCTAATCCC
AGTCGTAAGCAGTCGCTTGGAAGTTCACTGTCAGCGTTTCTTCCCGCTGA
TAGTTATAGTCAACAGGCTAATTCCCAGAGTAAAAGATCAAAAACTCCAA
ATCTTAAAAGTCGTTCCAAGACGCCAATTCAACAAACAATTGATCAAAAC
CGATCTAATTCCATCATGAAACCATCTATTAGCAACCAGGATCAGACTGT
TCCAGGGCCGATAATTGCCAATTGTCACATATGTCTACACGAGTTACGTG
ATCCAAACAATCTGAAAACTCTCCGGGCAACAGCTAATGAAGAATACATG
GACCAGCCTTATTTCCCATTTTTGAAAACATTGAGAGCGAATTCAATGAA
AAATTATGAGTTTCCAGTTTGTCTGCATTGTTATTACAATATGTATGGAC
AATGGCGAATGTCGCAAAAAGCTTCGATTCCGATTTACGGGCGTAAATAT
AATTACAATGAGCTCATGTGTACACAGTGTCAACGTTTATGCGCCCAGAA
AAGTGACACTTTGATTCTTCGTGATAGATTGGTTTGCATAGCCTGTTCAG
AAAACAGAAACTCGGATGCTGCTAAAAGTGGTTTTAATATTACTAATCAG
GATGCCACAGATGGTGGTGTACAGAATTTATTTACTATGAAAACTAAAAC
AACGGTTACCGTGACACCGATATCCAATGAATTATCAATTCCGAGTTTGG
CTTCATTCAATTATGCTGAAACAATGAAACAATATTCTAAAACATCTATA
TCTACTGTGTCAACTCCATCAGGAATTAATAATTCTCTCGGACAATTTGT
CGATAGTTTTTCTCGCAATACTTCAGTTTCATCGGACTTGATGTACAATT
CTAAAAACGTATTTGGAAAGAGCATTAAAAGACCTGTTGTTGCAGCTGTT
GCACCGAATCAAAGACAAAATACTCCTCATTTACAATCCGATTCCAATGC
ATCTCAATCTGATTTTTCCCACATGAAAATGTCAGATTTGGCAAATTTCC
CCGGAAATTATTACAATCACAATTCAGCATTTAATCCTTTTACTAGCAAC
AGCATTGCAAACTCAAACGCTTCTTTTGCACTGCCAATATTTTCATCCAA
CAATCCATTCGGAATTCCATCTCACTCGTCAATTGGTAGAAAGCATTTGT
CATCATCAAGTTCTGATCGTGACTATTTATTGAAACACGCAACAAATTTC
TCCAGTTCCTATCTTGATCCGAAAACTCGAATCAACACATTACAAAACCC
AGTCAACCCGTTTATCAACTGGCAACAGCCTCAACAACAGCACCAGTCAA
ATGTGCTCGAATCGAATCCTTCATTCCCGTTTCAATCGATTCCTGGATTG
GATTCATACAATTTTGGCGGCAATAACAATAATAATATTAACAACAACAA
CAATAATAATAGCAACAAGGAAATGGAAATCGCTATGAAAATATGGATGT
CCCAGCAGAACAGTGGTGACAATAATTTGAAATTCCCAAATTTGTGGCCG
TCCAATAATTCTCAATTATTTGACGAAATGACATCGAGCTATTTCCAAGC
AGTGTTGTCGCAATCTCTGGCAATGGCCAATCGCGATGATATAATGACAC
CGAATATTGGACAAAACAACAGTTTCAATAACAACAGCAGCAGCAGCAGC
AGCACTGCCAGCAACAGCAATAAT
back to top

protein sequence of SMED30035316-orf-1

>SMED30035316-orf-1 ID=SMED30035316-orf-1|Name=SMED30035316-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=950bp
MERCFSCAEIGNCSELYVRKPPDYYGPYFPTFERFHPPSSSNAISSDGTV
KVCALCKIYLNSQWQNFEYNKTAECQRIYFTKRHDGINYTGNDSFNSHSE
SLINSKSNFSWSKSESQKSINLNSESVNLSNKASLANTNSKNNLMEINNE
KSELSEELSLDISFPGNNKQLTEHYICCFVCGLPCLKWHAKTAYSSQMLE
NKEYFPFFEKLDPPQSSIPLTNGATKICIQCEADLSKQWDHYEKLGTDQM
SRIYHITNDHSTQFSITNPGRFITNSLTNTHHYSMLKLKNTVLKCSLCLN
KIIDTYRVSWNPRATCLCIPHLKNFQFPTDGVMVDRLAEETIICDVCHYF
LSFQTQNCVLIPFHLREYKLPKVGYLPPMYSGSNDNKTGSNPSRKQSLGS
SLSAFLPADSYSQQANSQSKRSKTPNLKSRSKTPIQQTIDQNRSNSIMKP
SISNQDQTVPGPIIANCHICLHELRDPNNLKTLRATANEEYMDQPYFPFL
KTLRANSMKNYEFPVCLHCYYNMYGQWRMSQKASIPIYGRKYNYNELMCT
QCQRLCAQKSDTLILRDRLVCIACSENRNSDAAKSGFNITNQDATDGGVQ
NLFTMKTKTTVTVTPISNELSIPSLASFNYAETMKQYSKTSISTVSTPSG
INNSLGQFVDSFSRNTSVSSDLMYNSKNVFGKSIKRPVVAAVAPNQRQNT
PHLQSDSNASQSDFSHMKMSDLANFPGNYYNHNSAFNPFTSNSIANSNAS
FALPIFSSNNPFGIPSHSSIGRKHLSSSSSDRDYLLKHATNFSSSYLDPK
TRINTLQNPVNPFINWQQPQQQHQSNVLESNPSFPFQSIPGLDSYNFGGN
NNNNINNNNNNNSNKEMEIAMKIWMSQQNSGDNNLKFPNLWPSNNSQLFD
EMTSSYFQAVLSQSLAMANRDDIMTPNIGQNNSFNNNSSSSSSTASNSNN
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 139..159
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 412..457
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 931..952
NoneNo IPR availablePANTHERPTHR40240FAMILY NOT NAMEDcoord: 3..155
coord: 176..577