Endothelin-converting enzyme 1

Overview
NameEndothelin-converting enzyme 1
Smed IDSMED30035315
Length (bp)2788
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Endothelin-converting enzyme 1 (SMED30035315) t-SNE clustered cells

Violin plots show distribution of expression levels for Endothelin-converting enzyme 1 (SMED30035315) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Endothelin-converting enzyme 1 (SMED30035315) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Endothelin-converting enzyme 1 (SMED30035315) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035315

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035315SMESG000025056.1 SmedASXL_013748SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30035315SMESG000025056.1 dd_Smed_v4_8276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035315SMESG000025056.1 dd_Smed_v4_8276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035315SMESG000025056.1 dd_Smed_v4_8276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30035315SMESG000025056.1 dd_Smed_v4_8276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30035315SMESG000025056.1 dd_Smed_v4_8276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035315SMESG000025056.1 dd_Smed_v4_8276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035315SMESG000025056.1 dd_Smed_v4_8276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30035315SMESG000025056.1 dd_Smed_v4_8276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035315SMESG000025056.1 dd_Smed_v4_8276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035315SMESG000025056.1 dd_Smed_v4_8276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30035315SMESG000025056.1 dd_Smed_v4_8276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035315SMESG000025056.1 dd_Smed_v4_8276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035315SMESG000025056.1 Contig37005newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035315SMESG000025056.1 Contig37005uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035315SMESG000025056.1 Contig4006newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035315SMESG000025056.1 Contig4006uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035315SMESG000049472.1 Contig4006newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035315SMESG000049472.1 Contig4006uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30035315SMESG000025056.1 dd_Smed_v6_8276_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035315SMESG000025056.1 OX_Smed_1.0.13097ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035315SMESG000025056.1 dd_Smed_v4_8276_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Human
Match: ECE2 (endothelin converting enzyme 2 [Source:HGNC Symbol;Acc:HGNC:13275])

HSP 1 Score: 461.455 bits (1186), Expect = 1.089e-149
Identity = 252/693 (36.36%), Postives = 391/693 (56.42%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWD------LAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CLT +C++ A +I +SL+  V+PC DF QF CG W     LP G SR++TF+ +      I K LLEN  F ++S    K  + Y SCL ++RI  LGA PL   + +     GGW    N   P    WD      + K +      TP   + +  D K+S+ N++ +  S L +  R +  N T   N+K+L  + DYM ++G LL  R     EQ  ++L+LEI++A     ++ +RD E  Y+KM++SE+Q       +W E +     L  + +S    ++V     L  + EL     ++  IL+NY++W  V +  + L   F+  ++K     YG   +   RW+ C+S     +   LG++++K  F++QSK     MI+ ++  F+  L   VWMD++TR  A EK D ++ +IG+ D IL    L++ +   EI++ ++F+N+  L N +     ++L K P       TPQ VNA+Y P KNEI+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + +   F+  + C  +QY++Y ++G  +NG  TLGENIADNGG++  Y  YK   +K+G+E+ LP +  T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RV+GTLSN ++F   F CP GS MNP   C VW
Sbjct:   63 STCLTEACIRVAGKILESLDRGVSPCEDFYQFSCGGWIRRNPLPDGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAEQKTQRFYLSCLQVERIEELGAQPLRDLIEKI----GGW----NITGP----WDQDNFMEVLKAVAGTYRATPFFTVYISADSKSSNSNVIQVDQSGLFLPSRDYYLNRTA--NEKVLTAYLDYMEELGMLLGGRPTSTREQMQQVLELEIQLANITVPQDQRRDEEKIYHKMSISELQA-LAPSMDWLEFLS--FLLSPLELSDSEPVVVYGMDYLQQVSELINR--TEPSILNNYLIWNLVQKTTSSLDRRFESAQEKLLETLYGTKKSCVPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMISEIRTAFEEALGQLVWMDEKTRQAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEISEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYARNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLAAFRNHTACMEEQYNQYQVNGERLNGRQTLGENIADNGGLKAAYNAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 736          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Human
Match: ECE2 (endothelin converting enzyme 2 [Source:HGNC Symbol;Acc:HGNC:13275])

HSP 1 Score: 462.225 bits (1188), Expect = 1.689e-149
Identity = 252/693 (36.36%), Postives = 391/693 (56.42%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWD------LAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CLT +C++ A +I +SL+  V+PC DF QF CG W     LP G SR++TF+ +      I K LLEN  F ++S    K  + Y SCL ++RI  LGA PL   + +     GGW    N   P    WD      + K +      TP   + +  D K+S+ N++ +  S L +  R +  N T   N+K+L  + DYM ++G LL  R     EQ  ++L+LEI++A     ++ +RD E  Y+KM++SE+Q       +W E +     L  + +S    ++V     L  + EL     ++  IL+NY++W  V +  + L   F+  ++K     YG   +   RW+ C+S     +   LG++++K  F++QSK     MI+ ++  F+  L   VWMD++TR  A EK D ++ +IG+ D IL    L++ +   EI++ ++F+N+  L N +     ++L K P       TPQ VNA+Y P KNEI+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + +   F+  + C  +QY++Y ++G  +NG  TLGENIADNGG++  Y  YK   +K+G+E+ LP +  T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RV+GTLSN ++F   F CP GS MNP   C VW
Sbjct:   92 STCLTEACIRVAGKILESLDRGVSPCEDFYQFSCGGWIRRNPLPDGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAEQKTQRFYLSCLQVERIEELGAQPLRDLIEKI----GGW----NITGP----WDQDNFMEVLKAVAGTYRATPFFTVYISADSKSSNSNVIQVDQSGLFLPSRDYYLNRTA--NEKVLTAYLDYMEELGMLLGGRPTSTREQMQQVLELEIQLANITVPQDQRRDEEKIYHKMSISELQA-LAPSMDWLEFLS--FLLSPLELSDSEPVVVYGMDYLQQVSELINR--TEPSILNNYLIWNLVQKTTSSLDRRFESAQEKLLETLYGTKKSCVPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMISEIRTAFEEALGQLVWMDEKTRQAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEISEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYARNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLAAFRNHTACMEEQYNQYQVNGERLNGRQTLGENIADNGGLKAAYNAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 765          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Human
Match: ECE2 (endothelin converting enzyme 2 [Source:HGNC Symbol;Acc:HGNC:13275])

HSP 1 Score: 462.225 bits (1188), Expect = 6.245e-149
Identity = 250/693 (36.08%), Postives = 390/693 (56.28%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWD------LAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CLT +C++ A +I +SL+  V+PC DF QF CG W     LP G SR++TF+ +      I K LLEN  F ++S    K  + Y SCL ++RI  LGA PL   + +     GGW +           WD      + K +      TP   + +  D K+S+ N++ +  S L +  R +  N T   N+K+L  + DYM ++G LL  R     EQ  ++L+LEI++A     ++ +RD E  Y+KM++SE+Q       +W E +     L  + +S    ++V     L  + EL     ++  IL+NY++W  V +  + L   F+  ++K     YG   +   RW+ C+S     +   LG++++K  F++QSK     MI+ ++  F+  L   VWMD++TR  A EK D ++ +IG+ D IL    L++ +   EI++ ++F+N+  L N +     ++L K P       TPQ VNA+Y P KNEI+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + +   F+  + C  +QY++Y ++G  +NG  TLGENIADNGG++  Y  YK   +K+G+E+ LP +  T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RV+GTLSN ++F   F CP GS MNP   C VW
Sbjct:  138 STCLTEACIRVAGKILESLDRGVSPCEDFYQFSCGGWIRRNPLPDGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAEQKTQRFYLSCLQVERIEELGAQPLRDLIEKI----GGWNIT--------GPWDQDNFMEVLKAVAGTYRATPFFTVYISADSKSSNSNVIQVDQSGLFLPSRDYYLNRTA--NEKVLTAYLDYMEELGMLLGGRPTSTREQMQQVLELEIQLANITVPQDQRRDEEKIYHKMSISELQA-LAPSMDWLEFLS--FLLSPLELSDSEPVVVYGMDYLQQVSELINR--TEPSILNNYLIWNLVQKTTSSLDRRFESAQEKLLETLYGTKKSCVPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMISEIRTAFEEALGQLVWMDEKTRQAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEISEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYARNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLAAFRNHTACMEEQYNQYQVNGERLNGRQTLGENIADNGGLKAAYNAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 811          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Human
Match: ECE2 (endothelin converting enzyme 2 [Source:HGNC Symbol;Acc:HGNC:13275])

HSP 1 Score: 462.225 bits (1188), Expect = 4.200e-148
Identity = 252/693 (36.36%), Postives = 391/693 (56.42%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWD------LAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CLT +C++ A +I +SL+  V+PC DF QF CG W     LP G SR++TF+ +      I K LLEN  F ++S    K  + Y SCL ++RI  LGA PL   + +     GGW    N   P    WD      + K +      TP   + +  D K+S+ N++ +  S L +  R +  N T   N+K+L  + DYM ++G LL  R     EQ  ++L+LEI++A     ++ +RD E  Y+KM++SE+Q       +W E +     L  + +S    ++V     L  + EL     ++  IL+NY++W  V +  + L   F+  ++K     YG   +   RW+ C+S     +   LG++++K  F++QSK     MI+ ++  F+  L   VWMD++TR  A EK D ++ +IG+ D IL    L++ +   EI++ ++F+N+  L N +     ++L K P       TPQ VNA+Y P KNEI+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + +   F+  + C  +QY++Y ++G  +NG  TLGENIADNGG++  Y  YK   +K+G+E+ LP +  T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RV+GTLSN ++F   F CP GS MNP   C VW
Sbjct:  210 STCLTEACIRVAGKILESLDRGVSPCEDFYQFSCGGWIRRNPLPDGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAEQKTQRFYLSCLQVERIEELGAQPLRDLIEKI----GGW----NITGP----WDQDNFMEVLKAVAGTYRATPFFTVYISADSKSSNSNVIQVDQSGLFLPSRDYYLNRTA--NEKVLTAYLDYMEELGMLLGGRPTSTREQMQQVLELEIQLANITVPQDQRRDEEKIYHKMSISELQA-LAPSMDWLEFLS--FLLSPLELSDSEPVVVYGMDYLQQVSELINR--TEPSILNNYLIWNLVQKTTSSLDRRFESAQEKLLETLYGTKKSCVPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMISEIRTAFEEALGQLVWMDEKTRQAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEISEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYARNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLAAFRNHTACMEEQYNQYQVNGERLNGRQTLGENIADNGGLKAAYNAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 883          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Human
Match: ECE1 (endothelin converting enzyme 1 [Source:HGNC Symbol;Acc:HGNC:3146])

HSP 1 Score: 448.358 bits (1152), Expect = 2.087e-144
Identity = 258/688 (37.50%), Postives = 385/688 (55.96%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWL-LMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF--EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CL+ +C+     I  S++ +V+PC+DF  + CG W     +P G SR+ TF  +      I K LLEN    + S    KA   Y +C+N  RI  L A PL+  + R     GGW +            D  +V+      +P   + V  D KNS+ N++ +  S L L  R +  N+T  EN+K+L  + +YM  +GKLL    E+    Q  +IL  E  +A     +E +RD E  Y+K+T +E+Q       NW   +      V I  S+   I+V +   L  I  L  +  + + +L+NY++W  V +  +FL + FQ   +KF  V YG   T   RW+ CVS  + ++   LG M++K  F + SK    E+I  +K+ F+ +L +  WMD++TR  A EK D ++ +IGY + I++   L++ F D       YFEN     N +     ++L K P       TP  VNA+YSP KNEI+FPAGILQ PF+    P++L +GGIG  +GHE+ H FDD G +YD  G+LR WW + + + FK +++C V+QYS YS++G  +NG +TLGENIADNGG++  Y+ Y++  KK G E  LP L  T++QLFF+ FA++WC+++T +S    ++++ H+P+ +RVIG+LSN KEF+E F CP GS MNP  KC VW
Sbjct:   81 SVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLEN-STASVSEAERKAQVYYRACMNETRIEELRAKPLMELIER----LGGWNITGPWAKDNFQ--DTLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKT--ENEKVLTGYLNYMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQ-TLAPAINWLPFLNTIFYPVEINESE--PIVVYDKEYLEQISTLINT--TDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEVMYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKAFEESLSTLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW 754          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Celegans
Match: nep-11 (Neprilysin-11 [Source:UniProtKB/Swiss-Prot;Acc:O16796])

HSP 1 Score: 378.252 bits (970), Expect = 5.084e-117
Identity = 227/705 (32.20%), Postives = 366/705 (51.91%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPI---IRIIVQEDEKNSSRNILNLQLSWLLM---ERQFLQNETKPENKKILDVFKDYMYDVGKLLKI-------RKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASK------KRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQ-TYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIH--GHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGL-NYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            C T  C++AA     ++NTSV+PC DF +F CG+W  +  +P     + TF      + +  + LLE  E  T S   + A   Y SC+N  +++ L   PL      T    G W +L  + + T  K++   ++ +   +  +    ++ +  D KN+SRN L +  S L +    R +  N T   +   +  ++ Y+  +  LLK          E      +I+  EIE+AK    E+++R+    YNK  + ++      Q +W    +            D+  +  N T ++     +  + S+        +L NYVLWR V   + +L E F+ IK  F +V  G   +  RW+ C  +    + L  G +Y++ +F +  K + L MI  L+  F + +  N WMD++T++ A+EK ++M   IGY D   ++  L++ +  + I+D  TY+  +         R F+KL K  +    D +P  VNAFYSP KN I FPAGILQ PFF   FP+++ YG IG  +GHEI HGFDD GS+YD  G+L  WW++ +   F T+  C V+QY  Y++      +NG+ T GENIADNGGV+  +Q Y+    + G+E  LPGL  YT++Q+FF+++A  WC  + + + +  +L++ H+P  +RVIG LSN + FA+ + CP+ + +NP  KC+VW
Sbjct:  161 CSTPGCVRAATHFLNAMNTSVDPCDDFFEFACGQWNDQHPIPDDMYGFGTFAYAREQVRQQLRVLLEQ-EVVTESESINMARATYRSCMNKTQLDELMTGPLF----ETLTELGEWPLLQENWDKT--KFNFTSLLVNSRRDYGVDVFFQLYIYADSKNTSRNTLFIDQSTLALGRGTRDYYLNTTLFSSH--MTAYRKYLRQIAHLLKTDGNLTRSESEMNADIEKIIDFEIELAKIIVAEDERRNNTRLYNKRQIQDLYN-LLPQVDWVPFFQS-------IAPSDLTHLFHNETEIIICEIEYLQHVSELIEKTDVGLLTNYVLWRVVQSNVRYLDERFEDIKQDFLKVMTGQQQSPPRWKDCAQVPSTVLPLAAGAIYVQAHFQESDKHEALRMIMHLRNSFADLVRQNDWMDEETKAVAIEKANSMINNIGYPDVTNDLPKLDKQYLGLSISDSDTYYYIMKKSVVWMQSREFQKLTKPFDKHEFDISPAVVNAFYSPEKNAITFPAGILQPPFFSGTFPKAVNYGAIGAVIGHEITHGFDDQGSQYDKDGNLHNWWSESSLNSFDTRRRCIVEQYGNYTVPKTNFRVNGKLTQGENIADNGGVKEAFQAYQKYVTENGEEPRLPGLQQYTNEQIFFVSYAHFWCGKKKEAAAMQQVLTDEHSPEVFRVIGVLSNMQAFADVYKCPRNAPVNPDHKCIVW 848          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Celegans
Match: nep-1 (Neprilysin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18673])

HSP 1 Score: 359.762 bits (922), Expect = 3.575e-111
Identity = 231/703 (32.86%), Postives = 376/703 (53.49%), Query Frame = 1
Query:  568 QAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKW-----DLAKVIEDPMVETPIIRIIV----QEDEKNSSRNILNLQLSWLLM---ERQFLQNETKPEN------KKILDVFKDYMYDVGKLLKIRKEKFEQ-FNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMK-LVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYF-----ENIDMLTNRAMYRNFEKLNKRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHS--INGENTLGENIADNGGVRLTYQVYKD-LEKKYGKEKLLPGL-NYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            +A+  ++KSLN S++PC DF ++ C  W     +P   + YS F      +    +KL E+      S   +   ++Y++C++ ++ N++GA  L+  +      YG W M+ N+      KW     DL K++ +  +++  + +       ED +N SR +L+     L +    R +  +E K E       K  +   + Y  D G  + + + K E   +EI+  E E A+    EED+R+    YN     +++ +Y    +W ++       LV+  +  +  II+++   L  +  L ++  +  RI+ NY+L R        + + ++ ++ +F    YG    + RW+ CVS     +S   G+MY++  F+  +K   L+MI  L++ F+N + +N WMD +T+ +ALEK D M   IGY D ILN   L++ +K +E   +  F     ++I    N    R  E +N+      I +   VNAFYSP +N I FPAGILQ PFF+  FP++L YGGIG  +GHEI HGFDDTG ++D+ G+LR WW + T   F  ++ C ++QY+   + G    ING+ T GENIADNGG++  ++ YK  LEK  G+E  LP   + T++QLFF+ +A++WC  +T ++  + +L++ H+P   RV   L+N  EFAEAF CP GS MNPT +C+VW
Sbjct:   71 EASRLLQKSLNLSLDPCDDFFEYACRAWVDSHPIPDDLTSYSQFTATREKVLAEMRKLYEDNTSIPTSKSIALIKQIYNTCMDTEKHNAVGARDLLEKIK----TYGYWPMVHNE------KWRESTFDLTKLLSN-TIQSRDVSVFFDFGPAEDSRNVSRRLLSFDQGSLGLGYSTRDYYLDEKKYEKQMKAYRKYTIGKVRYYTEDAG--MAVNESKIESDVDEIIAFEKEWAQILVAEEDRRNYTKLYNVRRFDDLK-EYMSIIDWKKLTLSTTPFLVHSYLKTNPSIIISDVEYLQKMNTLLQN--TDPRIVTNYILLRWAGSWSQEIGKKYEDLQQEFAFQMYGRKQRQPRWKDCVSSAGGKLSYASGSMYVRKYFDANAKNTTLDMITDLQEAFRNMMHANDWMDAETKKYALEKADQMLKQIGYPDFILNDEKLDDWYKGLEGAPEDSFSQLVEKSIQWRNNFYYRRLLEPVNRF---EFISSAAVVNAFYSPTRNAIAFPAGILQQPFFDARFPKALNYGGIGAVIGHEITHGFDDTGRQFDNVGNLRDWWDNTTSSKFNERTQCIIEQYADVKLRGTDLRINGKLTQGENIADNGGIKQAFKAYKSYLEKHGGQEARLPQFESLTNEQLFFVGYAQVWCGAKTPETKTLLLLTDPHSPETARVNTVLTNQPEFAEAFKCPAGSPMNPTKRCVVW 754          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Celegans
Match: nep-2 (Neprilysin-2 [Source:UniProtKB/Swiss-Prot;Acc:O44857])

HSP 1 Score: 358.221 bits (918), Expect = 1.098e-110
Identity = 229/694 (33.00%), Postives = 351/694 (50.58%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDL-FKIQKKLLENPE-FKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWL-LMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVN------ITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQR-INFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENST-IDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIH--GHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            CL+  C++ A  I  S+N+SV+PC DF +F CG+W     +P  +   S F+ +  DL F +++ L EN E +   +    KA   Y+ CLN   I         T  +    ++GGW  L + + P      L   +        + +  VQ D+KNS R++L +    L L  R F       E    L + +D +     L   R        EI+  E  +A     +E + D    Y K+TL E++ +    FNW     R  K ++      IT   + E++V     L  +  L   Y    R++ NY+ W   ++  +  L + F     KF +    +   K RW  CV+ +   M +    +Y+KN+F+ ++K QV EMI+L+ + F + LLS  W+  +T+  A +K++ M   IGY D + +   +   +K  ++    Y++       +      E++ +  +    +     VNAFYSPN NEIIFPAGILQ  F+   FP S+ +GGIG  +GHEI HGFDD G  YD+ G++R WW + T   F+ K+ C  KQYS Y +      ING++T GENIADNGG++  Y+ YK  EK++ +   LPG+N THDQLFF+ +A++WC     +  I  + ++ H+P   RV G LSN  +FA+A+NC  GS MNP +KC VW
Sbjct:   53 CLSPGCIKTASVILSSMNSSVDPCDDFYEFACGQWIKGHPIPDDAPSVSNFENLGQDLEFALKELLDENDEPYDYETSAVGKAKYFYNLCLNESEI----LDNWRTTFDEVVKSFGGWPSLGHQMKPDASIEMLYADMVAKFKADSLFKATVQPDDKNSQRHVLLIDQPQLNLFARDFYVAAENEERMAYLQLIRDVLI---LLDADRTRATLDAKEIIDFETALANITMADEHRHDIAELYTKITLGEMR-RSLPHFNWPLFFNRMFKDLHEKNGKRITFDDNTEVVVYGYEFLRRLDVLIPQY--DNRLIVNYLEWCWFFKTMLRDLPDPFALTIFKFYKTLNIMNVQKVRWHGCVTRINSLMPMATSAIYVKNHFDHEAKQQVEEMISLIMESFVDLLLSEDWLTKETKQTAKQKVNEMKRKIGYPDYLNDPAAVNNEYKTFKVYPGHYYQTKFSFYEQYQRDVLERITEAVDRERWVAGAALVNAFYSPNTNEIIFPAGILQPVFYSKDFPSSMNFGGIGVVIGHEITHGFDDRGRLYDNLGNIRQWWDNATISKFEHKAQCIEKQYSSYVLDQINMQINGKSTKGENIADNGGLKQAYRAYKKYEKRHSRPPRLPGVNLTHDQLFFLNYAQIWCGTMNDKEAIRKLRTSEHSPGPIRVKGPLSNSYDFAKAYNCEPGSQMNPREKCRVW 736          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Celegans
Match: nep-11 (Neprilysin-11 [Source:UniProtKB/Swiss-Prot;Acc:O16796])

HSP 1 Score: 321.627 bits (823), Expect = 2.626e-96
Identity = 206/650 (31.69%), Postives = 330/650 (50.77%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPI---IRIIVQEDEKNSSRNILNLQLSWLLM---ERQFLQNETKPENKKILDVFKDYMYDVGKLLKI-------RKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASK------KRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQ-TYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIH--GHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGL-NYTHDQLFFITFARLWC 2424
            C T  C++AA     ++NTSV+PC DF +F CG+W  +  +P     + TF      + +  + LLE  E  T S   + A   Y SC+N  +++ L   PL      T    G W +L  + + T  K++   ++ +   +  +    ++ +  D KN+SRN L +  S L +    R +  N T   +   +  ++ Y+  +  LLK          E      +I+  EIE+AK    E+++R+    YNK  + ++      Q +W    +            D+  +  N T ++     +  + S+        +L NYVLWR V   + +L E F+ IK  F +V  G   +  RW+ C  +    + L  G +Y++ +F +  K + L MI  L+  F + +  N WMD++T++ A+EK ++M   IGY D   ++  L++ +  + I+D  TY+  +         R F+KL K  +    D +P  VNAFYSP KN I FPAGILQ PFF   FP+++ YG IG  +GHEI HGFDD GS+YD  G+L  WW++ +   F T+  C V+QY  Y++      +NG+ T GENIADNGGV+  +Q Y+    + G+E  LPGL  YT++Q+FF+++A + C
Sbjct:  161 CSTPGCVRAATHFLNAMNTSVDPCDDFFEFACGQWNDQHPIPDDMYGFGTFAYAREQVRQQLRVLLEQ-EVVTESESINMARATYRSCMNKTQLDELMTGPLF----ETLTELGEWPLLQENWDKT--KFNFTSLLVNSRRDYGVDVFFQLYIYADSKNTSRNTLFIDQSTLALGRGTRDYYLNTTLFSSH--MTAYRKYLRQIAHLLKTDGNLTRSESEMNADIEKIIDFEIELAKIIVAEDERRNNTRLYNKRQIQDLYN-LLPQVDWVPFFQS-------IAPSDLTHLFHNETEIIICEIEYLQHVSELIEKTDVGLLTNYVLWRVVQSNVRYLDERFEDIKQDFLKVMTGQQQSPPRWKDCAQVPSTVLPLAAGAIYVQAHFQESDKHEALRMIMHLRNSFADLVRQNDWMDEETKAVAIEKANSMINNIGYPDVTNDLPKLDKQYLGLSISDSDTYYYIMKKSVVWMQSREFQKLTKPFDKHEFDISPAVVNAFYSPEKNAITFPAGILQPPFFSGTFPKAVNYGAIGAVIGHEITHGFDDQGSQYDKDGNLHNWWSESSLNSFDTRRRCIVEQYGNYTVPKTNFRVNGKLTQGENIADNGGVKEAFQAYQKYVTENGEEPRLPGLQQYTNEQIFFVSYAHVSC 793          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Celegans
Match: nep-21 (Neprilysin-21 [Source:UniProtKB/Swiss-Prot;Acc:Q22523])

HSP 1 Score: 317.39 bits (812), Expect = 3.604e-95
Identity = 221/725 (30.48%), Postives = 359/725 (49.52%), Query Frame = 1
Query:  487 SSTMGTRRVISNQNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVK-LYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTL--DKWD---------LAKVIEDPMVETPIIRIIVQEDEKNSSRNILNL-QLSWLLMER-QFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTK--ERWEHCVSIVQVHMSLILGNMYIKNNFNKQ-SKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMY-RNFEKLNKRPENST-IDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSI--NGENTLGENIADNGGVRLTYQVYKDLEKKYG--KEKLLPGL-NYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            +S++   R   N N   D  C +  C++ A  + ++LN+ +NPC DF +F CG +   + LP       T   V + L K  K +L++P    N   + K  K  Y  CL+ + + S G   +     R     GGW        PTL  DKW          +A V+    V   I+ + V  D  NSSR+++ L Q  W    R  +L     P  +    + K     +G    I ++   + NE ++ E+++      +  +RDPE   N+  L +++  +    N+ + ++   K + + +S +  +IV      + I  + +S  + KR+L NY+ WR V     FL    +    +F+    G+  +   +RWE CV++  + M + +G ++++N F K+ +  ++ E+ + LK +F   L    WMD+ TR  A+ K + +    G+   + N T++E+ +  I I  + Y  ++ +      +     +L++  + S    +P +V+A+Y+PN NE+IFPAGI+Q PF   G P  + YG +G  +GHE+ H FDD G +YD  G+L  WW   T + F  K+ CFV+QY    +    I  NG+ +LGENIADNGGV+  +  YK  +       E  LPG  N+T  Q+FF+ +A  WC+L   +  I  IL++ H P+ YR +  L N  EFA+AF CP GS MNP  KC VW
Sbjct:   69 NSSVAVDRSAKNHN---DVVCTSRECVRLAGFLAENLNSKINPCEDFYEFACGNYGLNKNLPANKPLRHTISDVQSRLNKQVKSMLQSP-ISANEKPWDKVAKGYYQKCLDEEELESTGVEAMRDIAKRI----GGW--------PTLEGDKWQEWSHSWEEQIALVLNLTGVNAVILEMAVTHDPSNSSRSVIELDQPKWGAGSRYPYLSGANDPMLRNYTTLMKMTAVALGADPAIAEK---EMNEAMEFELKLVNFSADDMVRRDPERGNNRFELWQLKSVF-PFINFEKYLKTVFKEL-VALSPNHTVIVREIDYFVGIQHVLQS--TPKRVLANYISWRLVQGFSPFLPPSAREPFYQFKANQTGMFNSPPPDRWEDCVTLSVIMMDMPVGRLFVENFFEKERAMKKMTELTSYLKNEFIKQLHVLDWMDEITRRRAISKANMIEYKSGFPMVLFNDTWMEKNWGMI-IKPREYLLHLTIRVKLVRFTEELLRLDQPLDRSMWFQSPAQVDAYYAPNNNEMIFPAGIMQFPFLTLGVPNYITYGMVGAVIGHEVSHAFDDQGGQYDEMGNLNDWWDAETEEKFIEKTRCFVRQYENVHVVEADIHLNGQLSLGENIADNGGVKTAFNAYKAWKSNTTGISEPALPGFQNFTSQQMFFLAYANNWCSLVRPKHYIQIILTDVHAPSKYRAMIPLQNRPEFAKAFQCPIGSPMNPERKCQVW 769          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Fly
Match: Nep3 (gene:FBgn0031081 transcript:FBtr0307554)

HSP 1 Score: 428.328 bits (1100), Expect = 1.362e-136
Identity = 246/718 (34.26%), Postives = 393/718 (54.74%), Query Frame = 1
Query:  487 SSTMGTRRVISNQNRELDSP------CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLD-RINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLA---KVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRK-EKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNP---TNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENST--IDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKL-LPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
             S+  T+ V+  Q  + D P      CL   C+ A+ EI KS++ +V+PC DF  + C +W     +P+G S + TF  +      I + +LE P     S    KA   Y+SCL+ D  +  LGA P+    N      GGW +  +  N  +  W +    K++ +      +    + ED+KNSSR+++ +    L +      N     ++K+L+ + +YM  V  LL   + +   Q   ++  E ++A      ED+R+ E+ Y+ M L ++  K     NWT+     M++V   ++ D  ++V  P    NL DI    +     K  L+NY++W+ V    + LS+ F+      R+   G  G +E W +CVS     +   +G ++++  F+ +SKP   +MI  +++ F+ NL +  W+D QTR  A+EK + +  +IG+ D IL+   L++ + ++ I    YFEN   +    +  N ++L++ P N T    TPQ VNA+Y+P KN+I+FPAGILQ PFF+   P+SL +G +G  MGHE+ H FDD G +YD  G++  WW  ++ + F  KS+C  +QYS Y ++G ++NG+ TLGENIADNGG++  Y  Y+  +     + L LPGLN TH QLFF++FA++WC+  T ++ ++ +  + H+P+ +RVIGTLSN KEFAE F C  G  MNPT+KC VW
Sbjct:   77 GSSDATKHVLHVQPHQKDCPSGNELPCLNKHCIFASSEILKSIDVTVDPCDDFYGYSCNQWIKNNPIPEGKSTWGTFGKLEQMNQLIIRNVLEKPAKSFKSDAERKAKVYYESCLDADEHMEKLGAKPM----NDLLLQIGGWNVTKSGYN--VANWTMGHTLKILHNKYNFNCLFGWAIGEDDKNSSRHVIQIDQGGLTLPTADYYNNKTDNHRKVLNEYIEYMTKVCVLLGANESDARAQMIGVINFEKKLANITIPLEDRRNEEAMYHPMQLRQLS-KLAPFLNWTDHFDNAMQMVGRRVTDDEVVVVYAPDFLKNLSDIILKMEQTEEGKITLNNYLVWQAVRTLTSCLSKPFRDAYKGVRKALMGSDGGEEIWRYCVSDTNNVVGFAVGAIFVRQAFHGESKPAAEQMIAEIREAFKMNLQNLTWVDKQTREKAIEKANQISDMIGFPDYILDPVELDKKYAELNITPNAYFENNIQVAIYNLKSNLKRLDQ-PVNKTNWGMTPQTVNAYYTPTKNQIVFPAGILQTPFFDINNPKSLNFGAMGVVMGHELTHAFDDQGREYDKFGNINRWWDSKSIERFNEKSECIARQYSGYKMNGRTLNGKQTLGENIADNGGLKAAYHAYQRTKSDRDVDILKLPGLNLTHSQLFFVSFAQVWCSSTTDETNLLQMEKDPHSPSQFRVIGTLSNMKEFAEVFQCKPGKRMNPTEKCEVW 786          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Fly
Match: Nep3 (gene:FBgn0031081 transcript:FBtr0070000)

HSP 1 Score: 428.328 bits (1100), Expect = 1.362e-136
Identity = 246/718 (34.26%), Postives = 393/718 (54.74%), Query Frame = 1
Query:  487 SSTMGTRRVISNQNRELDSP------CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLD-RINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLA---KVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRK-EKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNP---TNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENST--IDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKL-LPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
             S+  T+ V+  Q  + D P      CL   C+ A+ EI KS++ +V+PC DF  + C +W     +P+G S + TF  +      I + +LE P     S    KA   Y+SCL+ D  +  LGA P+    N      GGW +  +  N  +  W +    K++ +      +    + ED+KNSSR+++ +    L +      N     ++K+L+ + +YM  V  LL   + +   Q   ++  E ++A      ED+R+ E+ Y+ M L ++  K     NWT+     M++V   ++ D  ++V  P    NL DI    +     K  L+NY++W+ V    + LS+ F+      R+   G  G +E W +CVS     +   +G ++++  F+ +SKP   +MI  +++ F+ NL +  W+D QTR  A+EK + +  +IG+ D IL+   L++ + ++ I    YFEN   +    +  N ++L++ P N T    TPQ VNA+Y+P KN+I+FPAGILQ PFF+   P+SL +G +G  MGHE+ H FDD G +YD  G++  WW  ++ + F  KS+C  +QYS Y ++G ++NG+ TLGENIADNGG++  Y  Y+  +     + L LPGLN TH QLFF++FA++WC+  T ++ ++ +  + H+P+ +RVIGTLSN KEFAE F C  G  MNPT+KC VW
Sbjct:   77 GSSDATKHVLHVQPHQKDCPSGNELPCLNKHCIFASSEILKSIDVTVDPCDDFYGYSCNQWIKNNPIPEGKSTWGTFGKLEQMNQLIIRNVLEKPAKSFKSDAERKAKVYYESCLDADEHMEKLGAKPM----NDLLLQIGGWNVTKSGYN--VANWTMGHTLKILHNKYNFNCLFGWAIGEDDKNSSRHVIQIDQGGLTLPTADYYNNKTDNHRKVLNEYIEYMTKVCVLLGANESDARAQMIGVINFEKKLANITIPLEDRRNEEAMYHPMQLRQLS-KLAPFLNWTDHFDNAMQMVGRRVTDDEVVVVYAPDFLKNLSDIILKMEQTEEGKITLNNYLVWQAVRTLTSCLSKPFRDAYKGVRKALMGSDGGEEIWRYCVSDTNNVVGFAVGAIFVRQAFHGESKPAAEQMIAEIREAFKMNLQNLTWVDKQTREKAIEKANQISDMIGFPDYILDPVELDKKYAELNITPNAYFENNIQVAIYNLKSNLKRLDQ-PVNKTNWGMTPQTVNAYYTPTKNQIVFPAGILQTPFFDINNPKSLNFGAMGVVMGHELTHAFDDQGREYDKFGNINRWWDSKSIERFNEKSECIARQYSGYKMNGRTLNGKQTLGENIADNGGLKAAYHAYQRTKSDRDVDILKLPGLNLTHSQLFFVSFAQVWCSSTTDETNLLQMEKDPHSPSQFRVIGTLSNMKEFAEVFQCKPGKRMNPTEKCEVW 786          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Fly
Match: Nep3 (gene:FBgn0031081 transcript:FBtr0307555)

HSP 1 Score: 428.328 bits (1100), Expect = 1.362e-136
Identity = 246/718 (34.26%), Postives = 393/718 (54.74%), Query Frame = 1
Query:  487 SSTMGTRRVISNQNRELDSP------CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLD-RINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLA---KVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRK-EKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNP---TNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENST--IDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKL-LPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
             S+  T+ V+  Q  + D P      CL   C+ A+ EI KS++ +V+PC DF  + C +W     +P+G S + TF  +      I + +LE P     S    KA   Y+SCL+ D  +  LGA P+    N      GGW +  +  N  +  W +    K++ +      +    + ED+KNSSR+++ +    L +      N     ++K+L+ + +YM  V  LL   + +   Q   ++  E ++A      ED+R+ E+ Y+ M L ++  K     NWT+     M++V   ++ D  ++V  P    NL DI    +     K  L+NY++W+ V    + LS+ F+      R+   G  G +E W +CVS     +   +G ++++  F+ +SKP   +MI  +++ F+ NL +  W+D QTR  A+EK + +  +IG+ D IL+   L++ + ++ I    YFEN   +    +  N ++L++ P N T    TPQ VNA+Y+P KN+I+FPAGILQ PFF+   P+SL +G +G  MGHE+ H FDD G +YD  G++  WW  ++ + F  KS+C  +QYS Y ++G ++NG+ TLGENIADNGG++  Y  Y+  +     + L LPGLN TH QLFF++FA++WC+  T ++ ++ +  + H+P+ +RVIGTLSN KEFAE F C  G  MNPT+KC VW
Sbjct:   77 GSSDATKHVLHVQPHQKDCPSGNELPCLNKHCIFASSEILKSIDVTVDPCDDFYGYSCNQWIKNNPIPEGKSTWGTFGKLEQMNQLIIRNVLEKPAKSFKSDAERKAKVYYESCLDADEHMEKLGAKPM----NDLLLQIGGWNVTKSGYN--VANWTMGHTLKILHNKYNFNCLFGWAIGEDDKNSSRHVIQIDQGGLTLPTADYYNNKTDNHRKVLNEYIEYMTKVCVLLGANESDARAQMIGVINFEKKLANITIPLEDRRNEEAMYHPMQLRQLS-KLAPFLNWTDHFDNAMQMVGRRVTDDEVVVVYAPDFLKNLSDIILKMEQTEEGKITLNNYLVWQAVRTLTSCLSKPFRDAYKGVRKALMGSDGGEEIWRYCVSDTNNVVGFAVGAIFVRQAFHGESKPAAEQMIAEIREAFKMNLQNLTWVDKQTREKAIEKANQISDMIGFPDYILDPVELDKKYAELNITPNAYFENNIQVAIYNLKSNLKRLDQ-PVNKTNWGMTPQTVNAYYTPTKNQIVFPAGILQTPFFDINNPKSLNFGAMGVVMGHELTHAFDDQGREYDKFGNINRWWDSKSIERFNEKSECIARQYSGYKMNGRTLNGKQTLGENIADNGGLKAAYHAYQRTKSDRDVDILKLPGLNLTHSQLFFVSFAQVWCSSTTDETNLLQMEKDPHSPSQFRVIGTLSNMKEFAEVFQCKPGKRMNPTEKCEVW 786          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Fly
Match: Nep1 (gene:FBgn0029843 transcript:FBtr0343930)

HSP 1 Score: 425.631 bits (1093), Expect = 6.689e-135
Identity = 230/691 (33.29%), Postives = 380/691 (54.99%), Query Frame = 1
Query:  538 DSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKW--DLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNL-QLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKE-KFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTIDT-PQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIH--GHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            D+ C+T  C++ A  +  +++ + +PC DF Q+ CG W     +P+  S  STF+V++     I + +LE P  + ++    KA   + SC+++ +I  +G       L +   + GGW ++  + +P  D     L   +     E  +I + V  D+KNSS NIL + QL + L  R +   E+   +++    +  YM  V  LL         +  +++  E ++      E D+ D    Y KM L E+Q +   +  W E ++  +    I + +D  ++      L ++ ++     + +R++HNY+LWR V   ++ + +++QR + +FR++  G+   + RW  CV      + + +G ++I++NFN++SK   LEMI+ ++  F   L  N WMDD+TR+ A EK D+M   IGY + + N T LE+ + ++ I    +  N+  +      +    L +  +     T P  VNAFY+PNKN+I+FPAGILQ  F+   FP+SL YGGIG  +GHEI HGFDD G ++D +G++  WW + T + F+ ++ C + QYS+Y I+     ++G  T GENIADNGG++  ++ YK  E  +G+E+ LPGLN THDQLFF+ +A++WC     +  +  I S  H+P   RV+G LSN ++FA A+ CP GS MNP +KC VW
Sbjct:  170 DNICMTQECVRTAASLLSAMDLNSDPCEDFFQYACGTWNKMHPIPEDRSSISTFEVLSDQQQVILRAVLEEPIDERDNKATIKAKTFFKSCMDIPQIRKIG----TGRLKQVLQSLGGWPVIERNWSPPADLSVERLMGQLRLNYSEPVMIELYVGADDKNSSVNILQMDQLQYALPSRDYYLKESSANDRR---AYHRYMTQVALLLGADPATAAAELEKVVLFETQLVNVSLPEADRHDTSLVYRKMLLPELQ-ELVPEVQWQEYLQAALG-PGIPLQEDEPLVTYGLHYLTEMGKILAH--TDRRVVHNYMLWRLVMSLMSHMIDEYQRERVEFRKILMGIQSERTRWSQCVEWTNKKLGVAVGALFIRDNFNQESKEVALEMIHTIRAAFNELLAENDWMDDETRAVAKEKADSMNERIGYPELLTNATELEQEYVNLTIVPDNFINNVLSILQWESEKMLRLLRQPVDKEKWTTEPAVVNAFYNPNKNDIVFPAGILQPLFYSQHFPKSLNYGGIGVVIGHEITHGFDDKGRQFDKEGNMMQWWNNATIEAFRERTQCVIDQYSRYKINEVDMFMDGRMTQGENIADNGGLKQAFRAYKKWETLHGREQQLPGLNMTHDQLFFLNYAQIWCGSMRPEDALTKIRSAVHSPGFVRVLGPLSNSRDFASAYKCPLGSTMNPAEKCSVW 849          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Fly
Match: Nep1 (gene:FBgn0029843 transcript:FBtr0070873)

HSP 1 Score: 425.631 bits (1093), Expect = 6.689e-135
Identity = 230/691 (33.29%), Postives = 380/691 (54.99%), Query Frame = 1
Query:  538 DSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKW--DLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNL-QLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKE-KFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTIDT-PQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIH--GHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            D+ C+T  C++ A  +  +++ + +PC DF Q+ CG W     +P+  S  STF+V++     I + +LE P  + ++    KA   + SC+++ +I  +G       L +   + GGW ++  + +P  D     L   +     E  +I + V  D+KNSS NIL + QL + L  R +   E+   +++    +  YM  V  LL         +  +++  E ++      E D+ D    Y KM L E+Q +   +  W E ++  +    I + +D  ++      L ++ ++     + +R++HNY+LWR V   ++ + +++QR + +FR++  G+   + RW  CV      + + +G ++I++NFN++SK   LEMI+ ++  F   L  N WMDD+TR+ A EK D+M   IGY + + N T LE+ + ++ I    +  N+  +      +    L +  +     T P  VNAFY+PNKN+I+FPAGILQ  F+   FP+SL YGGIG  +GHEI HGFDD G ++D +G++  WW + T + F+ ++ C + QYS+Y I+     ++G  T GENIADNGG++  ++ YK  E  +G+E+ LPGLN THDQLFF+ +A++WC     +  +  I S  H+P   RV+G LSN ++FA A+ CP GS MNP +KC VW
Sbjct:  170 DNICMTQECVRTAASLLSAMDLNSDPCEDFFQYACGTWNKMHPIPEDRSSISTFEVLSDQQQVILRAVLEEPIDERDNKATIKAKTFFKSCMDIPQIRKIG----TGRLKQVLQSLGGWPVIERNWSPPADLSVERLMGQLRLNYSEPVMIELYVGADDKNSSVNILQMDQLQYALPSRDYYLKESSANDRR---AYHRYMTQVALLLGADPATAAAELEKVVLFETQLVNVSLPEADRHDTSLVYRKMLLPELQ-ELVPEVQWQEYLQAALG-PGIPLQEDEPLVTYGLHYLTEMGKILAH--TDRRVVHNYMLWRLVMSLMSHMIDEYQRERVEFRKILMGIQSERTRWSQCVEWTNKKLGVAVGALFIRDNFNQESKEVALEMIHTIRAAFNELLAENDWMDDETRAVAKEKADSMNERIGYPELLTNATELEQEYVNLTIVPDNFINNVLSILQWESEKMLRLLRQPVDKEKWTTEPAVVNAFYNPNKNDIVFPAGILQPLFYSQHFPKSLNYGGIGVVIGHEITHGFDDKGRQFDKEGNMMQWWNNATIEAFRERTQCVIDQYSRYKINEVDMFMDGRMTQGENIADNGGLKQAFRAYKKWETLHGREQQLPGLNMTHDQLFFLNYAQIWCGSMRPEDALTKIRSAVHSPGFVRVLGPLSNSRDFASAYKCPLGSTMNPAEKCSVW 849          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Zebrafish
Match: ece2b (endothelin converting enzyme 2b [Source:ZFIN;Acc:ZDB-GENE-131120-140])

HSP 1 Score: 459.914 bits (1182), Expect = 7.863e-149
Identity = 251/690 (36.38%), Postives = 389/690 (56.38%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDK---WDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFE-QFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CLT +C+  A +I ++L+ S +PC DF Q+ CG W  +  LP G SR+STF+ +      + K LLEN  F ++S    K    Y SCLN  RI  LGA PL+  + +     GGW     ++  + DK    D+ K+I  P    P   + V  D KNS+ N++ +  S L +  R +  N+T   N+K+L  + DYM ++G LL   K     Q  +IL  E  +A     ++++RD E  Y+K+T++++Q        W + +   +  + +  ++   ++V     +  + EL     +   +L+NY++W  V +  + L + F+  +DK     YG   +   RW+ C+      +   LG +++K  F+KQSK     MIN ++  F+  L    WMD+QTR  A +K D ++ +IG+ D IL+   L++ +   E+ +  +F+N+    N +     ++L K P       TP  VNA+Y P KN I+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD  G+LR WW + + + FK +++C V QY++Y+I+G  ING+ TLGENIADNGG++  Y  Y+   +K G+EK LP +N T+DQLFF+ FA++WC+++T +S    ++++ H+P  YRVIGTLSN  EFAE F CP GS MN   +C VW
Sbjct:   93 SICLTEACVTVASKIVEALDRSADPCQDFYQYACGGWVRKNPLPDGRSRWSTFNSIWDQNQAVLKHLLENGTFNSSSEAERKTQSYYLSCLNEQRIEELGAQPLMDLITKI----GGW-----NITESWDKENFLDVLKIISGPYRAQPFFTVSVSVDPKNSNSNVIQVDQSGLFLPSRDYYLNKT---NEKVLKAYLDYMVELGLLLGGDKNSTRGQMQQILDFETALANITVPQDERRDEEKIYHKITIADLQ-VLAPAIEWLDYLNSVLSPLELNDTE--PVVVYAKEYMQQVSELINK--TDHSLLNNYMIWNLVQKGASSLDQRFENAQDKLLESLYGTKKSCTPRWQTCIGNTDDTLGFALGALFVKATFDKQSKEIAEGMINEIRTAFKGALDDLKWMDEQTRQAAKDKADAIYDMIGFPDFILDSKELDDVYDGYEVTEDNFFQNMINFYNFSARVMADQLRKPPNRDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYAQDHPKALNFGGIGVVMGHELTHAFDDQGREYDKDGNLRSWWQNSSVEAFKNRTECMVDQYTQYTINGEHINGKQTLGENIADNGGLKAAYHAYRSWVQKNGEEKRLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPKYRVIGTLSNSPEFAEHFQCPLGSSMNSGHRCEVW 765          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Zebrafish
Match: ece1 (endothelin converting enzyme 1 [Source:ZFIN;Acc:ZDB-GENE-061110-100])

HSP 1 Score: 410.609 bits (1054), Expect = 3.556e-130
Identity = 233/687 (33.92%), Postives = 381/687 (55.46%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRT--FGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWL-LMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQF-NEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            CL+  C+  A  +  SL+ SV+PC DF  F CG W  +  LP+G SR+  F  +      + K LLEN   K+ S    KA   Y +C+N  +I  LGA PL   +N+T  +G  G WE   ++    L      +++      +P   + V  D K+S+ NI+ +  S L L  R++  N+T   N+K L+ + +++ ++G LL   ++  ++   EI++ E  +A     + ++RD E  Y K+   E+        +W   +      V +  S+   ++V     L  + EL  +  + K +L+NY++ + V + ++ L + FQ  + +F  V YG   +   RW+ CVS     +   LG +++K  F++ SK  V +M++ +K  F+++L +  WMD +T+  A EK D ++ ++GY   I+N   L++ F D ++    YF+N+    N +     ++L K P       TP  VNA+Y+P KNE++ PAGI Q PF+   +P+++ +GGIG  MGHE+ H FDD G KYD  G+L  WW + + + F+ ++ C V+QYS YSI+   +NG++TLGENIADNGG+   Y+ Y +  KK G+E  LP L   + QLFF+ FA++WC+++T +S    ++++ H+P+ +RVIGT+SN  EF+E F C   S MNP  KC +W
Sbjct:   81 CLSEPCVSVASAVLGSLDRSVDPCQDFYNFACGGWMRKNPLPEGKSRWGPFSNLWEHNMAVMKNLLENTSMKSLSRAEQKAQWYYQACMNESKIEELGAKPLQDLINQTGGWGLKGPWE--KDNFQEVL------RIVSANFRTSPFFTVFVSTDSKSSNSNIIQVDQSGLGLPSREYYLNKTA--NEKYLNAYLNFLVELGVLLGGSQDTSQKMMEEIIEFETTLANITVPQVERRDEEKIYYKIQAKEL-ATLAPAIDWMPFLSSVFAPVELNDSE--PVVVYAKEYLQKVSELISN--TNKSVLNNYMIMKVVRKMVSILDQKFQDAEQRFLEVMYGTKKSCMPRWKLCVSDTDSALGFALGALFVKATFSEDSKAFVEDMVSEIKWAFEDSLKTVSWMDPETKKAAKEKADAIYNMVGYPKFIMNPKELDKVFNDFDVVSDLYFQNVMNYYNFSARVTADQLRKAPNRDQWSMTPPTVNAYYNPTKNEMVLPAGIFQAPFYNHAWPKAMNFGGIGVVMGHELTHAFDDQGRKYDKDGNLAKWWQNSSVEAFQHQTQCMVEQYSNYSINNEPLNGKHTLGENIADNGGLNAAYKAYVNWIKKNGEEASLPALGMNNHQLFFVGFAQVWCSVRTPESSHEGVITDPHSPSRFRVIGTISNSHEFSEHFGCKADSPMNPKRKCELW 752          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Zebrafish
Match: ece1 (endothelin converting enzyme 1 [Source:ZFIN;Acc:ZDB-GENE-061110-100])

HSP 1 Score: 410.609 bits (1054), Expect = 3.556e-130
Identity = 233/687 (33.92%), Postives = 381/687 (55.46%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRT--FGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWL-LMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQF-NEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            CL+  C+  A  +  SL+ SV+PC DF  F CG W  +  LP+G SR+  F  +      + K LLEN   K+ S    KA   Y +C+N  +I  LGA PL   +N+T  +G  G WE   ++    L      +++      +P   + V  D K+S+ NI+ +  S L L  R++  N+T   N+K L+ + +++ ++G LL   ++  ++   EI++ E  +A     + ++RD E  Y K+   E+        +W   +      V +  S+   ++V     L  + EL  +  + K +L+NY++ + V + ++ L + FQ  + +F  V YG   +   RW+ CVS     +   LG +++K  F++ SK  V +M++ +K  F+++L +  WMD +T+  A EK D ++ ++GY   I+N   L++ F D ++    YF+N+    N +     ++L K P       TP  VNA+Y+P KNE++ PAGI Q PF+   +P+++ +GGIG  MGHE+ H FDD G KYD  G+L  WW + + + F+ ++ C V+QYS YSI+   +NG++TLGENIADNGG+   Y+ Y +  KK G+E  LP L   + QLFF+ FA++WC+++T +S    ++++ H+P+ +RVIGT+SN  EF+E F C   S MNP  KC +W
Sbjct:   81 CLSEPCVSVASAVLGSLDRSVDPCQDFYNFACGGWMRKNPLPEGKSRWGPFSNLWEHNMAVMKNLLENTSMKSLSRAEQKAQWYYQACMNESKIEELGAKPLQDLINQTGGWGLKGPWE--KDNFQEVL------RIVSANFRTSPFFTVFVSTDSKSSNSNIIQVDQSGLGLPSREYYLNKTA--NEKYLNAYLNFLVELGVLLGGSQDTSQKMMEEIIEFETTLANITVPQVERRDEEKIYYKIQAKEL-ATLAPAIDWMPFLSSVFAPVELNDSE--PVVVYAKEYLQKVSELISN--TNKSVLNNYMIMKVVRKMVSILDQKFQDAEQRFLEVMYGTKKSCMPRWKLCVSDTDSALGFALGALFVKATFSEDSKAFVEDMVSEIKWAFEDSLKTVSWMDPETKKAAKEKADAIYNMVGYPKFIMNPKELDKVFNDFDVVSDLYFQNVMNYYNFSARVTADQLRKAPNRDQWSMTPPTVNAYYNPTKNEMVLPAGIFQAPFYNHAWPKAMNFGGIGVVMGHELTHAFDDQGRKYDKDGNLAKWWQNSSVEAFQHQTQCMVEQYSNYSINNEPLNGKHTLGENIADNGGLNAAYKAYVNWIKKNGEEASLPALGMNNHQLFFVGFAQVWCSVRTPESSHEGVITDPHSPSRFRVIGTISNSHEFSEHFGCKADSPMNPKRKCELW 752          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Zebrafish
Match: mmel1 (membrane metallo-endopeptidase-like 1 [Source:ZFIN;Acc:ZDB-GENE-101112-2])

HSP 1 Score: 410.223 bits (1053), Expect = 4.920e-130
Identity = 232/700 (33.14%), Postives = 386/700 (55.14%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDK-W---DLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGK-------LLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKY-CQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNV--TYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPE-NSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYS---IHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            C T  C+ AA  + ++++ SV+PC +F Q+ CG W    ++P+ SS +S F+++  +L  + K +LE  E K +   + KA  LY SC+N   I    + PL+    R   + G W + +   N T ++ W   D   V+     +  ++ + V  D+++SSR I+++    L M  R +  ++     KK+ + + ++M  + +       L +  +   E  +++L+LE +IA      E++ D    YNKMTL E Q  +    FNWT  ++  M  V+I++  D  I++     L  + E+   ++   R L NY++W  +  R++ +S  F+ ++  +R+  +G    + RW  CV  VQ +M   +G +Y++  F+  SK  V E+I  +++ +   L    WMD+Q++  A EK   +   IGY D IL      L++ +  +  +++ YFENI      +  +  +KL +  + +  I     VNAFYS N+N+I+FPAGILQ PFF     ++L +GGIG  +GHEI HGFDD G  +D  G++  WW++ + + F+ +S C V+QY ++S     G +++G  TLGENIADNGGVR  Y+ Y    ++ G+E  LPGL+  H QLFF+ FA++WC     +  I  I ++ H+P  YRV+G+L NF+ F+EAF+C +G+ MNP +KC VW
Sbjct:   65 CTTPQCVTAAARLLQNMDPSVDPCQNFYQYACGGWIERHVIPETSSLHSVFNILRDELEIVLKGVLEM-ENKDDREAFKKAKTLYSSCMNEILIEQRDSQPLL----RLIDSIGDWPVASEVWNGTSEQTWSLEDTLAVLNGRYNKKAVLEMFVWPDDRDSSRYIIHVDQPALGMPSRDYYLSDGN--YKKVREAYLEFMVSMARIAREDRNLTQDEERVLEDMSQVLELETDIANATSPAEERNDITVLYNKMTLREAQQTFNLNGFNWTRYIQGIMSSVSISVQSDEPIVIYCSPYLEKLSEVLSKHS--HRTLQNYLVWMLIMDRVSSMSRRFKDVRAHYRKALHGTTVEEARWRDCVRYVQGNMENAVGALYVRETFSGNSKRMVGELIKKIQEAYVETLEELSWMDEQSKVKAREKAMAISEQIGYPDHILEEENKKLDQEYAHLNFSEENYFENILENLAASAQKGHKKLREPVDPDMWIIGAAVVNAFYSHNRNQIVFPAGILQPPFFSEKQLQALNFGGIGMVIGHEITHGFDDHGRNFDKDGNMYNWWSNYSAERFEDQSKCMVEQYGRFSWKLAGGQNVSGITTLGENIADNGGVRQAYKAYVKWVEREGEEPRLPGLDMNHKQLFFLNFAQVWCGACRPEYAIQTIKTDPHSPLEYRVLGSLQNFEAFSEAFHCARGAPMNPEEKCRVW 755          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Zebrafish
Match: mmel1 (membrane metallo-endopeptidase-like 1 [Source:ZFIN;Acc:ZDB-GENE-101112-2])

HSP 1 Score: 410.609 bits (1054), Expect = 5.225e-130
Identity = 232/700 (33.14%), Postives = 386/700 (55.14%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDK-W---DLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGK-------LLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKY-CQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNV--TYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPE-NSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYS---IHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            C T  C+ AA  + ++++ SV+PC +F Q+ CG W    ++P+ SS +S F+++  +L  + K +LE  E K +   + KA  LY SC+N   I    + PL+    R   + G W + +   N T ++ W   D   V+     +  ++ + V  D+++SSR I+++    L M  R +  ++     KK+ + + ++M  + +       L +  +   E  +++L+LE +IA      E++ D    YNKMTL E Q  +    FNWT  ++  M  V+I++  D  I++     L  + E+   ++   R L NY++W  +  R++ +S  F+ ++  +R+  +G    + RW  CV  VQ +M   +G +Y++  F+  SK  V E+I  +++ +   L    WMD+Q++  A EK   +   IGY D IL      L++ +  +  +++ YFENI      +  +  +KL +  + +  I     VNAFYS N+N+I+FPAGILQ PFF     ++L +GGIG  +GHEI HGFDD G  +D  G++  WW++ + + F+ +S C V+QY ++S     G +++G  TLGENIADNGGVR  Y+ Y    ++ G+E  LPGL+  H QLFF+ FA++WC     +  I  I ++ H+P  YRV+G+L NF+ F+EAF+C +G+ MNP +KC VW
Sbjct:   75 CTTPQCVTAAARLLQNMDPSVDPCQNFYQYACGGWIERHVIPETSSLHSVFNILRDELEIVLKGVLEM-ENKDDREAFKKAKTLYSSCMNEILIEQRDSQPLL----RLIDSIGDWPVASEVWNGTSEQTWSLEDTLAVLNGRYNKKAVLEMFVWPDDRDSSRYIIHVDQPALGMPSRDYYLSDGN--YKKVREAYLEFMVSMARIAREDRNLTQDEERVLEDMSQVLELETDIANATSPAEERNDITVLYNKMTLREAQQTFNLNGFNWTRYIQGIMSSVSISVQSDEPIVIYCSPYLEKLSEVLSKHS--HRTLQNYLVWMLIMDRVSSMSRRFKDVRAHYRKALHGTTVEEARWRDCVRYVQGNMENAVGALYVRETFSGNSKRMVGELIKKIQEAYVETLEELSWMDEQSKVKAREKAMAISEQIGYPDHILEEENKKLDQEYAHLNFSEENYFENILENLAASAQKGHKKLREPVDPDMWIIGAAVVNAFYSHNRNQIVFPAGILQPPFFSEKQLQALNFGGIGMVIGHEITHGFDDHGRNFDKDGNMYNWWSNYSAERFEDQSKCMVEQYGRFSWKLAGGQNVSGITTLGENIADNGGVRQAYKAYVKWVEREGEEPRLPGLDMNHKQLFFLNFAQVWCGACRPEYAIQTIKTDPHSPLEYRVLGSLQNFEAFSEAFHCARGAPMNPEEKCRVW 765          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Xenopus
Match: dhdds (dehydrodolichyl diphosphate synthase subunit [Source:Xenbase;Acc:XB-GENE-1002142])

HSP 1 Score: 473.396 bits (1217), Expect = 7.366e-154
Identity = 254/696 (36.49%), Postives = 395/696 (56.75%), Query Frame = 1
Query:  514 ISNQNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFE-QFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            +++++R L   CL+ +C+  A  I  SL+  ++PC DF Q+ CG W     LP G SR++TF+ +      I K +LEN  F ++S    K  + Y SCL   RI  L   PL   + +     GGW +  N          + K +      TP   + V  D K+S+ NI+ +  S L +  R +  N+T   N K+LD +  YM  VG+LL       + Q  +IL+ E  +A     ++++RD E  YN+MT+SE+Q      F+W + +     L  + ++    ++V     L  + EL  +  +   +L+NY++W  V +  + L   F++ +DK     YG   +   RW+ C+S     +   LG++++K+ F+K SK    +MI+ ++  F+  L    WMD++TR  A EK D ++ +IG+ D IL+   L+E +   E+++  +F+N+    N +     E+L K P       TPQ VNA+Y PNKNEI+FPAGILQ PF+ P  P++L +GGIG  MGHE+ H FDD G +YD  G+LR WW + + + FK +++C V QY+ Y+++G  +NG  TLGENIADNGG++  Y  YK    K+G+EK LPG+  T++QLFF+ FA++WC+++T +S    ++++ H+P  +RVIGTLSN K+FAE FNCPKG+ MNP   C VW
Sbjct:   87 MTDRSRSL---CLSEACVSVAGRILDSLDRGIDPCQDFYQYSCGGWMRRNPLPDGRSRWNTFNSIWDQNQAILKHILENATFNSSSEAEMKTQRFYLSCLKEQRIEELRQKPLTDLIEKI----GGWNISGNWRGENF--MSVLKTVSGTYRATPFFSVFVSADSKSSNSNIIQVDQSGLFLPSRDYYLNKTA--NGKVLDAYLQYMVSVGELLGGSPGSVDMQMTQILEFETLLANLTVPQDERRDEEKIYNRMTISELQ-SLAPAFDWMDYLT--FALSPLDLNDTEPVVVYGKEYLQQVSELVNN--TDPMLLNNYLVWNLVQKMSSSLDSRFEKAQDKLLESLYGAKKSCTPRWQTCLSNTDDTLGFALGSLFVKSTFDKNSKNIAEQMISEIRDAFELTLGGLTWMDEKTRRAAKEKADAIYDMIGFPDFILDTKELDEVYDGFEVSEDAFFQNMLNFYNFSAKLMAEQLRKPPNREQWSMTPQTVNAYYLPNKNEIVFPAGILQAPFYAPTHPKALNFGGIGVVMGHELTHAFDDQGREYDEDGNLRPWWQNSSLEAFKNRTECMVNQYNSYTVNGERVNGRQTLGENIADNGGLKAAYHAYKSWLVKHGEEKQLPGVGLTNNQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPAKFRVIGTLSNSKDFAEHFNCPKGTPMNPGKHCDVW 766          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Xenopus
Match: dhdds (dehydrodolichyl diphosphate synthase subunit [Source:Xenbase;Acc:XB-GENE-1002142])

HSP 1 Score: 473.011 bits (1216), Expect = 7.430e-154
Identity = 254/696 (36.49%), Postives = 395/696 (56.75%), Query Frame = 1
Query:  514 ISNQNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFE-QFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            +++++R L   CL+ +C+  A  I  SL+  ++PC DF Q+ CG W     LP G SR++TF+ +      I K +LEN  F ++S    K  + Y SCL   RI  L   PL   + +     GGW +  N          + K +      TP   + V  D K+S+ NI+ +  S L +  R +  N+T   N K+LD +  YM  VG+LL       + Q  +IL+ E  +A     ++++RD E  YN+MT+SE+Q      F+W + +     L  + ++    ++V     L  + EL  +  +   +L+NY++W  V +  + L   F++ +DK     YG   +   RW+ C+S     +   LG++++K+ F+K SK    +MI+ ++  F+  L    WMD++TR  A EK D ++ +IG+ D IL+   L+E +   E+++  +F+N+    N +     E+L K P       TPQ VNA+Y PNKNEI+FPAGILQ PF+ P  P++L +GGIG  MGHE+ H FDD G +YD  G+LR WW + + + FK +++C V QY+ Y+++G  +NG  TLGENIADNGG++  Y  YK    K+G+EK LPG+  T++QLFF+ FA++WC+++T +S    ++++ H+P  +RVIGTLSN K+FAE FNCPKG+ MNP   C VW
Sbjct:   76 MTDRSRSL---CLSEACVSVAGRILDSLDRGIDPCQDFYQYSCGGWMRRNPLPDGRSRWNTFNSIWDQNQAILKHILENATFNSSSEAEMKTQRFYLSCLKEQRIEELRQKPLTDLIEKI----GGWNISGNWRGENF--MSVLKTVSGTYRATPFFSVFVSADSKSSNSNIIQVDQSGLFLPSRDYYLNKTA--NGKVLDAYLQYMVSVGELLGGSPGSVDMQMTQILEFETLLANLTVPQDERRDEEKIYNRMTISELQ-SLAPAFDWMDYLT--FALSPLDLNDTEPVVVYGKEYLQQVSELVNN--TDPMLLNNYLVWNLVQKMSSSLDSRFEKAQDKLLESLYGAKKSCTPRWQTCLSNTDDTLGFALGSLFVKSTFDKNSKNIAEQMISEIRDAFELTLGGLTWMDEKTRRAAKEKADAIYDMIGFPDFILDTKELDEVYDGFEVSEDAFFQNMLNFYNFSAKLMAEQLRKPPNREQWSMTPQTVNAYYLPNKNEIVFPAGILQAPFYAPTHPKALNFGGIGVVMGHELTHAFDDQGREYDEDGNLRPWWQNSSLEAFKNRTECMVNQYNSYTVNGERVNGRQTLGENIADNGGLKAAYHAYKSWLVKHGEEKQLPGVGLTNNQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPAKFRVIGTLSNSKDFAEHFNCPKGTPMNPGKHCDVW 755          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Xenopus
Match: dhdds (dehydrodolichyl diphosphate synthase subunit [Source:Xenbase;Acc:XB-GENE-1002142])

HSP 1 Score: 472.626 bits (1215), Expect = 1.197e-153
Identity = 254/696 (36.49%), Postives = 395/696 (56.75%), Query Frame = 1
Query:  514 ISNQNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFE-QFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            +++++R L   CL+ +C+  A  I  SL+  ++PC DF Q+ CG W     LP G SR++TF+ +      I K +LEN  F ++S    K  + Y SCL   RI  L   PL   + +     GGW +  N          + K +      TP   + V  D K+S+ NI+ +  S L +  R +  N+T   N K+LD +  YM  VG+LL       + Q  +IL+ E  +A     ++++RD E  YN+MT+SE+Q      F+W + +     L  + ++    ++V     L  + EL  +  +   +L+NY++W  V +  + L   F++ +DK     YG   +   RW+ C+S     +   LG++++K+ F+K SK    +MI+ ++  F+  L    WMD++TR  A EK D ++ +IG+ D IL+   L+E +   E+++  +F+N+    N +     E+L K P       TPQ VNA+Y PNKNEI+FPAGILQ PF+ P  P++L +GGIG  MGHE+ H FDD G +YD  G+LR WW + + + FK +++C V QY+ Y+++G  +NG  TLGENIADNGG++  Y  YK    K+G+EK LPG+  T++QLFF+ FA++WC+++T +S    ++++ H+P  +RVIGTLSN K+FAE FNCPKG+ MNP   C VW
Sbjct:   85 MTDRSRSL---CLSEACVSVAGRILDSLDRGIDPCQDFYQYSCGGWMRRNPLPDGRSRWNTFNSIWDQNQAILKHILENATFNSSSEAEMKTQRFYLSCLKEQRIEELRQKPLTDLIEKI----GGWNISGNWRGENF--MSVLKTVSGTYRATPFFSVFVSADSKSSNSNIIQVDQSGLFLPSRDYYLNKTA--NGKVLDAYLQYMVSVGELLGGSPGSVDMQMTQILEFETLLANLTVPQDERRDEEKIYNRMTISELQ-SLAPAFDWMDYLT--FALSPLDLNDTEPVVVYGKEYLQQVSELVNN--TDPMLLNNYLVWNLVQKMSSSLDSRFEKAQDKLLESLYGAKKSCTPRWQTCLSNTDDTLGFALGSLFVKSTFDKNSKNIAEQMISEIRDAFELTLGGLTWMDEKTRRAAKEKADAIYDMIGFPDFILDTKELDEVYDGFEVSEDAFFQNMLNFYNFSAKLMAEQLRKPPNREQWSMTPQTVNAYYLPNKNEIVFPAGILQAPFYAPTHPKALNFGGIGVVMGHELTHAFDDQGREYDEDGNLRPWWQNSSLEAFKNRTECMVNQYNSYTVNGERVNGRQTLGENIADNGGLKAAYHAYKSWLVKHGEEKQLPGVGLTNNQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPAKFRVIGTLSNSKDFAEHFNCPKGTPMNPGKHCDVW 764          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Xenopus
Match: dhdds (dehydrodolichyl diphosphate synthase subunit [Source:Xenbase;Acc:XB-GENE-1002142])

HSP 1 Score: 464.537 bits (1194), Expect = 1.763e-151
Identity = 253/689 (36.72%), Postives = 389/689 (56.46%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFE-QFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEET--FKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CL+ +C+  A  I  SL+  ++PC DF Q+ CG W     LP G SR++TF+ +      I K +LEN  F ++S    K  + Y SCL   RI  L   PL   + +     GGW +  N          + K +      TP   + V  D K+S+ NI+ +  S L +  R +  N+T   N K+LD +  YM  VG+LL       + Q  +IL+ E  +A     ++++RD E  YN+MT+SE+Q      F+W + +     L  + ++    ++V     L  + EL  +  +   +L+NY++W  V +  + L   F++ +DK     YG   +   RW+ C+S     +   LG++++K+ F+K SK    +MI+ ++  F+  L    WMD++TR  A EK D ++ +IG+ D IL+   L+ET      ++++  +F+N+    N +     E+L K P       TPQ VNA+Y PNKNEI+FPAGILQ PF+ P  P++L +GGIG  MGHE+ H FDD G +YD  G+LR WW + + + FK +++C V QY+ Y+++G  +NG  TLGENIADNGG++  Y  YK    K+G+EK LPG+  T++QLFF+ FA++WC+++T +S    ++++ H+P  +RVIGTLSN K+FAE FNCPKG+ MNP   C VW
Sbjct:    8 SLCLSEACVSVAGRILDSLDRGIDPCQDFYQYSCGGWMRRNPLPDGRSRWNTFNSIWDQNQAILKHILENATFNSSSEAEMKTQRFYLSCLKEQRIEELRQKPLTDLIEKI----GGWNISGNWRGENF--MSVLKTVSGTYRATPFFSVFVSADSKSSNSNIIQVDQSGLFLPSRDYYLNKTA--NGKVLDAYLQYMVSVGELLGGSPGSVDMQMTQILEFETLLANLTVPQDERRDEEKIYNRMTISELQ-SLAPAFDWMDYLT--FALSPLDLNDTEPVVVYGKEYLQQVSELVNN--TDPMLLNNYLVWNLVQKMSSSLDSRFEKAQDKLLESLYGAKKSCTPRWQTCLSNTDDTLGFALGSLFVKSTFDKNSKNIAEQMISEIRDAFELTLGGLTWMDEKTRRAAKEKADAIYDMIGFPDFILDTKELDETGLLYTAKVSEDAFFQNMLNFYNFSAKLMAEQLRKPPNREQWSMTPQTVNAYYLPNKNEIVFPAGILQAPFYAPTHPKALNFGGIGVVMGHELTHAFDDQGREYDEDGNLRPWWQNSSLEAFKNRTECMVNQYNSYTVNGERVNGRQTLGENIADNGGLKAAYHAYKSWLVKHGEEKQLPGVGLTNNQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPAKFRVIGTLSNSKDFAEHFNCPKGTPMNPGKHCDVW 683          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Xenopus
Match: dhdds (dehydrodolichyl diphosphate synthase subunit [Source:Xenbase;Acc:XB-GENE-1002142])

HSP 1 Score: 464.151 bits (1193), Expect = 8.189e-151
Identity = 252/687 (36.68%), Postives = 388/687 (56.48%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFE-QFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CL+ +C+  A  I  SL+  ++PC DF Q+ CG W     LP G SR++TF+ +      I K +LEN  F ++S    K  + Y SCL   RI  L   PL   + +     GGW +  N          + K +      TP   + V  D K+S+ NI+ +  S L +  R +  N+T   N K+LD +  YM  VG+LL       + Q  +IL+ E  +A     ++++RD E  YN+MT+SE+Q      F+W + +     L  + ++    ++V     L  + EL  +  +   +L+NY++W  V +  + L   F++ +DK     YG   +   RW+ C+S     +   LG++++K+ F+K SK    +MI+ ++  F+  L    WMD++TR  A EK D ++ +IG+ D IL+   L+E +  +  ++  +F+N+    N +     E+L K P       TPQ VNA+Y PNKNEI+FPAGILQ PF+ P  P++L +GGIG  MGHE+ H FDD G +YD  G+LR WW + + + FK +++C V QY+ Y+++G  +NG  TLGENIADNGG++  Y  YK    K+G+EK LPG+  T++QLFF+ FA++WC+++T +S    ++++ H+P  +RVIGTLSN K+FAE FNCPKG+ MNP   C VW
Sbjct:   59 SLCLSEACVSVAGRILDSLDRGIDPCQDFYQYSCGGWMRRNPLPDGRSRWNTFNSIWDQNQAILKHILENATFNSSSEAEMKTQRFYLSCLKEQRIEELRQKPLTDLIEKI----GGWNISGNWRGENF--MSVLKTVSGTYRATPFFSVFVSADSKSSNSNIIQVDQSGLFLPSRDYYLNKTA--NGKVLDAYLQYMVSVGELLGGSPGSVDMQMTQILEFETLLANLTVPQDERRDEEKIYNRMTISELQ-SLAPAFDWMDYLT--FALSPLDLNDTEPVVVYGKEYLQQVSELVNN--TDPMLLNNYLVWNLVQKMSSSLDSRFEKAQDKLLESLYGAKKSCTPRWQTCLSNTDDTLGFALGSLFVKSTFDKNSKNIAEQMISEIRDAFELTLGGLTWMDEKTRRAAKEKADAIYDMIGFPDFILDTKELDEVYDGV--SEDAFFQNMLNFYNFSAKLMAEQLRKPPNREQWSMTPQTVNAYYLPNKNEIVFPAGILQAPFYAPTHPKALNFGGIGVVMGHELTHAFDDQGREYDEDGNLRPWWQNSSLEAFKNRTECMVNQYNSYTVNGERVNGRQTLGENIADNGGLKAAYHAYKSWLVKHGEEKQLPGVGLTNNQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPAKFRVIGTLSNSKDFAEHFNCPKGTPMNPGKHCDVW 730          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Mouse
Match: Ece2 (endothelin converting enzyme 2 [Source:MGI Symbol;Acc:MGI:1101356])

HSP 1 Score: 455.677 bits (1171), Expect = 1.184e-147
Identity = 250/688 (36.34%), Postives = 391/688 (56.83%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTN-DLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S C+T +C++ A +I +SL+  V+PC DF QF CG W     LP G SR++TF+ +      I K LLEN  F ++S    K    Y SCL  +RI  LGA PL   +++     GGW +    D +  +D   + K +      TP   + V  D K+S+ NI+ +  S L +  R +  N T   N+K+L  + DYM ++G LL  +     EQ  ++L+LEI++A     ++ +RD E  Y+KM++SE+Q       +W E +     L  + +     ++V     L  + EL     ++  IL+NY++W  V +  + L + F+  ++K     YG   +   RW+ C+S     +   LG++++K  F++QSK     MIN ++  F+  L   VWMD++TR  A EK D ++ +IG+ D IL    L++ +   E+++ ++F+N+  L N +     ++L K P       TPQ VNA+Y P KNEI+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + +   F+  + C  +QYS+Y ++G  +NG  TLGENIADNGG++  Y  YK   +K+G+E+ LP +  T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RV+GTLSN ++F   F CP GS MNP   C VW
Sbjct:   61 STCVTEACIRVAGKILESLDRGVSPCQDFYQFSCGGWIRRNPLPNGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAERKTRSFYLSCLQSERIEKLGAKPLRDLIDKI----GGWNITGPWDEDSFMD---VLKAVAGTYRATPFFTVYVSADSKSSNSNIIQVDQSGLFLPSRDYYLNRTA--NEKVLTAYLDYMVELGVLLGGQPTSTREQMQQVLELEIQLANITVPQDQRRDEEKIYHKMSISELQA-LAPAVDWLEFLS--FLLSPLELGDSEPVVVYGTEYLQQVSELINR--TEPSILNNYLIWNLVQKTTSSLDQRFETAQEKLLETLYGTKKSCTPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMINEIRSAFEETLGDLVWMDEKTRLAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEVSEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYAHNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLTAFQNHTACMEEQYSQYQVNGERLNGLQTLGENIADNGGLKAAYNAYKAWLRKHGEEQPLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 734          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Mouse
Match: Ece2 (endothelin converting enzyme 2 [Source:MGI Symbol;Acc:MGI:1101356])

HSP 1 Score: 456.447 bits (1173), Expect = 1.790e-147
Identity = 250/688 (36.34%), Postives = 391/688 (56.83%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTN-DLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S C+T +C++ A +I +SL+  V+PC DF QF CG W     LP G SR++TF+ +      I K LLEN  F ++S    K    Y SCL  +RI  LGA PL   +++     GGW +    D +  +D   + K +      TP   + V  D K+S+ NI+ +  S L +  R +  N T   N+K+L  + DYM ++G LL  +     EQ  ++L+LEI++A     ++ +RD E  Y+KM++SE+Q       +W E +     L  + +     ++V     L  + EL     ++  IL+NY++W  V +  + L + F+  ++K     YG   +   RW+ C+S     +   LG++++K  F++QSK     MIN ++  F+  L   VWMD++TR  A EK D ++ +IG+ D IL    L++ +   E+++ ++F+N+  L N +     ++L K P       TPQ VNA+Y P KNEI+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + +   F+  + C  +QYS+Y ++G  +NG  TLGENIADNGG++  Y  YK   +K+G+E+ LP +  T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RV+GTLSN ++F   F CP GS MNP   C VW
Sbjct:   90 STCVTEACIRVAGKILESLDRGVSPCQDFYQFSCGGWIRRNPLPNGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAERKTRSFYLSCLQSERIEKLGAKPLRDLIDKI----GGWNITGPWDEDSFMD---VLKAVAGTYRATPFFTVYVSADSKSSNSNIIQVDQSGLFLPSRDYYLNRTA--NEKVLTAYLDYMVELGVLLGGQPTSTREQMQQVLELEIQLANITVPQDQRRDEEKIYHKMSISELQA-LAPAVDWLEFLS--FLLSPLELGDSEPVVVYGTEYLQQVSELINR--TEPSILNNYLIWNLVQKTTSSLDQRFETAQEKLLETLYGTKKSCTPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMINEIRSAFEETLGDLVWMDEKTRLAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEVSEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYAHNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLTAFQNHTACMEEQYSQYQVNGERLNGLQTLGENIADNGGLKAAYNAYKAWLRKHGEEQPLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 763          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Mouse
Match: Gm49333 (predicted gene, 49333 [Source:MGI Symbol;Acc:MGI:6121518])

HSP 1 Score: 456.833 bits (1174), Expect = 6.666e-146
Identity = 250/688 (36.34%), Postives = 391/688 (56.83%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTN-DLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S C+T +C++ A +I +SL+  V+PC DF QF CG W     LP G SR++TF+ +      I K LLEN  F ++S    K    Y SCL  +RI  LGA PL   +++     GGW +    D +  +D   + K +      TP   + V  D K+S+ NI+ +  S L +  R +  N T   N+K+L  + DYM ++G LL  +     EQ  ++L+LEI++A     ++ +RD E  Y+KM++SE+Q       +W E +     L  + +     ++V     L  + EL     ++  IL+NY++W  V +  + L + F+  ++K     YG   +   RW+ C+S     +   LG++++K  F++QSK     MIN ++  F+  L   VWMD++TR  A EK D ++ +IG+ D IL    L++ +   E+++ ++F+N+  L N +     ++L K P       TPQ VNA+Y P KNEI+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + +   F+  + C  +QYS+Y ++G  +NG  TLGENIADNGG++  Y  YK   +K+G+E+ LP +  T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RV+GTLSN ++F   F CP GS MNP   C VW
Sbjct:  237 STCVTEACIRVAGKILESLDRGVSPCQDFYQFSCGGWIRRNPLPNGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAERKTRSFYLSCLQSERIEKLGAKPLRDLIDKI----GGWNITGPWDEDSFMD---VLKAVAGTYRATPFFTVYVSADSKSSNSNIIQVDQSGLFLPSRDYYLNRTA--NEKVLTAYLDYMVELGVLLGGQPTSTREQMQQVLELEIQLANITVPQDQRRDEEKIYHKMSISELQA-LAPAVDWLEFLS--FLLSPLELGDSEPVVVYGTEYLQQVSELINR--TEPSILNNYLIWNLVQKTTSSLDQRFETAQEKLLETLYGTKKSCTPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMINEIRSAFEETLGDLVWMDEKTRLAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEVSEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYAHNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLTAFQNHTACMEEQYSQYQVNGERLNGLQTLGENIADNGGLKAAYNAYKAWLRKHGEEQPLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 910          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Mouse
Match: Gm49333 (predicted gene, 49333 [Source:MGI Symbol;Acc:MGI:6121518])

HSP 1 Score: 455.677 bits (1171), Expect = 8.600e-146
Identity = 250/688 (36.34%), Postives = 391/688 (56.83%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTN-DLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S C+T +C++ A +I +SL+  V+PC DF QF CG W     LP G SR++TF+ +      I K LLEN  F ++S    K    Y SCL  +RI  LGA PL   +++     GGW +    D +  +D   + K +      TP   + V  D K+S+ NI+ +  S L +  R +  N T   N+K+L  + DYM ++G LL  +     EQ  ++L+LEI++A     ++ +RD E  Y+KM++SE+Q       +W E +     L  + +     ++V     L  + EL     ++  IL+NY++W  V +  + L + F+  ++K     YG   +   RW+ C+S     +   LG++++K  F++QSK     MIN ++  F+  L   VWMD++TR  A EK D ++ +IG+ D IL    L++ +   E+++ ++F+N+  L N +     ++L K P       TPQ VNA+Y P KNEI+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + +   F+  + C  +QYS+Y ++G  +NG  TLGENIADNGG++  Y  YK   +K+G+E+ LP +  T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RV+GTLSN ++F   F CP GS MNP   C VW
Sbjct:  208 STCVTEACIRVAGKILESLDRGVSPCQDFYQFSCGGWIRRNPLPNGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAERKTRSFYLSCLQSERIEKLGAKPLRDLIDKI----GGWNITGPWDEDSFMD---VLKAVAGTYRATPFFTVYVSADSKSSNSNIIQVDQSGLFLPSRDYYLNRTA--NEKVLTAYLDYMVELGVLLGGQPTSTREQMQQVLELEIQLANITVPQDQRRDEEKIYHKMSISELQA-LAPAVDWLEFLS--FLLSPLELGDSEPVVVYGTEYLQQVSELINR--TEPSILNNYLIWNLVQKTTSSLDQRFETAQEKLLETLYGTKKSCTPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMINEIRSAFEETLGDLVWMDEKTRLAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEVSEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYAHNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLTAFQNHTACMEEQYSQYQVNGERLNGLQTLGENIADNGGLKAAYNAYKAWLRKHGEEQPLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 881          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Mouse
Match: Ece1 (endothelin converting enzyme 1 [Source:MGI Symbol;Acc:MGI:1101357])

HSP 1 Score: 443.736 bits (1140), Expect = 8.060e-143
Identity = 256/686 (37.32%), Postives = 380/686 (55.39%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWL-LMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF--EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTK-ERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            CLT +C+     I  S++ +V+PC DF  + CG W     +P G SR+ TF  +      + K LLEN      S    KA   Y +C+N  RI  L A PL+  + +     GGW +            D  +V+      +P   + V  D KNS+ N++ +  S L L  R +  N+T  EN+K+L  + +YM  +GKLL    E     Q  +IL  E  +A     +E +RD E  Y+K+T +E+Q       NW   +      V I  S+   I+V +   L  +  L  +  + K +L+NY++W  V +  +FL + FQ   +KF  V YG   T   RW+ CVS  + ++   LG M++K  F + SK    E+I  +K+ F+ +L +  WMD++TR  A EK D ++ +IGY + I++   L++ F D       YFEN     N +     ++L K P       TP  VNA+YSP KNEI+FPAGILQ PF+    P +L +GGIG  +GHE+ H FDD G +YD  G+LR WW + + + FK +++C V+QYS YS++G  +NG +TLGENIADNGG++  Y+ Y++  KK G E+ LP L  T +QLFF+ FA++WC+++T +S    ++++ H+P+ +RVIG+LSN KEF+E F CP GS MNP  KC VW
Sbjct:   82 CLTEACVSVTSSILNSMDPTVDPCQDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAVIKHLLENATASV-SEAERKAQVYYRACMNETRIEELRAKPLMELIEK----LGGWNITGPWAKDNFQ--DTLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKT--ENEKVLTGYLNYMVQLGKLLGGGDEDAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQ-TLAPAINWLPFLNTIFYPVEINESE--PIVVYDKEYLRQVSTLINN--TDKCLLNNYMMWNLVRKTSSFLDQRFQDADEKFMEVMYGTKKTCIPRWKFCVSDTENNLGFALGPMFVKATFAEDSKNIASEIIMEIKKAFEESLSTLKWMDEETRRSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPNALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKQQTECMVQQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEQTLPTLGLTSNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPHHKCEVW 753          
BLAST of Endothelin-converting enzyme 1 vs. UniProt/SwissProt
Match: sp|P0DPD6|ECE2_HUMAN (Endothelin-converting enzyme 2 OS=Homo sapiens OX=9606 GN=ECE2 PE=1 SV=1)

HSP 1 Score: 462.225 bits (1188), Expect = 2.999e-148
Identity = 250/693 (36.08%), Postives = 390/693 (56.28%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWD------LAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CLT +C++ A +I +SL+  V+PC DF QF CG W     LP G SR++TF+ +      I K LLEN  F ++S    K  + Y SCL ++RI  LGA PL   + +     GGW +           WD      + K +      TP   + +  D K+S+ N++ +  S L +  R +  N T   N+K+L  + DYM ++G LL  R     EQ  ++L+LEI++A     ++ +RD E  Y+KM++SE+Q       +W E +     L  + +S    ++V     L  + EL     ++  IL+NY++W  V +  + L   F+  ++K     YG   +   RW+ C+S     +   LG++++K  F++QSK     MI+ ++  F+  L   VWMD++TR  A EK D ++ +IG+ D IL    L++ +   EI++ ++F+N+  L N +     ++L K P       TPQ VNA+Y P KNEI+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + +   F+  + C  +QY++Y ++G  +NG  TLGENIADNGG++  Y  YK   +K+G+E+ LP +  T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RV+GTLSN ++F   F CP GS MNP   C VW
Sbjct:  138 STCLTEACIRVAGKILESLDRGVSPCEDFYQFSCGGWIRRNPLPDGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAEQKTQRFYLSCLQVERIEELGAQPLRDLIEKI----GGWNIT--------GPWDQDNFMEVLKAVAGTYRATPFFTVYISADSKSSNSNVIQVDQSGLFLPSRDYYLNRTA--NEKVLTAYLDYMEELGMLLGGRPTSTREQMQQVLELEIQLANITVPQDQRRDEEKIYHKMSISELQA-LAPSMDWLEFLS--FLLSPLELSDSEPVVVYGMDYLQQVSELINR--TEPSILNNYLIWNLVQKTTSSLDRRFESAQEKLLETLYGTKKSCVPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMISEIRTAFEEALGQLVWMDEKTRQAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEISEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYARNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLAAFRNHTACMEEQYNQYQVNGERLNGRQTLGENIADNGGLKAAYNAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 811          
BLAST of Endothelin-converting enzyme 1 vs. UniProt/SwissProt
Match: sp|P0DPD8|EFCE2_HUMAN (EEF1AKMT4-ECE2 readthrough transcript protein OS=Homo sapiens OX=9606 GN=EEF1AKMT4-ECE2 PE=1 SV=1)

HSP 1 Score: 462.225 bits (1188), Expect = 2.017e-147
Identity = 252/693 (36.36%), Postives = 391/693 (56.42%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWD------LAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CLT +C++ A +I +SL+  V+PC DF QF CG W     LP G SR++TF+ +      I K LLEN  F ++S    K  + Y SCL ++RI  LGA PL   + +     GGW    N   P    WD      + K +      TP   + +  D K+S+ N++ +  S L +  R +  N T   N+K+L  + DYM ++G LL  R     EQ  ++L+LEI++A     ++ +RD E  Y+KM++SE+Q       +W E +     L  + +S    ++V     L  + EL     ++  IL+NY++W  V +  + L   F+  ++K     YG   +   RW+ C+S     +   LG++++K  F++QSK     MI+ ++  F+  L   VWMD++TR  A EK D ++ +IG+ D IL    L++ +   EI++ ++F+N+  L N +     ++L K P       TPQ VNA+Y P KNEI+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + +   F+  + C  +QY++Y ++G  +NG  TLGENIADNGG++  Y  YK   +K+G+E+ LP +  T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RV+GTLSN ++F   F CP GS MNP   C VW
Sbjct:  210 STCLTEACIRVAGKILESLDRGVSPCEDFYQFSCGGWIRRNPLPDGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAEQKTQRFYLSCLQVERIEELGAQPLRDLIEKI----GGW----NITGP----WDQDNFMEVLKAVAGTYRATPFFTVYISADSKSSNSNVIQVDQSGLFLPSRDYYLNRTA--NEKVLTAYLDYMEELGMLLGGRPTSTREQMQQVLELEIQLANITVPQDQRRDEEKIYHKMSISELQA-LAPSMDWLEFLS--FLLSPLELSDSEPVVVYGMDYLQQVSELINR--TEPSILNNYLIWNLVQKTTSSLDRRFESAQEKLLETLYGTKKSCVPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMISEIRTAFEEALGQLVWMDEKTRQAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEISEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYARNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLAAFRNHTACMEEQYNQYQVNGERLNGRQTLGENIADNGGLKAAYNAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 883          
BLAST of Endothelin-converting enzyme 1 vs. UniProt/SwissProt
Match: sp|F1N476|ECE2_BOVIN (Endothelin-converting enzyme 2 OS=Bos taurus OX=9913 GN=ECE2 PE=2 SV=1)

HSP 1 Score: 457.988 bits (1177), Expect = 3.509e-147
Identity = 249/693 (35.93%), Postives = 390/693 (56.28%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWD------LAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CLT +C++ A +I +SL+  V+PC DF QF CG W     LP G SR++TF+ +      I K LLEN  F ++S    K  + Y SCL ++RI  LGA PL   +++     GGW    N   P    WD      + K +      TP   + V  D K+S+ NI+ +  S L +  R +  N T   N+K+L  + DYM ++G LL  +     EQ  ++L+LEI++A     ++ +RD E  Y+KM+++E+Q       +W E +     L  + +     ++V     L  + EL     ++  +L+NY++W  V +  + L   F+  ++K     YG   +   RW+ C+S     +   LG++++K  F++QSK     MI+ ++  F+  L   VWMD++TR  A EK D ++ +IG+ D IL    L++ +   E+++ ++F+N+  L N +     ++L K P       TPQ VNA+Y P KNEI+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + +   F+  + C  +QYS+Y ++G  +NG  TLGENIADNGG++  Y  YK   +K+G+E+ LP +  T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RV+GTLSN ++F   F CP GS MN    C VW
Sbjct:   92 STCLTEACIRVAGKILESLDRGVSPCEDFYQFSCGGWIRRNPLPDGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAERKTQRFYLSCLQVERIEELGAQPLRDLIDKI----GGW----NVTGP----WDQDNFMEVLKAVAGTYRATPFFTVYVSADSKSSNSNIIQVDQSGLFLPSRDYYLNRTA--NEKVLTAYLDYMEELGMLLGGQPTSTREQMRQVLELEIQLANITVPQDQRRDEEKIYHKMSIAELQA-LAPSMDWLEFLS--FLLSPLELGDSEPVVVYGTDYLQQVSELINR--TEPSVLNNYLIWNLVQKTTSSLDHRFESAQEKLLETLYGTKKSCTPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMISEIRAAFEEALGHLVWMDEKTRQAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEVSEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYTCNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLAAFRNHTACIEEQYSQYQVNGEKLNGRQTLGENIADNGGLKAAYNAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNSGQLCEVW 765          
BLAST of Endothelin-converting enzyme 1 vs. UniProt/SwissProt
Match: sp|B2RQR8|ECE2_MOUSE (Endothelin-converting enzyme 2 OS=Mus musculus OX=10090 GN=Ece2 PE=1 SV=1)

HSP 1 Score: 456.447 bits (1173), Expect = 1.252e-146
Identity = 250/688 (36.34%), Postives = 391/688 (56.83%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTN-DLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S C+T +C++ A +I +SL+  V+PC DF QF CG W     LP G SR++TF+ +      I K LLEN  F ++S    K    Y SCL  +RI  LGA PL   +++     GGW +    D +  +D   + K +      TP   + V  D K+S+ NI+ +  S L +  R +  N T   N+K+L  + DYM ++G LL  +     EQ  ++L+LEI++A     ++ +RD E  Y+KM++SE+Q       +W E +     L  + +     ++V     L  + EL     ++  IL+NY++W  V +  + L + F+  ++K     YG   +   RW+ C+S     +   LG++++K  F++QSK     MIN ++  F+  L   VWMD++TR  A EK D ++ +IG+ D IL    L++ +   E+++ ++F+N+  L N +     ++L K P       TPQ VNA+Y P KNEI+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + +   F+  + C  +QYS+Y ++G  +NG  TLGENIADNGG++  Y  YK   +K+G+E+ LP +  T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RV+GTLSN ++F   F CP GS MNP   C VW
Sbjct:   90 STCVTEACIRVAGKILESLDRGVSPCQDFYQFSCGGWIRRNPLPNGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAERKTRSFYLSCLQSERIEKLGAKPLRDLIDKI----GGWNITGPWDEDSFMD---VLKAVAGTYRATPFFTVYVSADSKSSNSNIIQVDQSGLFLPSRDYYLNRTA--NEKVLTAYLDYMVELGVLLGGQPTSTREQMQQVLELEIQLANITVPQDQRRDEEKIYHKMSISELQA-LAPAVDWLEFLS--FLLSPLELGDSEPVVVYGTEYLQQVSELINR--TEPSILNNYLIWNLVQKTTSSLDQRFETAQEKLLETLYGTKKSCTPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMINEIRSAFEETLGDLVWMDEKTRLAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEVSEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYAHNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLTAFQNHTACMEEQYSQYQVNGERLNGLQTLGENIADNGGLKAAYNAYKAWLRKHGEEQPLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW 763          
BLAST of Endothelin-converting enzyme 1 vs. UniProt/SwissProt
Match: sp|P0DPE2|EFCE2_BOVIN (EEF1AKMT4-ECE2 readthrough transcript protein OS=Bos taurus OX=9913 GN=EEF1AKMT4-ECE2 PE=1 SV=1)

HSP 1 Score: 456.447 bits (1173), Expect = 2.991e-145
Identity = 249/693 (35.93%), Postives = 390/693 (56.28%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWD------LAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CLT +C++ A +I +SL+  V+PC DF QF CG W     LP G SR++TF+ +      I K LLEN  F ++S    K  + Y SCL ++RI  LGA PL   +++     GGW    N   P    WD      + K +      TP   + V  D K+S+ NI+ +  S L +  R +  N T   N+K+L  + DYM ++G LL  +     EQ  ++L+LEI++A     ++ +RD E  Y+KM+++E+Q       +W E +     L  + +     ++V     L  + EL     ++  +L+NY++W  V +  + L   F+  ++K     YG   +   RW+ C+S     +   LG++++K  F++QSK     MI+ ++  F+  L   VWMD++TR  A EK D ++ +IG+ D IL    L++ +   E+++ ++F+N+  L N +     ++L K P       TPQ VNA+Y P KNEI+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + +   F+  + C  +QYS+Y ++G  +NG  TLGENIADNGG++  Y  YK   +K+G+E+ LP +  T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RV+GTLSN ++F   F CP GS MN    C VW
Sbjct:  210 STCLTEACIRVAGKILESLDRGVSPCEDFYQFSCGGWIRRNPLPDGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAERKTQRFYLSCLQVERIEELGAQPLRDLIDKI----GGW----NVTGP----WDQDNFMEVLKAVAGTYRATPFFTVYVSADSKSSNSNIIQVDQSGLFLPSRDYYLNRTA--NEKVLTAYLDYMEELGMLLGGQPTSTREQMRQVLELEIQLANITVPQDQRRDEEKIYHKMSIAELQA-LAPSMDWLEFLS--FLLSPLELGDSEPVVVYGTDYLQQVSELINR--TEPSVLNNYLIWNLVQKTTSSLDHRFESAQEKLLETLYGTKKSCTPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMISEIRAAFEEALGHLVWMDEKTRQAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEVSEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYTCNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLAAFRNHTACIEEQYSQYQVNGEKLNGRQTLGENIADNGGLKAAYNAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNSGQLCEVW 883          
BLAST of Endothelin-converting enzyme 1 vs. TrEMBL
Match: F6U2S1 (Uncharacterized protein OS=Ciona intestinalis OX=7719 PE=4 SV=2)

HSP 1 Score: 483.797 bits (1244), Expect = 1.835e-155
Identity = 280/699 (40.06%), Postives = 405/699 (57.94%), Query Frame = 1
Query:  544 PCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTN------DLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWL-LMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQF--NEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRR-MKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGV-VGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEIN-DQTYFEN----IDMLTNRAMYRNFEKLNKRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGK-EKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            PC T +C+  A ++  SL+ SV+PC DF +F CG W+   +LP G SR+S F+ +      I K +LE    + NS    KA   Y+SC++L+ IN  GA PL+T L +     GGW +L N      D N T+ ++        P    P   I V  D K+S+ NI+ +  S L L  R F  N+T  E+ KIL  + DYM +V  LL  +     +F   E+L+LE ++A      E+ R+ E  Y++M L+++Q       +W+ +V    +KL N T+  +  +I  +   L +  ++   Y + KR+L NY  WR V+  ++ L + F    +KF +V YG  +   ERW  C++ V   + L +G ++++  F+K SK    EM+  +K  FQ NL    WMD  TR  A EK   +  +IG+ D ILN+TY+ E +K++ ++ ++ +FE+    +  +T + + ++  K  KR E S   TP  VNA+YSP KN I+FPAGILQ PF+   FP+S+ YGGIG  +GHE+ HGFDD G +YD  G+L  WW   T   FK K++C V+QY  ++  G  +NG  TLGENIADNGGVRL Y  Y++ +K  G  E  LP LNYTHDQLFFI+FA+LWC++ T Q     +L + H+P   RVIGTLSNF+EF++AF+CPKGS MNP  KC VW
Sbjct:   21 PCTTRACINVASKVALSLDESVDPCQDFYEFACGGWEESNLLPSGESRWSGFNALQQSNHAIMKNVLELNTTQNNSVAEKKAKIFYESCIDLEAINKRGAQPLLTMLEKV----GGWPVLNNWDESSFDFNATIQQYF-------PYSIYPFFSIGVNTDSKHSNSNIVIVGESGLSLGTRDFYVNKTI-EDDKILHAYLDYMTEVATLLGAKDRNITRFRMKEVLELEKKLAIISLPLEEMRNEEKNYHRMVLADLQ-DLAPAVDWSNLVPELFLKLANETVGTNEPVITFSRQYLRNFSDIV--YQTPKRVLGNYFGWRFVHSFVSALGQPFLEALNKFHKVQYGSNMNCVERWRRCLNTVDSVLGLAVGRLFVQKKFDKTSKSSAEEMVREIKASFQKNLPKTSWMDPVTRKKASEKCSAVEDMIGFDDKILNITYVNEKYKNLIVDPNKGHFEHHVSVVRYITVKEL-KHLRKPVKRKEWSI--TPPTVNAYYSPTKNIIVFPAGILQPPFYSSNFPKSINYGGIGIVVGHELTHGFDDQGRQYDLNGNLNNWWQKDTLAKFKKKAECMVEQYGSFNFGGAQVNGVLTLGENIADNGGVRLAYNAYQEWKKANGSLETQLPSLNYTHDQLFFISFAQLWCSVSTPQFRKHQVLVDMHSPPKARVIGTLSNFEEFSKAFSCPKGSPMNPAKKCKVW 701          
BLAST of Endothelin-converting enzyme 1 vs. TrEMBL
Match: A0A3Q0K666 (endothelin-converting enzyme 2 isoform X2 OS=Ciona intestinalis OX=7719 GN=LOC100186841 PE=4 SV=1)

HSP 1 Score: 484.182 bits (1245), Expect = 2.344e-154
Identity = 280/699 (40.06%), Postives = 405/699 (57.94%), Query Frame = 1
Query:  544 PCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTN------DLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWL-LMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQF--NEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRR-MKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGV-VGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEIN-DQTYFEN----IDMLTNRAMYRNFEKLNKRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGK-EKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            PC T +C+  A ++  SL+ SV+PC DF +F CG W+   +LP G SR+S F+ +      I K +LE    + NS    KA   Y+SC++L+ IN  GA PL+T L +     GGW +L N      D N T+ ++        P    P   I V  D K+S+ NI+ +  S L L  R F  N+T  E+ KIL  + DYM +V  LL  +     +F   E+L+LE ++A      E+ R+ E  Y++M L+++Q       +W+ +V    +KL N T+  +  +I  +   L +  ++   Y + KR+L NY  WR V+  ++ L + F    +KF +V YG  +   ERW  C++ V   + L +G ++++  F+K SK    EM+  +K  FQ NL    WMD  TR  A EK   +  +IG+ D ILN+TY+ E +K++ ++ ++ +FE+    +  +T + + ++  K  KR E S   TP  VNA+YSP KN I+FPAGILQ PF+   FP+S+ YGGIG  +GHE+ HGFDD G +YD  G+L  WW   T   FK K++C V+QY  ++  G  +NG  TLGENIADNGGVRL Y  Y++ +K  G  E  LP LNYTHDQLFFI+FA+LWC++ T Q     +L + H+P   RVIGTLSNF+EF++AF+CPKGS MNP  KC VW
Sbjct:  124 PCTTRACINVASKVALSLDESVDPCQDFYEFACGGWEESNLLPSGESRWSGFNALQQSNHAIMKNVLELNTTQNNSVAEKKAKIFYESCIDLEAINKRGAQPLLTMLEKV----GGWPVLNNWDESSFDFNATIQQYF-------PYSIYPFFSIGVNTDSKHSNSNIVIVGESGLSLGTRDFYVNKTI-EDDKILHAYLDYMTEVATLLGAKDRNITRFRMKEVLELEKKLAIISLPLEEMRNEEKNYHRMVLADLQ-DLAPAVDWSNLVPELFLKLANETVGTNEPVITFSRQYLRNFSDIV--YQTPKRVLGNYFGWRFVHSFVSALGQPFLEALNKFHKVQYGSNMNCVERWRRCLNTVDSVLGLAVGRLFVQKKFDKTSKSSAEEMVREIKASFQKNLPKTSWMDPVTRKKASEKCSAVEDMIGFDDKILNITYVNEKYKNLIVDPNKGHFEHHVSVVRYITVKEL-KHLRKPVKRKEWSI--TPPTVNAYYSPTKNIIVFPAGILQPPFYSSNFPKSINYGGIGIVVGHELTHGFDDQGRQYDLNGNLNNWWQKDTLAKFKKKAECMVEQYGSFNFGGAQVNGVLTLGENIADNGGVRLAYNAYQEWKKANGSLETQLPSLNYTHDQLFFISFAQLWCSVSTPQFRKHQVLVDMHSPPKARVIGTLSNFEEFSKAFSCPKGSPMNPAKKCKVW 804          
BLAST of Endothelin-converting enzyme 1 vs. TrEMBL
Match: A0A3Q0K2P4 (endothelin-converting enzyme 2 isoform X1 OS=Ciona intestinalis OX=7719 GN=LOC100186841 PE=4 SV=1)

HSP 1 Score: 484.182 bits (1245), Expect = 2.751e-154
Identity = 280/699 (40.06%), Postives = 405/699 (57.94%), Query Frame = 1
Query:  544 PCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTN------DLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWL-LMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQF--NEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRR-MKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGV-VGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEIN-DQTYFEN----IDMLTNRAMYRNFEKLNKRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGK-EKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            PC T +C+  A ++  SL+ SV+PC DF +F CG W+   +LP G SR+S F+ +      I K +LE    + NS    KA   Y+SC++L+ IN  GA PL+T L +     GGW +L N      D N T+ ++        P    P   I V  D K+S+ NI+ +  S L L  R F  N+T  E+ KIL  + DYM +V  LL  +     +F   E+L+LE ++A      E+ R+ E  Y++M L+++Q       +W+ +V    +KL N T+  +  +I  +   L +  ++   Y + KR+L NY  WR V+  ++ L + F    +KF +V YG  +   ERW  C++ V   + L +G ++++  F+K SK    EM+  +K  FQ NL    WMD  TR  A EK   +  +IG+ D ILN+TY+ E +K++ ++ ++ +FE+    +  +T + + ++  K  KR E S   TP  VNA+YSP KN I+FPAGILQ PF+   FP+S+ YGGIG  +GHE+ HGFDD G +YD  G+L  WW   T   FK K++C V+QY  ++  G  +NG  TLGENIADNGGVRL Y  Y++ +K  G  E  LP LNYTHDQLFFI+FA+LWC++ T Q     +L + H+P   RVIGTLSNF+EF++AF+CPKGS MNP  KC VW
Sbjct:  124 PCTTRACINVASKVALSLDESVDPCQDFYEFACGGWEESNLLPSGESRWSGFNALQQSNHAIMKNVLELNTTQNNSVAEKKAKIFYESCIDLEAINKRGAQPLLTMLEKV----GGWPVLNNWDESSFDFNATIQQYF-------PYSIYPFFSIGVNTDSKHSNSNIVIVGESGLSLGTRDFYVNKTI-EDDKILHAYLDYMTEVATLLGAKDRNITRFRMKEVLELEKKLAIISLPLEEMRNEEKNYHRMVLADLQ-DLAPAVDWSNLVPELFLKLANETVGTNEPVITFSRQYLRNFSDIV--YQTPKRVLGNYFGWRFVHSFVSALGQPFLEALNKFHKVQYGSNMNCVERWRRCLNTVDSVLGLAVGRLFVQKKFDKTSKSSAEEMVREIKASFQKNLPKTSWMDPVTRKKASEKCSAVEDMIGFDDKILNITYVNEKYKNLIVDPNKGHFEHHVSVVRYITVKEL-KHLRKPVKRKEWSI--TPPTVNAYYSPTKNIIVFPAGILQPPFYSSNFPKSINYGGIGIVVGHELTHGFDDQGRQYDLNGNLNNWWQKDTLAKFKKKAECMVEQYGSFNFGGAQVNGVLTLGENIADNGGVRLAYNAYQEWKKANGSLETQLPSLNYTHDQLFFISFAQLWCSVSTPQFRKHQVLVDMHSPPKARVIGTLSNFEEFSKAFSCPKGSPMNPAKKCKVW 804          
BLAST of Endothelin-converting enzyme 1 vs. TrEMBL
Match: A0A401RYI9 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0001600 PE=4 SV=1)

HSP 1 Score: 475.707 bits (1223), Expect = 1.630e-151
Identity = 258/703 (36.70%), Postives = 403/703 (57.33%), Query Frame = 1
Query:  511 VISNQNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWD------LAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKI-RKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            VI N        CLT +C+  A +I +SL+ SV PC DF Q+ CG W  +  LP G SR++TF+ +      + K LLEN  F ++S    KA + Y SCLN  RI  LGA PL+  +N+T    GGW +           WD      + K +       P   + V  D K+S+ N++ +  S + +  R +  N+T   N+K+L+ + DYM ++G LL   R   + Q  +IL+ E  +A     ++++RD E  Y+KMT+S++Q       +W + +     L  + +++   ++V     L  + +L  +  + K IL+NY++W  V +  + L + F+  ++K     YG   +   RW+ C+      +   LG +++K  F+K SK    EMIN ++  F++ L    WMDD+TR  A EK D ++ +IG+ D IL+   L+E +   E+++ ++F+N+    N +     ++L K P       TP  +NA+Y P KNEI+FPAGILQ PF+    P+SL +GGIG  MGHE+ H FDD G +YD  G+L+ WW + + + FK K++C V QY++Y+++G  ING+ TLGENIADNGG++  Y  YK   K+ G+EKLLP ++ T+ QLFF+ FA++WC+++T +S    ++++ H+P  +RVIGTLSN K+FAE FNCP G+ MNP  +C VW
Sbjct:   86 VIKNSQDPSHKICLTETCIMVAAKITESLDRSVGPCSDFYQYACGGWIKKNPLPDGRSRWNTFNSLWDQNQAVMKHLLENSTFNSSSEAERKAQRYYLSCLNEQRIEELGAQPLIDLINKT----GGWNIT--------GPWDKDNFMEVLKAVSGTYRAVPFFTVYVSADSKSSNSNVIQVDQSGVFLPSRDYYLNKTA--NEKVLNAYLDYMVELGILLGGERNSTYIQMQQILEFETILANITVPQDERRDEEKIYHKMTISDLQ-NLAPAIDWLDYLS--FGLAPVDLNETESVVVYAKEYLQMVSDLINN--TDKSILNNYMIWNLVLKTASNLDQRFENAQEKLLETLYGTKKSCTPRWQTCIGNTDDTLGFALGALFVKVTFDKDSKIVAEEMINEIRTAFKDGLDELAWMDDKTRQAAKEKADAIYDMIGFPDFILDTKELDEVYDGYEVSEDSFFQNMLNFYNFSAKVMADQLRKAPNRDQWSMTPPTINAYYLPTKNEIVFPAGILQAPFYARNNPKSLNFGGIGVVMGHELTHAFDDQGREYDKDGNLQPWWQNCSVETFKNKTECMVNQYNQYTVNGEHINGKQTLGENIADNGGLKAAYHAYKTWVKQNGEEKLLPAVDLTNHQLFFVGFAQVWCSVRTPESAHEGLITDPHSPAKFRVIGTLSNSKDFAEHFNCPTGTPMNPGKQCEVW 769          
BLAST of Endothelin-converting enzyme 1 vs. TrEMBL
Match: A0A5G3IRF2 (Dehydrodolichyl diphosphate synthase subunit OS=Xenopus tropicalis OX=8364 GN=dhdds PE=4 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 1.157e-150
Identity = 254/696 (36.49%), Postives = 395/696 (56.75%), Query Frame = 1
Query:  514 ISNQNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFE-QFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            +++++R L   CL+ +C+  A  I  SL+  ++PC DF Q+ CG W     LP G SR++TF+ +      I K +LEN  F ++S    K  + Y SCL   RI  L   PL   + +     GGW +  N          + K +      TP   + V  D K+S+ NI+ +  S L +  R +  N+T   N K+LD +  YM  VG+LL       + Q  +IL+ E  +A     ++++RD E  YN+MT+SE+Q      F+W + +     L  + ++    ++V     L  + EL  +  +   +L+NY++W  V +  + L   F++ +DK     YG   +   RW+ C+S     +   LG++++K+ F+K SK    +MI+ ++  F+  L    WMD++TR  A EK D ++ +IG+ D IL+   L+E +   E+++  +F+N+    N +     E+L K P       TPQ VNA+Y PNKNEI+FPAGILQ PF+ P  P++L +GGIG  MGHE+ H FDD G +YD  G+LR WW + + + FK +++C V QY+ Y+++G  +NG  TLGENIADNGG++  Y  YK    K+G+EK LPG+  T++QLFF+ FA++WC+++T +S    ++++ H+P  +RVIGTLSN K+FAE FNCPKG+ MNP   C VW
Sbjct:   87 MTDRSRSL---CLSEACVSVAGRILDSLDRGIDPCQDFYQYSCGGWMRRNPLPDGRSRWNTFNSIWDQNQAILKHILENATFNSSSEAEMKTQRFYLSCLKEQRIEELRQKPLTDLIEKI----GGWNISGNWRGENF--MSVLKTVSGTYRATPFFSVFVSADSKSSNSNIIQVDQSGLFLPSRDYYLNKTA--NGKVLDAYLQYMVSVGELLGGSPGSVDMQMTQILEFETLLANLTVPQDERRDEEKIYNRMTISELQ-SLAPAFDWMDYLT--FALSPLDLNDTEPVVVYGKEYLQQVSELVNN--TDPMLLNNYLVWNLVQKMSSSLDSRFEKAQDKLLESLYGAKKSCTPRWQTCLSNTDDTLGFALGSLFVKSTFDKNSKNIAEQMISEIRDAFELTLGGLTWMDEKTRRAAKEKADAIYDMIGFPDFILDTKELDEVYDGFEVSEDAFFQNMLNFYNFSAKLMAEQLRKPPNREQWSMTPQTVNAYYLPNKNEIVFPAGILQAPFYAPTHPKALNFGGIGVVMGHELTHAFDDQGREYDEDGNLRPWWQNSSLEAFKNRTECMVNQYNSYTVNGERVNGRQTLGENIADNGGLKAAYHAYKSWLVKHGEEKQLPGVGLTNNQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPAKFRVIGTLSNSKDFAEHFNCPKGTPMNPGKHCDVW 766          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Cavefish
Match: ece2b (endothelin-converting enzyme 2 [Source:NCBI gene;Acc:103045399])

HSP 1 Score: 462.225 bits (1188), Expect = 7.022e-150
Identity = 256/690 (37.10%), Postives = 392/690 (56.81%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDK---WDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFE-QFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CLT +C+  A +I +SL+ +V+PC DF Q+ CG W  +  LP G SR+STF+ +      + K LLEN  F ++S    KA   Y SCLN  RI  LGA PLV  + +T    GGW     ++  T DK    D+ K +  P    P   + V  D KNS+ N++ +  S L +  R +  N+T   N+K+L  + DYM ++G LL   K   + Q  +IL  E  +A     ++++RD E  Y+K+T++E+Q        W + +   +  + +  ++   ++V     L  + EL     + + +L+NY++W  V +  + L + F+  +DK     YG   +   RW+ C+      +   LG +++   F+K SK     MIN ++  FQ+ L    WMDDQTR  A EK D ++ +IGY D IL+   L++ +   ++++  +F+N+    N +     ++L K P       TP  VNA+Y P KN I+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD  G+LR WW + +   FK +++C V QY++Y+I+G  ING+ TLGENIADNGG++  Y  Y+   K  G+EK LP +N T+DQLFF+ FA++WC+++T +S    ++++ H+P  YRVIGTLSN  +F++ FNCP GS MN   +C VW
Sbjct:   91 SLCLTEACVTVASKIVESLDRTVDPCQDFYQYACGGWIRKNPLPDGRSRWSTFNSIWDQNQAVLKHLLENGTFNSSSEAEKKAQFYYLSCLNEQRIEELGAQPLVDLIAKT----GGW-----NITETWDKDNFMDVLKTVSGPYRAQPFFTVGVSVDPKNSNSNVIQVDQSGLFLPSRDYYLNKT---NEKVLKAYLDYMVELGLLLGGDKNSTQNQMQQILDFETALANITVPQDERRDEEKIYHKITIAELQ-TLAPAVEWLDYLSSVLSPLELNDTE--PVVVYAKEYLQQVSELINK--TDRNLLNNYMIWNLVQKGASSLDQRFENAQDKLLESLYGTKKSCTPRWQTCIGNTDDTLGFALGALFVNATFDKHSKEIAEGMINEIRTAFQDALDHLNWMDDQTRKAAKEKADDIYDMIGYPDFILDPKELDDVYDGYDVSEDNFFQNMLNFYNFSARVMADQLRKPPNKDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYARDHPKALNFGGIGVVMGHELTHAFDDQGREYDKTGNLRPWWQNSSVDAFKNRTECMVDQYTQYTINGEHINGKQTLGENIADNGGLKAAYHAYRSWVKTNGEEKSLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPKYRVIGTLSNSPDFSQHFNCPLGSPMNSGHRCEVW 763          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Cavefish
Match: ece2b (endothelin-converting enzyme 2 [Source:NCBI gene;Acc:103045399])

HSP 1 Score: 462.225 bits (1188), Expect = 9.302e-150
Identity = 256/690 (37.10%), Postives = 392/690 (56.81%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDK---WDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFE-QFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CLT +C+  A +I +SL+ +V+PC DF Q+ CG W  +  LP G SR+STF+ +      + K LLEN  F ++S    KA   Y SCLN  RI  LGA PLV  + +T    GGW     ++  T DK    D+ K +  P    P   + V  D KNS+ N++ +  S L +  R +  N+T   N+K+L  + DYM ++G LL   K   + Q  +IL  E  +A     ++++RD E  Y+K+T++E+Q        W + +   +  + +  ++   ++V     L  + EL     + + +L+NY++W  V +  + L + F+  +DK     YG   +   RW+ C+      +   LG +++   F+K SK     MIN ++  FQ+ L    WMDDQTR  A EK D ++ +IGY D IL+   L++ +   ++++  +F+N+    N +     ++L K P       TP  VNA+Y P KN I+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD  G+LR WW + +   FK +++C V QY++Y+I+G  ING+ TLGENIADNGG++  Y  Y+   K  G+EK LP +N T+DQLFF+ FA++WC+++T +S    ++++ H+P  YRVIGTLSN  +F++ FNCP GS MN   +C VW
Sbjct:   93 SLCLTEACVTVASKIVESLDRTVDPCQDFYQYACGGWIRKNPLPDGRSRWSTFNSIWDQNQAVLKHLLENGTFNSSSEAEKKAQFYYLSCLNEQRIEELGAQPLVDLIAKT----GGW-----NITETWDKDNFMDVLKTVSGPYRAQPFFTVGVSVDPKNSNSNVIQVDQSGLFLPSRDYYLNKT---NEKVLKAYLDYMVELGLLLGGDKNSTQNQMQQILDFETALANITVPQDERRDEEKIYHKITIAELQ-TLAPAVEWLDYLSSVLSPLELNDTE--PVVVYAKEYLQQVSELINK--TDRNLLNNYMIWNLVQKGASSLDQRFENAQDKLLESLYGTKKSCTPRWQTCIGNTDDTLGFALGALFVNATFDKHSKEIAEGMINEIRTAFQDALDHLNWMDDQTRKAAKEKADDIYDMIGYPDFILDPKELDDVYDGYDVSEDNFFQNMLNFYNFSARVMADQLRKPPNKDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYARDHPKALNFGGIGVVMGHELTHAFDDQGREYDKTGNLRPWWQNSSVDAFKNRTECMVDQYTQYTINGEHINGKQTLGENIADNGGLKAAYHAYRSWVKTNGEEKSLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPKYRVIGTLSNSPDFSQHFNCPLGSPMNSGHRCEVW 765          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Cavefish
Match: ece2b (endothelin-converting enzyme 2 [Source:NCBI gene;Acc:103045399])

HSP 1 Score: 462.225 bits (1188), Expect = 1.315e-149
Identity = 256/690 (37.10%), Postives = 392/690 (56.81%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDK---WDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFE-QFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CLT +C+  A +I +SL+ +V+PC DF Q+ CG W  +  LP G SR+STF+ +      + K LLEN  F ++S    KA   Y SCLN  RI  LGA PLV  + +T    GGW     ++  T DK    D+ K +  P    P   + V  D KNS+ N++ +  S L +  R +  N+T   N+K+L  + DYM ++G LL   K   + Q  +IL  E  +A     ++++RD E  Y+K+T++E+Q        W + +   +  + +  ++   ++V     L  + EL     + + +L+NY++W  V +  + L + F+  +DK     YG   +   RW+ C+      +   LG +++   F+K SK     MIN ++  FQ+ L    WMDDQTR  A EK D ++ +IGY D IL+   L++ +   ++++  +F+N+    N +     ++L K P       TP  VNA+Y P KN I+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD  G+LR WW + +   FK +++C V QY++Y+I+G  ING+ TLGENIADNGG++  Y  Y+   K  G+EK LP +N T+DQLFF+ FA++WC+++T +S    ++++ H+P  YRVIGTLSN  +F++ FNCP GS MN   +C VW
Sbjct:  114 SLCLTEACVTVASKIVESLDRTVDPCQDFYQYACGGWIRKNPLPDGRSRWSTFNSIWDQNQAVLKHLLENGTFNSSSEAEKKAQFYYLSCLNEQRIEELGAQPLVDLIAKT----GGW-----NITETWDKDNFMDVLKTVSGPYRAQPFFTVGVSVDPKNSNSNVIQVDQSGLFLPSRDYYLNKT---NEKVLKAYLDYMVELGLLLGGDKNSTQNQMQQILDFETALANITVPQDERRDEEKIYHKITIAELQ-TLAPAVEWLDYLSSVLSPLELNDTE--PVVVYAKEYLQQVSELINK--TDRNLLNNYMIWNLVQKGASSLDQRFENAQDKLLESLYGTKKSCTPRWQTCIGNTDDTLGFALGALFVNATFDKHSKEIAEGMINEIRTAFQDALDHLNWMDDQTRKAAKEKADDIYDMIGYPDFILDPKELDDVYDGYDVSEDNFFQNMLNFYNFSARVMADQLRKPPNKDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYARDHPKALNFGGIGVVMGHELTHAFDDQGREYDKTGNLRPWWQNSSVDAFKNRTECMVDQYTQYTINGEHINGKQTLGENIADNGGLKAAYHAYRSWVKTNGEEKSLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPKYRVIGTLSNSPDFSQHFNCPLGSPMNSGHRCEVW 786          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Cavefish
Match: ece2b (endothelin-converting enzyme 2 [Source:NCBI gene;Acc:103045399])

HSP 1 Score: 430.639 bits (1106), Expect = 3.150e-138
Identity = 243/689 (35.27%), Postives = 376/689 (54.57%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDK---WDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFE-QFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S CLT +C+  A +I +SL+ +V+PC DF Q+ CG W  +  LP G SR+STF+ +      + K LLEN  F ++S    KA   Y SCLN  RI  LGA PLV  + +T    GGW     ++  T DK    D+ K +  P    P   + V  D KNS+ N++ +  S L +  R +  N+T   N+K+L  + DYM ++G LL   K   + Q  +IL  E  +A     ++++RD E  Y+K+T++E+Q        W + +   +  + +  ++   ++V     L  + EL     + + +L+NY++W  V +  + L + F+  +DK     YG     ++ E  ++ ++      L ++                                 WMDDQTR  A EK D ++ +IGY D IL+   L++ +   ++++  +F+N+    N +     ++L K P       TP  VNA+Y P KN I+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD  G+LR WW + +   FK +++C V QY++Y+I+G  ING+ TLGENIADNGG++  Y  Y+   K  G+EK LP +N T+DQLFF+ FA++WC+++T +S    ++++ H+P  YRVIGTLSN  +F++ FNCP GS MN   +C VW
Sbjct:   93 SLCLTEACVTVASKIVESLDRTVDPCQDFYQYACGGWIRKNPLPDGRSRWSTFNSIWDQNQAVLKHLLENGTFNSSSEAEKKAQFYYLSCLNEQRIEELGAQPLVDLIAKT----GGW-----NITETWDKDNFMDVLKTVSGPYRAQPFFTVGVSVDPKNSNSNVIQVDQSGLFLPSRDYYLNKT---NEKVLKAYLDYMVELGLLLGGDKNSTQNQMQQILDFETALANITVPQDERRDEEKIYHKITIAELQ-TLAPAVEWLDYLSSVLSPLELNDTE--PVVVYAKEYLQQVSELINK--TDRNLLNNYMIWNLVQKGASSLDQRFENAQDKLLESLYGT----KKAEGMINEIRTAFQDALDHLN--------------------------------WMDDQTRKAAKEKADDIYDMIGYPDFILDPKELDDVYDGYDVSEDNFFQNMLNFYNFSARVMADQLRKPPNKDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYARDHPKALNFGGIGVVMGHELTHAFDDQGREYDKTGNLRPWWQNSSVDAFKNRTECMVDQYTQYTINGEHINGKQTLGENIADNGGLKAAYHAYRSWVKTNGEEKSLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPKYRVIGTLSNSPDFSQHFNCPLGSPMNSGHRCEVW 728          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Cavefish
Match: mmel1 (membrane metalloendopeptidase like 1 [Source:NCBI gene;Acc:103025396])

HSP 1 Score: 415.616 bits (1067), Expect = 6.354e-132
Identity = 233/703 (33.14%), Postives = 393/703 (55.90%), Query Frame = 1
Query:  541 SPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDK-WDLAKVIEDPMV---ETPIIRIIVQEDEKNSSRNILNL-QLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRK-------EKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKY-CQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILN--VTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENST--IDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYS---IHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            S C T  C+ AA  + ++++ SV+PC +F Q+ CG W    ++P+ SS +S F+++  +L  + K +LE  E + +   + KA  LY SC+N   I    + PL+  ++    + G W + + D N T ++ W L + +        +  ++ + V  D+++SSR+I+++ Q S  +  R +  N+     KK+ + +  +M  + K+ +  +         +++  ++++LE EIA      E++ D    YNKMTL E+Q  +    FNWT  ++  M+ V+I ++ +  I+V     L  +  +   Y   +R + NY++W  + +R++ LS  F+ ++  +R+  +G    + RW  CV  VQ +M   +G +Y++  F  +SK  V E+I  +++ F   +    WMDDQ++  A EK   +   IGY D IL      L++ +  +  ++++YFENI         +  +KL + P +    I     VNAFYS N+N+I+FPAGILQ PFF     ++L +GGIG  +GHEI HGFDD G  +D  G++  WW++ + + F+ +S C V+QY K++     G +++G  TLGENIADNGGVR  Y+ Y    ++ G+E  LPGL+  H QLFF+ FA++WC     +  I  I ++ H+P  YRV+G+L NF+ F+EAF+C +G+ MNP +KC VW
Sbjct:   73 SVCTTPDCVTAAARLLQNMDPSVDPCQNFYQYACGGWLERHVIPETSSLHSVFNILRDELEIVLKGILET-ESERDRQAFKKAKMLYRSCMNESVIEQRDSQPLLKLID----SIGDWPVASEDWNSTAEETWRLDETLATLNAHYNKKVLLEMFVWPDDRDSSRHIIHIDQPSLGMPSRDYYLNDGN--YKKVREAYLQFMVSMAKIAREDRNLTQDDEHVWDEVKQVMELEREIANATSPAEERNDITVLYNKMTLRELQDTFGLDGFNWTRYIQGIMESVSIVVNPEEPIVVYCSPYLDKLNNILPRY--DRRTVQNYLVWMLLMERVSSLSRRFKDVRAHYRKALHGTTVEEARWRDCVRYVQSNMENAVGALYVRETFAGESKRMVGELIRKIQEAFVETVEELNWMDDQSKEKAREKAMAISEQIGYPDYILQEETQKLDQEYTHLNFSEESYFENILQNLQATAQKGHKKL-REPVDPDLWIIGAAVVNAFYSHNRNQIVFPAGILQPPFFSEKQLQALNFGGIGMVIGHEITHGFDDHGRNFDKDGNMYNWWSNYSTEHFEEQSKCMVQQYGKFTWKLAGGQNVSGITTLGENIADNGGVRQAYKAYMKWIEREGEESYLPGLDLDHKQLFFLNFAQVWCGACRPEYAIQSIKTDPHSPLEYRVLGSLQNFEAFSEAFHCQRGAPMNPEEKCRVW 765          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Sea Lamprey
Match: mmel1 (membrane metallo-endopeptidase-like 1 [Source:ZFIN;Acc:ZDB-GENE-101112-2])

HSP 1 Score: 381.719 bits (979), Expect = 1.786e-120
Identity = 237/709 (33.43%), Postives = 375/709 (52.89%), Query Frame = 1
Query:  529 RELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLD-KWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNL-QLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF---------EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYC-QQFNWTEIVRRRMKLVNITMSKDIE----IIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSIL--NVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPE-NSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYS---IHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            R   + CL  + +  A  I ++++ S +PC DF ++ CG W  + I+P+ SSRY  FD++  +L  + K +LE  +       Y K+  LY SC++ ++I +L + PL+  L    G    W + T + N T + + +LA + +   V  PI+   V  D+KNS+  I+N+ Q  + L  R +  +ET+    K  + +KD++  +  +  +R++K          EQ   +   E ++A+    +E++ D    Y+KM+LSE+   Y    F+W       MK + I + KDI     I+V  P  L+ +  + +        + NY++W    + +  LS+ F+  + +FR+  YG    K RW  C S V   +S  +G +Y++  F   SK  V E++  +++ F +NL    WMDD T+  A +K   +   IGY + I+  N   ++E + D+  +   YF N          R   ++N   + N  I     VNAFYS + N+I+FPAGILQ PFF      SL +GGIG  +GHEIIHGFDD+G  +D  G+L  WW+  + + FK KS C + QY  +      G +++G NTLGENIADNGG+R  Y+ Y    K  G+E  LPGL+ +H QLFF+ FA++WC     +     I ++ H+P  +RVIG+L NF++F+EA+ C     MNP  KC VW
Sbjct:   15 RSGSACCLLNNLVFLAARILENMDPSADPCKDFYKYACGGWLKKNIIPETSSRYGVFDILRDELEVVLKAVLEKSDDAARDA-YKKSRTLYASCIDQEKIEALNSQPLLQLL----GNVNEWPIATVNWNTTQEYQKNLANLAKKYRVR-PIVNTYVGIDDKNSTAYIINIDQPGFGLPSRDYYFSETE-SYVKAREAYKDFIVAIANI--VRRDKAIPDDDVFVREQMEGLFNFEKKLAEASTPDENRTDITLIYHKMSLSELSTNYSIGNFSWLTY----MKDIFIDI-KDISSAENIVVYAPEYLIKLKTILED--ETPSTIQNYIVWMLTVEHVESLSQKFKDARAEFRKALYGTTSDKARWRSCSSYVNNILSNAVGALYVEEAFAGDSKKVVQELVKWIREVFISNLDKITWMDDATKGRARDKAFAIVERIGYPEFIVDKNDPKIDEEYADLAYSTTEYFANTLASLAFDSKRRLARINTAVDKNEWISGAAVVNAFYSSSYNQIVFPAGILQPPFFGLDQAMSLNFGGIGMVIGHEIIHGFDDSGRNFDKDGNLVDWWSAESAKNFKQKSQCIIDQYGNFQWDLAGGQNLSGINTLGENIADNGGIRQAYEAYMAWVKDNGEELPLPGLHLSHQQLFFLNFAQVWCGDYRPEYASNSIKTDVHSPGKFRVIGSLQNFEKFSEAYQCKASDAMNPRSKCHVW 707          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Sea Lamprey
Match: ecel1 (endothelin converting enzyme-like 1 [Source:ZFIN;Acc:ZDB-GENE-130530-692])

HSP 1 Score: 313.153 bits (801), Expect = 7.367e-97
Identity = 170/510 (33.33%), Postives = 290/510 (56.86%), Query Frame = 1
Query: 1093 ENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEED--QRDPESTYNKMTLSEIQ--GKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENI----DMLTNRAMYRNFEKLNKRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHY---RVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            E+ K++  +K  M  +  LL  R  +  +  ++ + E ++A     E D  +RD  + YNKM L ++        Q NW + +    ++    +S+D E++V   T +  +  L  +  +  R+LHNY+LWR V      LS  F+     F R   G     +    C++    +  ++LG ++++ +F+  SK +V +M+  +K  F   L    WMD++T+  A  K   M  +IGY + +  +  +++ +   E+N+++YF+NI    +   N ++++  +K+ +   N  +  PQ +NA+Y P  N+++FPAGILQ   ++P FP+S+ YGGIGT +GHE+ HG+DD G +YD  G+L+ WWT  +   F  +++C VK Y+ ++I+  ++NG+ TLGENIAD GG++L Y  Y+   ++ G E  L G+ YTH+QLFF+ FA+ WC  +  QS+ + +L++ H+P +Y   RV+G+ S F EF   F+C +GS M+P  KC VW
Sbjct:   20 ESLKVIKAYKVLMNKITTLLGARNAR-HKLEDVFEFEQQLANITLSESDPLRRDINNMYNKMKLRDLHHLAPAHDQINWRQFLE---QIFRKRISEDEEVVVLATTYIKKLSHLLST--TPVRVLHNYMLWRVVIVLSTHLSPPFRAALHDFSREVDGAEKEVDLERLCLAQANKYFGMVLGALFVREHFSLHSKQRVQQMVEDIKHAFDQRLEELGWMDEKTKDAARGKFQLMMDMIGYPEFLGRMDEVDKEY-GFEVNEKSYFKNILNSIEFNINVSIHKIHQKVER---NVWLLPPQTLNAYYLPTHNQMVFPAGILQPTLYDPEFPQSMNYGGIGTIIGHELTHGYDDWGGQYDRHGNLKQWWTAESYGKFLERTECVVKLYNNFTINKQNVNGKLTLGENIADMGGLKLAYHAYQKWVRENGPEPPLQGMAYTHEQLFFVAFAQNWCMKRRPQSLYLQLLTDKHSPENYSRRRVLGSASQFDEFGRVFHCRRGSPMSPQHKCSVW 519          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Sea Lamprey
Match: mmel1 (membrane metallo-endopeptidase-like 1 [Source:ZFIN;Acc:ZDB-GENE-101112-2])

HSP 1 Score: 292.738 bits (748), Expect = 1.514e-88
Identity = 182/571 (31.87%), Postives = 293/571 (51.31%), Query Frame = 1
Query:  574 AVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTL-DKWDLAKVIE---DPMVETPIIRIIVQEDEKNSSRNILNL-QLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-------EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKY-CQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSIL--NVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTIDT-PQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYS 2238
            A  + + +N + NPC +F +F CG W  +Q++P+ S  Y TF V++  L  + K+LLE      +    +KA +LY SC++ + I    + PL+  L         W + T D N T   +W L +V+           II + +  D  +S  + + + Q S  L  R F  +  K    ++ D +   M  V  +++  K          EQ   + +LE+EIA+     E++ D    +N+MTL ++Q ++    FNWT  +   +K V+I +    EI+V+ P  L  + ++  S+      +HNYV+W  + + I  LS  +Q    + +++ YGV+  + RW HCV  V   +   +G +Y+ + F +  K +V  MI  L++ F + L    WMDD+TR+ A EK   +   +GY D I+  N   L+E + D+   +  +FEN       A+    ++L +       D  P  +NAFY P+KN+I+FPAGILQ PFF  G   SL +GGIG  +GHEI HGFD+ G K+D +G+L  WWT  + + F ++S C V QYS Y+
Sbjct:    1 ATRLLEGMNPAANPCDNFYEFACGGWPKKQVIPEDSGYYGTFHVLDDHLEIVLKRLLEEAAGSGDRDAVTKAKRLYLSCMDEEAIEERDSEPLLWLLEDVLE----WPVATVDWNSTYGSQWRLEEVLAFMTSRYGNRVIIDVGIASDVNDSKSSAIYIDQPSLGLPTRDFYFD--KGYYSQVRDTYLRAMIAVATIIRADKNITDDIDFVQEQMEGVFRLEMEIAEAITPAENRTDVTKLFNRMTLLQLQQEFPLNGFNWTLFINEVLKTVDIEVEASEEILVSAPEYLEQLSDILNSHPPSD--VHNYVVWILITEVIGSLSHKYQEAIAETQKMLYGVLLARARWRHCVDYVNTALPSAVGALYVLDAFPRHGKTKVEMMIERLREAFIHTLDEMTWMDDRTRARAREKALAITTQMGYADYIVDGNNPRLDEEYADLNYEEDVHFENTLQDLEFAVKNELKRLRRTTSKQEWDIGPATINAFYHPSKNQIVFPAGILQPPFFGLGQAMSLNFGGIGMVIGHEITHGFDNFGRKFDKEGNLVDWWTAESDEDFDSRSRCLVSQYSSYT 563          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Sea Lamprey
Match: mmel1 (membrane metallo-endopeptidase-like 1 [Source:ZFIN;Acc:ZDB-GENE-101112-2])

HSP 1 Score: 291.967 bits (746), Expect = 2.681e-88
Identity = 183/576 (31.77%), Postives = 294/576 (51.04%), Query Frame = 1
Query:  574 AVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTL-DKWDLAKVIE---DPMVETPIIRIIVQEDEKNSSRNILNL-QLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKF-------EQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYC------QQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSIL--NVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTIDT-PQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYS 2238
            A  + + +N + NPC +F +F CG W  +Q++P+ S  Y TF V++  L  + K+LLE      +    +KA +LY SC++ + I    + PL+  L         W + T D N T   +W L +V+           II + +  D  +S  + + + Q S  L  R F  +  K    ++ D +   M  V  +++  K          EQ   + +LE+EIA+     E++ D    +N+MTL ++Q ++       Q FNWT  +   +K V+I +    EI+V+ P  L  + ++  S+      +HNYV+W  + + I  LS  +Q    + +++ YGV+  + RW HCV  V   +   +G +Y+ + F +  K +V  MI  L++ F + L    WMDD+TR+ A EK   +   +GY D I+  N   L+E + D+   +  +FEN       A+    ++L +       D  P  +NAFY P+KN+I+FPAGILQ PFF  G   SL +GGIG  +GHEI HGFD+ G K+D +G+L  WWT  + + F ++S C V QYS Y+
Sbjct:    1 ATRLLEGMNPAANPCDNFYEFACGGWPKKQVIPEDSGYYGTFHVLDDHLEIVLKRLLEEAAGSGDRDAVTKAKRLYLSCMDEEAIEERDSEPLLWLLEDVLE----WPVATVDWNSTYGSQWRLEEVLAFMTSRYGNRVIIDVGIASDVNDSKSSAIYIDQPSLGLPTRDFYFD--KGYYSQVRDTYLRAMIAVATIIRADKNITDDIDFVQEQMEGVFRLEMEIAEAITPAENRTDVTKLFNRMTLLQLQQEFPLNKLREQGFNWTLFINEVLKTVDIEVEASEEILVSAPEYLEQLSDILNSHPPSD--VHNYVVWILITEVIGSLSHKYQEAIAETQKMLYGVLLARARWRHCVDYVNTALPSAVGALYVLDAFPRHGKTKVEMMIERLREAFIHTLDEMTWMDDRTRARAREKALAITTQMGYADYIVDGNNPRLDEEYADLNYEEDVHFENTLQDLEFAVKNELKRLRRTTSKQEWDIGPATINAFYHPSKNQIVFPAGILQPPFFGLGQAMSLNFGGIGMVIGHEITHGFDNFGRKFDKEGNLVDWWTAESDEDFDSRSRCLVSQYSSYT 568          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004622.1 (pep scaffold:Pmarinus_7.0:GL480748:697:25272:-1 gene:ENSPMAG00000004207.1 transcript:ENSPMAT00000004622.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.172 bits (570), Expect = 3.363e-65
Identity = 135/384 (35.16%), Postives = 207/384 (53.91%), Query Frame = 1
Query: 1438 SKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTK-ERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFE---NIDMLTNRAMYRNF--EKLNKRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDD-TGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSI---IIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSG 2559
            S  + L NY LW  + + I  L   F++              +   RWE C+ +    ++  LG ++       + K  V +MI+ LK  F++NL    WMD++TR  A EK   +   +G  D + +V+ ++  +++ ++ +  +FE   N    T+R   R+     +  R    T+D       +Y  + N +  PAGI+Q PF++  +P  LKY GIGT +GHE+ HGFD+  GS+Y+ +G    WW + T   FK ++ C   QYS Y+     ING  TLGENIADNGG+      Y   E+++GKE+ LP LN T+ Q FF+ FA+LWC+++ K+S+   I D LS++H+P   RV G +SN   FAEAF CP G+ 
Sbjct:   46 SDPKTLTNYALWMLIQKMIPILDYRFRKAALIMAEAIDETTESPVRRWEFCMDLADKSLAYALGEIFAMKEITAKRKEDVKKMIDNLKHAFKDNLDHLPWMDNKTRLAAKEKAKNIQSAVGEDDYMEDVSNVDMFYENFKVVEGRFFETMVNFYNYTSRRTIRSMLATSMQWRAPAQTVDA-----FYYYESLNTMYIPAGIMQEPFYQDVYPMFLKYAGIGTVIGHELCHGFDNKAGSEYNVEGKQENWWENTTHNEFKLRTHCMEVQYSNYTWKERPINGTQTLGENIADNGGLHTALLAYARWEEQHGKEEPLPYLNLTNKQAFFVWFAQLWCSME-KESVEVEIEDALSDSHSPAAVRVRGMVSNSPAFAEAFTCPMGAA 423          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Nematostella
Match: EDO41501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4D9])

HSP 1 Score: 404.06 bits (1037), Expect = 1.201e-128
Identity = 233/718 (32.45%), Postives = 383/718 (53.34%), Query Frame = 1
Query:  499 GTRRVISNQ------------NRELDSP-CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIE--DPMVETPIIRIIVQEDEKNSSRNILNLQLSWL-LMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQ---FNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHAL-EKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
             TRRV++ Q             R   +P C T  C+ AA  I   ++ +VNPC DF Q+ CGKW  + ++P G+S++S F  V     +  KK+ +  +F +N  I+ K    Y SC N   I    A PL     +     G W  +T     T + W+  + +     +  TP+  + V  D+KNSS+NI+ +Q + + L +R++    T+ E+ K++  +K++M  +  LL             +EI + E ++A+ Y  +E  R  +  Y+KMT+ ++Q +      W + +     L +  +  D  ++V  PT L  + +L     + +RIL NY++W  +      LS+ ++       RV  GV      W+ CV+     +    G++Y+K +  K  K +  ++I  +K+ F +NL +  WMD+ T++ A  EK++++  LIGY D I++V  L   + ++ I  +  FEN          +  EK  K  +      TP +VNA+YS   N I FP+GILQ PFF+P FP+++ YG +G  MGHE+ HGFD  G  +D  G+L  WW +++ + F+    C V+QYS +++    ++G+ TL ENIADNGG+RL +Q ++  +K+  K+  LPGL  + DQLFF+ FA+LWC+  TK S+   +L+++H+P+  RV   +SN ++FAEA++CP  + MNP  KC VW
Sbjct:    7 ATRRVLALQIVSHSNTITSVPYRSYQNPICETKGCISAAFSILNKMDETVNPCRDFYQYACGKWLKDSVVPAGNSKWSAFHQVAEQNLRTLKKIFDRDDFASNGDIFRKVRDYYSSCTNKSIIEERDAAPL----KKLISDVGSWS-VTGGHTWTAETWNFEQALSLMHKLKSTPLFYMFVAADDKNSSQNIIQIQQAGITLSDREYY---TRNESDKVVKKYKEFMVKIATLLNGATADSTTGILMDEIFQFEKKLAEIYEPKERLRHSDKIYHKMTVEDLQ-QLAPAIPWMDYMN---NLFSTPVGHDEPVVVYTPTFLKSMSDLV--IRTDRRILANYMVWHLIKPLTTELSKPYREAALDLMRVEMGVESGAPTWKSCVTKTDTVLGYATGHLYVKQHDGKDVKEKAKQVIQSIKEAFISNLPTVTWMDEGTKTKARGEKMESVLDLIGYPDWIMDVAQLNAYYVNLVITPEMSFENHLNARRFVHQQTMEKRGKAVDRKEWHMTPVDVNAYYSLPNNYIAFPSGILQRPFFDPEFPQAMNYGAVGMVMGHELTHGFDSKGRLFDKNGNLESWWKNQSVEAFEEHVSCMVEQYSNFTVADVKVDGKQTLDENIADNGGLRLAFQAHRQWDKENEKQPRLPGLELSRDQLFFLGFAQLWCSSSTKNSMHHPLLTDSHSPDRIRVHAAVSNSEQFAEAYDCPLDTPMNPAKKCRVW 710          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Nematostella
Match: EDO35107 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMH5])

HSP 1 Score: 395.586 bits (1015), Expect = 7.457e-126
Identity = 240/690 (34.78%), Postives = 376/690 (54.49%), Query Frame = 1
Query:  589 KSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPE----FKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAK---VIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQ----------FNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMY--RNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEK--KYGKEKLLPGL-NYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            KS+NT+++PC DF Q+ CG W+++ ++P   S +S F +++    ++ KKL+ + +    +K N  +  KA   YD+C++   I  LG  PL   +      +G W  +TN  N T   WD  K   +I+  +   P   + V  D K+S++ ++    S  ++ R+ +   T   + KI   ++  M  + + L    E   +  E+ +LE+E+AK       QR   S  +   LS+++     +           N T+ +     L +  + +D E++V     ++++  +F +  + KRI+ NY++W   Y   + LS++F+ +  ++R    G  G   RW+ C S V     + +G +++   F K+SK     MI  ++  F +NL +  WMD++TR  A EK + +   IGY D I N T LE  +  + ++   YF N      R  Y  +N ++L K  + +     P  VNA+YS   N+I+FPAGILQ+PF+E   P SL YGGIG  +GHEI HGFDD G K++  G+L  WWT+ + + FK K+DC VKQYS Y  HG  +NG  TLGENIADNGG++ ++Q Y+  +K     +EK LPGL   +HDQLFF++FA++WC+    ++ I  I +  H+P   RVIG+LSN  EFAEA+ CP GS MNP DKC VW
Sbjct:    2 KSMNTTIDPCDDFYQYACGGWETKNLIPDTRSSWSQFRILSNRNEELLKKLINSKDIRDKYKDNPAVM-KAFDYYDACMDEKLIEKLGQQPLQDLIK----MFGSWN-VTNK-NWTEADWDFMKTFVMIQRDLSIAPWFNMFVGTDLKDSTKTVIVFDQSGTILSREAMLFNTT-YHAKIRTAYRRIMTSLMEKLGAGNEAEARMEEVYQLELELAKV-----KQRIQPSLIH--LLSKVRQNNQPRTLKLAPPPSFLNLTDFLGHIFNLTDYNVKQDTEVVVYAMEYMVNMSRIFAN--TPKRIVANYMMWHVAYFFASSLSKEFRDLYYEYREAITGTRGEDPRWQDCTSGVSGTFGMAIGLLFVDQTFKKESKTSAERMIKDIRNVFIDNLQNLNWMDEKTRKVAKEKAEAIRENIGYPDFIKNKTALELEYSGVRVDKTKYFWN--QYERRKFYNQKNIDELGKPVDKTKWSMNPPTVNAYYSSTDNKIVFPAGILQDPFYEGDHPNSLNYGGIGMVVGHEITHGFDDNGRKFNKDGNLLTWWTNNSIEAFKKKTDCLVKQYSSYEFHGKKLNGLQTLGENIADNGGIKQSFQAYQKWKKDNNVEEEKRLPGLEKLSHDQLFFLSFAQIWCSAYRPEAAIRAIENGVHSPGKLRVIGSLSNSNEFAEAWKCPVGSRMNPKDKCAVW 672          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Nematostella
Match: EDO49850 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REV1])

HSP 1 Score: 385.185 bits (988), Expect = 1.916e-121
Identity = 214/686 (31.20%), Postives = 364/686 (53.06%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAK---VIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWL-LMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            C + SC+Q + ++ +S++ +VNPC DF  + CG W  + I P  + ++  F  +  +   +  KL+ + + +    +Y KA+  YDSC++   I  LG  PL   +      +G W ++    N T   WD           +  +P++ + V  D KNSS N++NL  S+  +  R F +N +    +K+   +K+ M ++   L        +  +I K E ++A      E   +    Y KM++ ++Q     Q +W   +    + V+  + ++ E++V     L+ + ++ +   + K+ L NY++WR V  +   LS+++++I   F    +       R E C+S +  +  + L  MY+   F  +SK    E++  ++  F   L    WMD+ T+  A EK + +   IGY D +++  +L   +K++ ++ +TYF N   +      RN+ KL K  + +     P  +NA+YS N+N+++FPA +LQ PF+   +PR++ YGGIGT M HE+ HGFD TG  Y+  G+   WWTD+T Q F  KS C V+QY  ++ HG  ++G+ TL ENIADNGGV+  ++ Y+    ++G E  LPG+  T++Q+FF  FAR WC + + ++  + +  + H P  +RV G+L NFK+FAE F CP GS MNP  +C VW
Sbjct:   50 CWSPSCIQTSADLLRSIDPNVNPCDDFYGYACGGWIKKNIRPAKNPKWDQFSKLTEENNALMNKLINSRQIR---ALYGKALHFYDSCMDKAEIERLGGEPLTKLIKE----FGSWAVIDKSWNET--NWDFMTSFITAHRELAVSPLVSVWVDFDIKNSSVNVINLDQSYPGISHRAFTRNSST--YRKMRHAYKELMVNLTMTLGGDSHSLREMEDIYKFEKKLANIL---EPYVEGNKKYRKMSIRKLQNATGPQIDWMRFLTGVFRGVDYKIMEEEEVVVYAYDYLVKLAKILEK--TPKKTLANYIMWRVVKIQYVQLSKEYRKIFKNFYIRAFNFWRESPREEVCLSALSENFGMPLSKMYLDRRFKGKSKKLATEIVENIRDVFIARLKDITWMDNVTKHVAEEKAEYLLENIGYPDYVMDSKHLASLYKEVPVDPKTYFLNQVYVRRNDNLRNYAKLGKPFDKTEWPFPPTMLNAYYSYNENKMVFPAAMLQAPFYYASYPRAVNYGGIGTIMAHELTHGFDVTGKDYNKYGNNIKWWTDKTIQNFYNKSQCLVEQYGNFTFHGGLVDGKLTLSENIADNGGVKQAFEAYQSWVSRHGPEPRLPGMMLTNEQIFFFAFARNWCGMFSPEAGKLSLKWDEHAPMPWRVNGSLKNFKKFAEHFKCPVGSPMNPEKRCAVW 719          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Nematostella
Match: EDO41736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3J6])

HSP 1 Score: 368.622 bits (945), Expect = 1.805e-115
Identity = 239/707 (33.80%), Postives = 381/707 (53.89%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKL----YDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVI-----EDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQF-NEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFK---DIEINDQTYFENIDMLTNRAMYRNFEKLNK--RPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEP-GFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRV--WWTDRTRQLFKTKSDCFVKQYSKYSIHG-HSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKL-LPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW*NSQML 2607
            C T  C   A  I  S++ SV+PC DF QFVCG W  +  +P+ SS YSTF  +NT + K  + +LE        G   K +++    Y+SC++L  I+ LG  P+   +       G W +    +      WDL++ +     +      P+  + V +D   ++R+I+ +  +   + R     E   ++ KI+  +K Y+ DVG LL+  KE  E++  EI+ LE ++A     + D+   E+ +N+MT+ ++  K    ++W + + +      I  S+  +IIV     L  + +L ++  + KR+L NYV+W  +   ++FLS+ ++ ++ ++R    G  G K+RW+ CV      +  +LG  YI+++F++ SK    +MI  ++Q F++N+ S  WMD  T+    EK D+M   +GY   +       + FK    + + +   F N   +   A  R  +KL K    E   +D PQ +NA YS N+NE+I PA ILQ PFF P G P SL +G IG+ +GHE+ HGFD+TG K++  G+L    WW+D + + F  K+ C   QYS+Y + G + +NG+ TLGENIADNGG + +Y+ Y +  KK G E   LPGLN T +QLF++ F + +C+        +  LS+ H+   +RVIGTLSN  EF++AF C   + MNP  KC VW N  +L
Sbjct:    2 CHTKDCYSVARHINDSIDFSVSPCTDFYQFVCGGWMQKNPIPRSSSTYSTFTKLNTKVEKSLRGILEE-GISAIPGASKKLMRMPSDVYESCMDLGTIDKLGDQPIRDMIKEI----GSWSLEKGWVE---KDWDLSETLLYIHKKYTSAGGPLFSVHVSDDPIKNTRHIIEIDQAGPSLSR-----EVYTDSPKIIKAYKKYIIDVGTLLR-GKEAMEKYAQEIIDLETKLANISVPDADKT--ETWFNRMTIKDLM-KEAPGYDWLDHLNKMFAPEKIKDSE--QIIVPALPYLKKMIKLIEN--TPKRVLSNYVVWNVIQDEVSFLSKPYRDVRLRYRERVLGSKGHKKRWKTCVMYTNELVGDVLGAAYIQHHFDQHSKNIARDMIKEVRQAFKDNVNSIPWMDKTTKIAVSEKADSMKDEVGYPAYLKGGKKFIKRFKKYKGVTMKNNALFANRIAILKMAHKRMLKKLRKPVDKEEWPMD-PQTINAMYSFNENEMIIPAAILQPPFFYPKGSPSSLSFGAIGSILGHEMTHGFDNTGRKFNKNGELTTSNWWSDGSLKGFDEKAKCIENQYSQYKVDGKYPLNGKLTLGENIADNGGFKSSYRAYHNWLKKKGDETWSLPGLNLTSEQLFYVGFGQAYCSNSRSTEQYLATLSDRHSEEKFRVIGTLSNSYEFSKAFGCRPEAPMNPVTKCSVWSNDGLL 686          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Nematostella
Match: EDO49684 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFZ0])

HSP 1 Score: 360.918 bits (925), Expect = 1.026e-112
Identity = 225/694 (32.42%), Postives = 367/694 (52.88%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEF----KTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWD----LAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLD-ICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTIDT-PQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDL-RVWWTDRTRQLFKTKSDCFVKQYSKYSIHG-HSINGENTLGENIADNGGVRLTYQVYKDLEKKYG-KEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            C    C Q A  IR +++T   PC DF +F CG W  +  +P+  + +STF  V+ D+    ++LLE P +      N  +  KA   Y SC++   I  LG  PL+  + +     G W  L ND +   +KWD    L K+       +P   + V  D  NS+R+++ +  S L ++R+       PE   ++D + +YM  V  LL I+    ++  +I+  E ++A      ED+ D    Y ++ L  +  K    F W + ++   +  ++T   D ++++  P+  L  + ++ K   + K +L NYV+W+ +  +I+ LS+ F++ +  F     GV   + RW  C SI   ++ + LG +Y++  FN+ +  ++  MI  +K  F+  +  + W+DD+T  +  +K D +   IGY + +L    L++ FK ++I  +T+F N   +     +R   KL K  +       PQ +NA Y   +NEI    G L+  F       SL YG +G+ +GHE+ HGFD+TG K+D  GD+ + WW+  +   FK ++ C   QYSK+ I   + ++G  TL ENIADNGG +L+Y  Y    K  G +E++LPGL YT++QLFFI +A+ +C+    ++  I  LS+ H+P  +RVIGTLSN +EF++AF CP GS MNP  KC VW
Sbjct:    2 CQEPECQQIATLIRDAIDTDTPPCKDFFKFSCGNWVRKHPIPRSYNDFSTFTKVSKDIEDQLRELLETPSYIETLPENQAL-RKAKDFYRSCMDTKTIERLGTRPLMKLIRQ----LGSWS-LCNDKSWNKEKWDAYDVLRKLQSTYYPASPFFSVEVTNDHLNSTRHLIKVDQSGLSLQREIYFKH--PE---MVDTYVEYMAKVATLLGIKGNATKEMRKIVDFETKLANITTSAEDKAD--GIYRRIKLHHLI-KLVPGFPWLKHMQAIFRGAHVT---DADVVLATPSTYLSKMNDIIKE--TPKELLSNYVVWQMIRDKISLLSKPFRKARAVFNHKISGVKEQEPRWRTCTSITNDNLGVPLGTLYVRKYFNESTVGKIQLMIQEIKDTFKERVKEHEWIDDKTTQYVFQKADALRSKIGYANYVLRPIILKKRFKSLKIGKKTFFSNNVNVDKWVRHRLVGKLRKAVDKEKWPMFPQTINAMYQFYENEIGGGRGCLRRVFLALALALSLSYGAVGSIIGHEMTHGFDNTGRKFDKNGDIVQEWWSKSSLTNFKNRAQCIADQYSKFKIQNKYPLSGVVTLDENIADNGGTKLSYNAYHRWLKDNGNQEQVLPGLKYTNEQLFFIGYAQEYCSHARPKTEYIASLSDIHSPPKFRVIGTLSNMEEFSDAFKCPPGSPMNPKKKCEVW 676          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Medaka
Match: ece2b (endothelin-converting enzyme 2 [Source:NCBI gene;Acc:101164289])

HSP 1 Score: 463.766 bits (1192), Expect = 2.282e-150
Identity = 249/705 (35.32%), Postives = 395/705 (56.03%), Query Frame = 1
Query:  508 RVISNQNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWD------LAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEK-FEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLD-ICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTID-TPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            R  S+  R L   CL+ +C+  A +I ++++ SV+PC DF QF CG W  +  LP G SR+STF+ +      + K LLEN  F  +S    K    Y SCLN  RI  LGA PL+  + +     GGW M           WD      + KV+  P    P   + V  D KNS+ N++ +  S L +  R +  N+T   N+K+L  + DYM ++G LL   K     Q  +IL+ E  +A     ++ +RD E  Y+K+T++E+Q       +W E +   +  + +    D E +V      L  + EL     + + +L+NY++W  V + +  L + F+  +D+     YG   +   RW+ C+      +   LG +++K  F+K SK    EMIN ++  F+  L    WMD+QTR  A EK D+++ +IG+ + IL+   L++ +   E++D ++F+N+    N +     ++L K P       TP  VNA+Y P KN I+FPAGILQ PF+    P++L +GGIG  MGHE+ H FDD G +YD +G+LR WW + + + F+ +++C ++QY++Y+++G  +NG+ TLGENIADNGG++  Y  Y+   ++ G+EK LP +N T+DQLFF+ FA++WC+++T +S    ++++ H+P  YRVIGTL+N  +F+  F CP+G+ MN    C VW
Sbjct:   82 RFSSDSGRGL---CLSEACITVASQIVEAMDRSVDPCQDFYQFACGGWMRKNPLPDGRSRWSTFNSIWGQNQALLKHLLENGTFNGSSEAERKTQSYYLSCLNTQRIEELGAQPLIDLITKI----GGWNMT--------GPWDKDNFMEVLKVVSGPYRAQPFFSVGVSADPKNSNSNVVQVDQSGLFLPSRDYYLNKTA--NEKVLAAYLDYMVELGMLLGGEKSSTLVQMQQILEFETALANITVPQDQRRDEEKIYHKVTIAELQA-LAPAVDWLEFLTSSLSPLELN---DTEPVVLYAREYLQQVSELINK--TDRSLLNNYMMWTLVQKSVATLDQRFENAQDRLLESLYGTKKSCTPRWQTCIGNTDDTLGFALGALFVKATFDKLSKEIAEEMINEIRSAFKQALDRLSWMDEQTRKAAKEKADSIYDMIGFPEFILDPKELDDVYDGYEVSDDSFFQNMLNFYNFSARVMADQLRKTPNKDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYAHDHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNSSVEAFRVRTECMMEQYNRYTVNGEHVNGKQTLGENIADNGGLKAAYHAYQSWIQRNGQEKRLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPRYRVIGTLANSPDFSRHFGCPEGTPMNSGKPCEVW 763          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Medaka
Match: MME (membrane metalloendopeptidase [Source:NCBI gene;Acc:101170860])

HSP 1 Score: 430.639 bits (1106), Expect = 1.291e-137
Identity = 252/716 (35.20%), Postives = 383/716 (53.49%), Query Frame = 1
Query:  511 VISNQNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFG---AYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNL--QLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNE---------ILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQ-----FNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLN-KRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYS---IHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            +I    ++ D  C T  C Q+A  + +++++SVNPC +F Q+ CG W  + I+P+ SSRYSTFD++  +L  I K +LE       +   +KA  LY SC N   I   G  PL+  L   F    A  GWE        T    D+   + +      ++   V  D+++S+ +I++   Q S  L+ R +    T P   +    ++ +M D+ KL  IR ++  + NE         ++ LE +IA      ED+ +P   YNKM L ++   +  +     F+W+    + M  VNI +S   +II  +P     +  +   Y   KR L NY++WR     +  LS  ++  +  FR+   G       W  C   V  +M   +G +Y++  F+++SK  + EMI  +++ F +N+    WMD +T+  A EK   +   IGY+D+I++  +L   +KD+  N + YFENI         +   KL  K  ++  +     VNAFYS +KN+I+FPAGILQ PFF  G  +SL YGGIG  +GHEI HGFDD G  YD  GDL+ WWT  + + F  +S+C V QYS +S    +G  +NG NTLGENIADNGG+R  YQ Y++  K +G+E  LPG++ +HDQLFF+ FA++WC     +  +  I  + H+P  +RV+G+L NF EFA+AF+C K S M P + C VW
Sbjct:   64 IILFATQKTDEMCTTADCTQSASRLIENMDSSVNPCDNFYQYACGGWLKKNIIPETSSRYSTFDILRDELEVILKGVLEKT-VDGEAAALTKAKTLYKSCTNESLIEQRGGAPLLDMLPDMFEWPIAVDGWE---EKYGATWRLEDVIARLNEKYGTQLLVNFFVGTDDRDSNSHIIHFDQQTSLGLLSRDYYAC-TGPY-AEACRAYEQFMIDLAKL--IRSDRGLKVNETLIREEVARVMDLERDIANATDTPEDRNNPVLLYNKMELGDLNTNFTLEVDSKVFDWSHFTAKIMDAVNINISDSEKIINYSPNYYRRLNLVLAKY--NKRDLQNYMVWRFAMNMVVGLSRAYRDTRKAFRKALSGTTSEAAVWRQCALYVNNNMDNAVGRLYVQEAFSEKSKELMEEMIKDIREVFISNMDDLSWMDAETKKAAEEKARAIRERIGYSDTIMDDEHLNNEYKDLSYNAEKYFENILQNLEYVQKKRLRKLRVKVNKDEWVTGAAVVNAFYSASKNQIVFPAGILQPPFFSKGQAKSLNYGGIGMVIGHEITHGFDDNGRNYDKDGDLKDWWTPDSTRRFLEQSNCIVDQYSNFSWELANGLHLNGNNTLGENIADNGGIRQAYQAYRNHVKDHGEEPPLPGIDLSHDQLFFLNFAQVWCGTHRPEQAVNSIKVDVHSPGKFRVLGSLQNFPEFAKAFSCNKSSYMIPDNVCRVW 769          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Medaka
Match: ece1 (endothelin converting enzyme 1 [Source:NCBI gene;Acc:101158602])

HSP 1 Score: 428.713 bits (1101), Expect = 1.341e-137
Identity = 242/697 (34.72%), Postives = 390/697 (55.95%), Query Frame = 1
Query:  520 NQNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKV---IEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWL-LMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFE-QFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRP-ENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            N +R     CLT  C+  A  +  +L+ SV+PC+DF  F CG W     LP+G SR+  F  +      + K LLEN   K  S    KA + Y +C+N  +I  LGA PL   ++      GGW      LN   DK +  +V   +   +  +P   + V  D KNS+ N++ +  S L L  R +  N+T   N+K L  + +++ ++G LL   +E  +    EI++ E  +A     +E++RD E  Y+KM + +++        W   +    K V +  S+   ++V     L  + +L +   + K +L+NY++ + V + ++ L + FQ  + +F  V YG   +   RW+ CVS     +   LG M++K+ F + SK    EM+  +K  F+++L    WMD +T+  A EK D ++ ++GY + I+N T L++ F D E+  + YF+N+    N +     ++L K P  N    TP  VNA+Y+P KNE++ PAGILQ PF+   +P++L +GGIG  MGHE+ H FDD G +YD  G+LR WW + + + FK ++ C V+QY  YSI+   +NG++TLGENIADNGG++  Y+ Y +  +K G+E +LP L  T+ QLFF+ FA++WC+++T +S    ++++ H+P+ +RVIGT+SN +EF++ F C   + MNP  KC +W
Sbjct:   31 NVHRRHPGSCLTGPCITVAGAVMGALDRSVDPCHDFYNFACGGWVKNNPLPEGKSRWGPFSNLWEHNMLVMKHLLENTTMKGLSKAEEKAQRYYQACMNESKIEELGAKPLQQLISH----LGGWA-----LNGPWDKDNFQEVLRKVSGSLRTSPFFTVFVSTDSKNSNSNVIQVDQSSLGLPSRDYYLNKTA--NEKYLTAYLNFLVELGVLLGGTEEASQTMMTEIVEFETTLANITVPQEERRDEELIYHKMKVEDLK-TLAPAVEWIPYLIEVFKPVPLNQSE--LVVVYAKEYLQKVSDLIEK--TNKSLLNNYMVMKVVRKMVSVLDQRFQDAEQRFLEVMYGTKKSCTPRWKLCVSDTDSALGFALGAMFVKDTFAEDSKDIASEMVGEIKWAFEDSLKDVSWMDAETKKAAKEKADAIYNMVGYPEFIMNATKLDKVFNDFEVVSELYFQNVMQYYNFSARVTADQLRKAPNRNQWSMTPPTVNAYYNPTKNEMVLPAGILQAPFYSRSWPKALNFGGIGVVMGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKRQAQCMVEQYGNYSINQEPLNGKHTLGENIADNGGLKAAYKAYVNWIQKNGEEPMLPALGMTNHQLFFVGFAQVWCSVRTPESSHEGVITDPHSPSRFRVIGTISNSREFSKHFGCRANAPMNPKHKCELW 711          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Medaka
Match: ece1 (endothelin converting enzyme 1 [Source:NCBI gene;Acc:101158602])

HSP 1 Score: 426.017 bits (1094), Expect = 4.582e-136
Identity = 240/688 (34.88%), Postives = 387/688 (56.25%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKV---IEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWL-LMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFE-QFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGT-KERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRP-ENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            CLT  C+  A  +  +L+ SV+PC+DF  F CG W     LP+G SR+  F  +      + K LLEN   K  S    KA + Y +C+N  +I  LGA PL   ++      GGW      LN   DK +  +V   +   +  +P   + V  D KNS+ N++ +  S L L  R +  N+T   N+K L  + +++ ++G LL   +E  +    EI++ E  +A     +E++RD E  Y+KM + +++        W   +    K V +  S+   ++V     L  + +L +   + K +L+NY++ + V + ++ L + FQ  + +F  V YG   +   RW+ CVS     +   LG M++K+ F + SK    EM+  +K  F+++L    WMD +T+  A EK D ++ ++GY + I+N T L++ F D E+  + YF+N+    N +     ++L K P  N    TP  VNA+Y+P KNE++ PAGILQ PF+   +P++L +GGIG  MGHE+ H FDD G +YD  G+LR WW + + + FK ++ C V+QY  YSI+   +NG++TLGENIADNGG++  Y+ Y +  +K G+E +LP L  T+ QLFF+ FA++WC+++T +S    ++++ H+P+ +RVIGT+SN +EF++ F C   + MNP  KC +W
Sbjct:   82 CLTGPCITVAGAVMGALDRSVDPCHDFYNFACGGWVKNNPLPEGKSRWGPFSNLWEHNMLVMKHLLENTTMKGLSKAEEKAQRYYQACMNESKIEELGAKPLQQLISH----LGGWA-----LNGPWDKDNFQEVLRKVSGSLRTSPFFTVFVSTDSKNSNSNVIQVDQSSLGLPSRDYYLNKTA--NEKYLTAYLNFLVELGVLLGGTEEASQTMMTEIVEFETTLANITVPQEERRDEELIYHKMKVEDLK-TLAPAVEWIPYLIEVFKPVPLNQSE--LVVVYAKEYLQKVSDLIEK--TNKSLLNNYMVMKVVRKMVSVLDQRFQDAEQRFLEVMYGTKKSCTPRWKLCVSDTDSALGFALGAMFVKDTFAEDSKDIAEEMVGEIKWAFEDSLKDVSWMDAETKKAAKEKADAIYNMVGYPEFIMNATKLDKVFNDFEVVSELYFQNVMQYYNFSARVTADQLRKAPNRNQWSMTPPTVNAYYNPTKNEMVLPAGILQAPFYSRSWPKALNFGGIGVVMGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKRQAQCMVEQYGNYSINQEPLNGKHTLGENIADNGGLKAAYKAYVNWIQKNGEEPMLPALGMTNHQLFFVGFAQVWCSVRTPESSHEGVITDPHSPSRFRVIGTISNSREFSKHFGCRANAPMNPKHKCELW 753          
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Medaka
Match: mmel1 (membrane metalloendopeptidase like 1 [Source:NCBI gene;Acc:101173139])

HSP 1 Score: 421.394 bits (1082), Expect = 4.414e-134
Identity = 236/705 (33.48%), Postives = 390/705 (55.32%), Query Frame = 1
Query:  535 LDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDK-WDLAK---VIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLM-ERQFLQNETKPENKKILDVFKDYMYDVGK-------LLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYC-QQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVT--YLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENST--IDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYS---IHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            L++ C T  C+ AA  + ++++ SV PC +F ++ CG W    ++P+ SSR+S FD++   L  + K +LE         I  KA  LY+SC+N   I    + PL+  ++    + GGW + + D N T ++ W L     ++     +  I+ + V  D+++S R+I+ +    L M  R +  N+     KK+ + +  +M  + K       L +  +  +E+  ++L+LE +IA      E+++D    YNKMT+SE+Q  +    FNWT+ ++  +  V+I   ++ E++V +   L  + ++   ++   R + NY++W+ +  R++ LS  F+  + ++R+  YG       W  CV  VQ  M   +G +Y++  F  +SK  V  +I+ ++Q +   L    WMDD ++  A EK   M   IGY D IL  +   L++ +  +  +++ YFEN+        +++ +KL + P +    I     VNAFYSPN+N+I+FPAGILQ PFF     ++L +GGIG  +GHEI HGFDD G  +D  G++  WW++ + + FK +S C V+QY  ++     G +++G +TLGENIADNGGVR  Y+ Y    +  G+E  LPGL+  H QLFF+ FA++WC     +     I +++H+P  YRV+G+L NF+ F+EAF C KGS MNP  KC VW
Sbjct:   75 LNNVCTTADCVTAAARLLQNMDKSVEPCDNFYRYACGGWLERHVIPETSSRHSVFDILRDKLEIVLKGVLEMTSEADRDAI-KKAKVLYNSCMNESLIEQRDSQPLMKLID----SVGGWPVASEDWNTTAEETWSLESTLAILTAHFHKKVILDMYVWTDDRDSQRHIIYIDQPGLGMPSRDYYFNDGN--YKKVREAYLQFMVSIAKITRDDRNLTQDEERVWEEMMQVLELETDIANATSPAEERQDVTVLYNKMTISELQSTFSLNGFNWTKFIQGVLSTVSIDTQREEEVVVYSAPYLQKLDDVLSRHSV--RTMQNYLIWQLIIDRVSSLSRRFKDARARYRKTLYGTTVEDAWWRECVRYVQSSMENAVGALYVRETFAGESKQMVSNLISKIQQAYVETLEELNWMDDASKEKAREKAMAMKEHIGYPDHILEESNQKLDQEYAHLNFSEENYFENVLENLKSEAHKSLKKL-REPVDPDLWIIGAAVVNAFYSPNRNQIVFPAGILQPPFFSKHQHQALNFGGIGMVIGHEITHGFDDNGRNFDKDGNMLNWWSNYSAEHFKDQSQCMVQQYGNFNWKLAGGQNVSGISTLGENIADNGGVRQAYKAYLKWMEMEGEEPRLPGLDMNHRQLFFLNFAQVWCGAYRPEYASQSIKTDSHSPLEYRVLGSLQNFEAFSEAFQCQKGSPMNPELKCRVW 769          
BLAST of Endothelin-converting enzyme 1 vs. Planmine SMEST
Match: SMESG000025056.1 (SMESG000025056.1)

HSP 1 Score: 1515.36 bits (3922), Expect = 0.000e+0
Identity = 771/778 (99.10%), Postives = 772/778 (99.23%), Query Frame = 1
Query:  256 MSSDQYSRSIELGEVTPDIKIDGNIENQKMVASNSPEIDPIFKGLRSEHRKMSWEKXXXXXXXXXXXXXXXXXXXXXSSTMGTRRVISNQNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            MSSDQYSRSIELGEVTPDIKIDGNIENQKMVASNSPEIDPIFKGLRSEHRKMSWEKILLILIFIITIILLLLLVVLLSSTMGTR +   QNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNS IYSKAVKLYDSCLNLDRINSLGA PLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMINLLKQKFQNNLLSNVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW
Sbjct:    1 MSSDQYSRSIELGEVTPDIKIDGNIENQKMVASNSPEIDPIFKGLRSEHRKMSWEKILLILIFIITIILLLLLVVLLSSTMGTRSI---QNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSDIYSKAVKLYDSCLNLDRINSLGAIPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMINLLKQKFQNNLLSNVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 775          
BLAST of Endothelin-converting enzyme 1 vs. Planmine SMEST
Match: SMESG000025056.1 (SMESG000025056.1)

HSP 1 Score: 1513.82 bits (3918), Expect = 0.000e+0
Identity = 770/777 (99.10%), Postives = 771/777 (99.23%), Query Frame = 1
Query:  256 MSSDQYSRSIELGEVTPDIKIDGNIENQKMVASNSPEIDPIFKGLRSEHRKMSWEKXXXXXXXXXXXXXXXXXXXXXSSTMGTRRVISNQNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMV 2586
            MSSDQYSRSIELGEVTPDIKIDGNIENQKMVASNSPEIDPIFKGLRSEHRKMSWEKILLILIFIITIILLLLLVVLLSSTMGTR +   QNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNS IYSKAVKLYDSCLNLDRINSLGA PLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMINLLKQKFQNNLLSNVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMV
Sbjct:    1 MSSDQYSRSIELGEVTPDIKIDGNIENQKMVASNSPEIDPIFKGLRSEHRKMSWEKILLILIFIITIILLLLLVVLLSSTMGTRSI---QNRELDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSDIYSKAVKLYDSCLNLDRINSLGAIPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMINLLKQKFQNNLLSNVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMV 774          
BLAST of Endothelin-converting enzyme 1 vs. Planmine SMEST
Match: SMESG000003235.1 (SMESG000003235.1)

HSP 1 Score: 359.377 bits (921), Expect = 1.353e-111
Identity = 223/693 (32.18%), Postives = 365/693 (52.67%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSE-QILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSY---ASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNF---EKLNKRPENSTIDT----PQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKL-LPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            C T  C +   E+ K +N S +PC DFS ++CG      +ILP G + +++F  + + +    K LLE       S   +KA   Y SC+N +  N + + P++  + +       +E+            +L K+++  +  +    I V +D  N   NILN+    L++    L+N     +K+I+  +  YM  V  +L I K      +EILKL I +AK  P   DQ DPE   NK+++  +Q K+    +W  ++   ++  +  + +D +++  +      + ++ K Y   + KK+IL   + W  +   +   S+      ++F    +G+ G +E W+ CV I    +  I+GNM++K+ F    K  +  MI+ +K   ++ + +  WMD  T+S ALEK+  +   IGY DS+++ TYL + +  IE+     F+N  +L N   ++ F   E L    E  + D      QEVNA+Y+P  NEI+FPA IL+ PF++ G P +  YGGIG  +GHEI+HGFD  GSK+DSKG LR WWT  +R  + +K+ C + QY+ Y I+   +    T+GE+IADN G+R++Y  +    K   +EKL LPG++ + +QLFF+   R WC++ TK  I   +  + H+   YR+ G +SN  EF++ FNC +   MN   KC+VW
Sbjct:   24 CETEICKKLGEELNKIMNKSADPCDDFSSYMCGNMDKVFRILP-GQNSFNSFTQIRSSVTTTLKDLLEKQSTANRSQPQTKAAIYYQSCMNKESRNKI-SHPIILEVAKEISNGNDFEL------------NLIKLLKSGL-GSRFFSIEVAQDAANPEYNILNIGKPTLILSEGTLRNFE--SSKEIIASYIKYMKKVLNILGISKNYENVIDEILKLHIRLAKALPSIADQSDPEKYTNKLSIRNMQQKF-PSISWIRVINEVLENSDKKLKEDDKLVAFSLEYFDSLIKILKEYLGDSQKKQILQRDLEWAVISSLVPLGSDALIEANEEFMSEGFGIKGKQEEWKKCVQITSSTLQEIVGNMFVKSQFQPSQKKDIELMIDYIKAALKDVIENLTWMDSNTKSSALEKLKAIRHKIGYPDSLISETYLTKKYAPIEMT----FKN--LLGNYINFQEFAREEYLKAVGEKISPDEWAMGSQEVNAYYNPTSNEIVFPAAILRFPFYDIGLPITYNYGGIGMVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGIRMSY--FAANSKLEVREKLTLPGVDLSPEQLFFVGVGRTWCSIVTKSFIDERLKGDVHSVWKYRINGPMSNMPEFSKLFNCDRNKKMNRLKKCLVW 690          
BLAST of Endothelin-converting enzyme 1 vs. Planmine SMEST
Match: SMESG000003230.1 (SMESG000003230.1)

HSP 1 Score: 353.214 bits (905), Expect = 2.963e-109
Identity = 214/688 (31.10%), Postives = 356/688 (51.74%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNL-QLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSYAS---KKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKR--PENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKL-LPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            C T  C +   E+ K +N S +PC DFS ++CG       +  G + + +F  +++ +    K LLE       S   +KA   Y SC+N +  N + + P++  + +       +E+            +L K+ +  +  +    I V +D  N   NILN+ + +++L+E     +E+   +K+I+  +  YM  V  +L I K      +EILKL I +AK  P   DQ DPE   NK+++ ++Q K+    +W  ++    +   I + +D +++  +   L    ++ K Y     K+ IL   + W  +   ++  S       ++F     GV G +E W+ CV +    +  I+GNM++K+ F    K  +  MI+ +K   +N + +  WMD  T+S ALEK+  +   IGY DS+++ TYL + +   E++   +  N       +     + + K+  P+   + + QEVNA+Y+P  NEI+FPA IL+ PF++ G P +  YGGIG  +GHEI+HGFD  GSK+DSKG LR WWT  +R  + +K+ C + QY+ Y I+   +    T+GE+IADN G+R++Y  +    K   +EKL LP +  + +QLFF+   R WC + TK  I   +  + H+   YR+ G +SN  EF++ FNC +   MN   KC+VW
Sbjct:   24 CETEICKKLGEELNKIMNKSADPCDDFSSYMCGNMDKVYSILPGQNSFDSFTQISSSVTTTLKDLLEKQSTANRSQPQAKAAIYYQSCMNKESRNKI-SHPIILEVAKEISNGNDFEL------------NLIKLFKSGL-GSRFFSIEVAQDAANPEYNILNIGKPTFVLLEGTLRDSES--SSKEIIASYIKYMKKVLNILGISKTYENLIDEILKLHIRLAKALPSIADQSDPEKYTNKLSIRDMQKKF-PSISWIRVINEVFENTGIKLKEDDKLVAFSLEYLDSSIKILKVYLGDRKKREILQKDLEWAVISSLVSLGSNALIEANEEFMSESLGVKGKQEEWKKCVQMTSSTLQEIVGNMFVKSQFQPSQKKDIESMIDYIKAALKNVIENLTWMDSNTKSSALEKLKAIRHKIGYPDSLISETYLTKKYAPTEMSGNNFLGNYLTFLEFSTEEYLKTVGKKISPDEWAMGS-QEVNAYYNPLSNEIVFPAAILRFPFYDIGLPITYNYGGIGVVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGMRMSY--FAANSKLEVREKLTLPRVALSPEQLFFVGMGRSWCAIVTKNYIDDQLKEDVHSVWKYRINGPMSNMPEFSKVFNCDRNKNMNRQKKCLVW 691          
BLAST of Endothelin-converting enzyme 1 vs. Planmine SMEST
Match: SMESG000003218.1 (SMESG000003218.1)

HSP 1 Score: 347.436 bits (890), Expect = 3.714e-107
Identity = 210/688 (30.52%), Postives = 358/688 (52.03%), Query Frame = 1
Query:  547 CLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSSRYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINSLGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPIIRIIVQEDEKNSSRNILNL-QLSWLLMERQFLQNETKPENKKILDVFKDYMYDVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSEIQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNL---LDICELFKSYASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEHCVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMIXXXXXXXXXXXXXXVWMDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENIDMLTNRAMYRNFEKLNKR--PENSTIDTPQEVNAFYSPNKNEIIFPAGILQNPFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTRQLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDLEKKYGKEKL-LPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPNHYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW 2589
            C T  C +   E+ K +N S +PC DFS ++CG       +  G + +  F  +++ +    K LLE       S   +KA   Y SC+N +  N + + P++  + +       +E+            +L K+++  +  +    I V +D  N   NILN+ + +++L+E     +E+   +K+I+  +  YM  V  +L I K      +EILKL I +AK  P   DQ +PE   NK+++ ++Q K+    +W  ++    +   I + +D +++  +   L   + I +++     K+ IL   + W  + + +   S+     +++F     GV G +E W+ CV +    +  I+GNM++K+ F    K  +  MI+ +K   ++ + +  WMD  T+S ALEK+ T+   IGY DS+++ TYL + +   E++   +  N       +     + + K+  P+   +  PQ+VNA+Y+   NEI+FPA I + PF++ G P +  YGGIG  +GHEI+HGFD  GSK+DSKG LR WWT  +R  + +K+ C + QY+ Y I+   +    T+GE+IADN G+R++Y  +    K   +EKL LP +  + +QLFF+   R WC + TK  I   +  + H+   YR+ G +SN  EF++ FNC +   MN   KC+VW
Sbjct:   24 CETEICKKLGEELNKIMNKSADPCDDFSSYMCGNMDKVYSILPGQNSFDYFTQISSSVTTTLKDLLEKQSTANRSQPQAKAAIYYQSCMNKESRNKI-SHPIILEVAKEISNGNDFEL------------NLIKLLKSGL-GSRFFSIDVAQDAANPEYNILNIGKPTFVLLEGTLRDSES--SSKEIITSYIKYMKKVLNILGISKTYENLIDEILKLHIRLAKALPSIADQSNPEKYTNKLSIRDMQKKF-PSISWIRVINEVFENTGIKLKEDDKLVAFSLEYLDYSIKILKVYLGDRKKREILQKDLEWAVISRLVLLGSDALIEAQEEFMSESLGVKGKQEEWKKCVQMTSSTLQEIVGNMFVKSQFQPSQKKDIESMIDYIKAALKSVIENLTWMDSNTKSSALEKLKTIRHKIGYPDSLISETYLTKKYAPTEMSGNNFLGNYLTFLEFSTEEYLKTVGKKISPDKWAMG-PQKVNAYYNALSNEIVFPAAIFRFPFYDIGLPITYNYGGIGVVIGHEILHGFDTQGSKFDSKGLLREWWTKSSRDEYLSKTQCIINQYASYVINNKPLPSLQTVGEDIADNAGMRMSY--FAANSKLEVREKLTLPRVALSPEQLFFVGMGRSWCAIVTKNYIDNQLKEDVHSVWKYRINGPMSNMPEFSKVFNCDRNKNMNRQKKCLVW 691          
The following BLAST results are available for this feature:
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ECE21.089e-14936.36endothelin converting enzyme 2 [Source:HGNC Symbol... [more]
ECE21.689e-14936.36endothelin converting enzyme 2 [Source:HGNC Symbol... [more]
ECE26.245e-14936.08endothelin converting enzyme 2 [Source:HGNC Symbol... [more]
ECE24.200e-14836.36endothelin converting enzyme 2 [Source:HGNC Symbol... [more]
ECE12.087e-14437.50endothelin converting enzyme 1 [Source:HGNC Symbol... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nep-115.084e-11732.20Neprilysin-11 [Source:UniProtKB/Swiss-Prot;Acc:O1... [more]
nep-13.575e-11132.86Neprilysin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18... [more]
nep-21.098e-11033.00Neprilysin-2 [Source:UniProtKB/Swiss-Prot;Acc:O44... [more]
nep-112.626e-9631.69Neprilysin-11 [Source:UniProtKB/Swiss-Prot;Acc:O1... [more]
nep-213.604e-9530.48Neprilysin-21 [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nep31.362e-13634.26gene:FBgn0031081 transcript:FBtr0307554[more]
Nep31.362e-13634.26gene:FBgn0031081 transcript:FBtr0070000[more]
Nep31.362e-13634.26gene:FBgn0031081 transcript:FBtr0307555[more]
Nep16.689e-13533.29gene:FBgn0029843 transcript:FBtr0343930[more]
Nep16.689e-13533.29gene:FBgn0029843 transcript:FBtr0070873[more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ece2b7.863e-14936.38endothelin converting enzyme 2b [Source:ZFIN;Acc:Z... [more]
ece13.556e-13033.92endothelin converting enzyme 1 [Source:ZFIN;Acc:ZD... [more]
ece13.556e-13033.92endothelin converting enzyme 1 [Source:ZFIN;Acc:ZD... [more]
mmel14.920e-13033.14membrane metallo-endopeptidase-like 1 [Source:ZFIN... [more]
mmel15.225e-13033.14membrane metallo-endopeptidase-like 1 [Source:ZFIN... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhdds7.366e-15436.49dehydrodolichyl diphosphate synthase subunit [Sour... [more]
dhdds7.430e-15436.49dehydrodolichyl diphosphate synthase subunit [Sour... [more]
dhdds1.197e-15336.49dehydrodolichyl diphosphate synthase subunit [Sour... [more]
dhdds1.763e-15136.72dehydrodolichyl diphosphate synthase subunit [Sour... [more]
dhdds8.189e-15136.68dehydrodolichyl diphosphate synthase subunit [Sour... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ece21.184e-14736.34endothelin converting enzyme 2 [Source:MGI Symbol;... [more]
Ece21.790e-14736.34endothelin converting enzyme 2 [Source:MGI Symbol;... [more]
Gm493336.666e-14636.34predicted gene, 49333 [Source:MGI Symbol;Acc:MGI:6... [more]
Gm493338.600e-14636.34predicted gene, 49333 [Source:MGI Symbol;Acc:MGI:6... [more]
Ece18.060e-14337.32endothelin converting enzyme 1 [Source:MGI Symbol;... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DPD6|ECE2_HUMAN2.999e-14836.08Endothelin-converting enzyme 2 OS=Homo sapiens OX=... [more]
sp|P0DPD8|EFCE2_HUMAN2.017e-14736.36EEF1AKMT4-ECE2 readthrough transcript protein OS=H... [more]
sp|F1N476|ECE2_BOVIN3.509e-14735.93Endothelin-converting enzyme 2 OS=Bos taurus OX=99... [more]
sp|B2RQR8|ECE2_MOUSE1.252e-14636.34Endothelin-converting enzyme 2 OS=Mus musculus OX=... [more]
sp|P0DPE2|EFCE2_BOVIN2.991e-14535.93EEF1AKMT4-ECE2 readthrough transcript protein OS=B... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F6U2S11.835e-15540.06Uncharacterized protein OS=Ciona intestinalis OX=7... [more]
A0A3Q0K6662.344e-15440.06endothelin-converting enzyme 2 isoform X2 OS=Ciona... [more]
A0A3Q0K2P42.751e-15440.06endothelin-converting enzyme 2 isoform X1 OS=Ciona... [more]
A0A401RYI91.630e-15136.70Uncharacterized protein OS=Chiloscyllium punctatum... [more]
A0A5G3IRF21.157e-15036.49Dehydrodolichyl diphosphate synthase subunit OS=Xe... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ece2b7.022e-15037.10endothelin-converting enzyme 2 [Source:NCBI gene;A... [more]
ece2b9.302e-15037.10endothelin-converting enzyme 2 [Source:NCBI gene;A... [more]
ece2b1.315e-14937.10endothelin-converting enzyme 2 [Source:NCBI gene;A... [more]
ece2b3.150e-13835.27endothelin-converting enzyme 2 [Source:NCBI gene;A... [more]
mmel16.354e-13233.14membrane metalloendopeptidase like 1 [Source:NCBI ... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mmel11.786e-12033.43membrane metallo-endopeptidase-like 1 [Source:ZFIN... [more]
ecel17.367e-9733.33endothelin converting enzyme-like 1 [Source:ZFIN;A... [more]
mmel11.514e-8831.87membrane metallo-endopeptidase-like 1 [Source:ZFIN... [more]
mmel12.681e-8831.77membrane metallo-endopeptidase-like 1 [Source:ZFIN... [more]
ENSPMAT00000004622.13.363e-6535.16pep scaffold:Pmarinus_7.0:GL480748:697:25272:-1 ge... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO415011.201e-12832.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351077.457e-12634.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498501.916e-12131.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417361.805e-11533.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496841.026e-11232.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ece2b2.282e-15035.32endothelin-converting enzyme 2 [Source:NCBI gene;A... [more]
MME1.291e-13735.20membrane metalloendopeptidase [Source:NCBI gene;Ac... [more]
ece11.341e-13734.72endothelin converting enzyme 1 [Source:NCBI gene;A... [more]
ece14.582e-13634.88endothelin converting enzyme 1 [Source:NCBI gene;A... [more]
mmel14.414e-13433.48membrane metalloendopeptidase like 1 [Source:NCBI ... [more]
back to top
BLAST of Endothelin-converting enzyme 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025056.10.000e+099.10SMESG000025056.1[more]
SMESG000025056.10.000e+099.10SMESG000025056.1[more]
SMESG000003235.11.353e-11132.18SMESG000003235.1[more]
SMESG000003230.12.963e-10931.10SMESG000003230.1[more]
SMESG000003218.13.714e-10730.52SMESG000003218.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035315 ID=SMED30035315|Name=Endothelin-converting enzyme 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2788bp
CTGTGATCACTGCAATAGTTAGCATCTGAATTATTAACCAAAGAGAGTAA
GACAAAATATTGATCAATATTTTTTCTGCTACACTCGATTTGATTAGCTA
ATTCTTAAAACTGTTTCAAAATGGATTTTTAATTTCTAAACGGATTTATC
TGAATTTCTATTGAGCATTCTTGTTTTTTAAATCCTATTTATCGTTGTTT
TGTTAGAATTGTCTTGGAATTTTTTTGATGTGAAATGACAAATCATTACA
TTCAGATGTCGTCCGATCAATACAGTAGATCAATCGAGTTGGGCGAAGTG
ACACCTGACATAAAAATCGATGGAAATATTGAAAATCAAAAAATGGTTGC
ATCAAATTCTCCAGAAATCGATCCGATTTTCAAAGGACTCCGATCAGAAC
ATCGCAAAATGTCTTGGGAAAAGATTTTGTTAATTTTGATTTTTATAATC
ACGATAATTTTGCTGTTGCTTCTTGTTGTTTTATTGTCCTCAACCATGGG
AACCAGAAGGGTAATAAGCAATCAAAATCGTGAATTAGACAGTCCATGTT
TAACAGTTTCCTGTCTTCAAGCTGCGGTTGAAATCAGAAAAAGTTTGAAT
ACATCAGTGAATCCATGTTATGATTTCAGTCAGTTTGTCTGCGGTAAATG
GCAGAGTGAACAAATCCTTCCAAAAGGAAGTTCTAGATATTCCACTTTTG
ATGTAGTAAATACGGATTTGTTTAAAATACAAAAAAAGCTCCTGGAGAAT
CCGGAATTCAAAACCAACAGTGGTATTTACTCGAAAGCTGTCAAATTGTA
TGACTCGTGTTTGAATTTGGATAGAATAAATAGTTTAGGTGCAACACCGT
TAGTAACTTATTTAAACAGAACATTTGGTGCTTATGGTGGTTGGGAAATG
TTAACTAACGACTTAAATCCAACTCTGGATAAATGGGATTTAGCAAAGGT
TATTGAAGATCCAATGGTTGAGACTCCAATTATCAGAATAATCGTACAAG
AAGATGAAAAGAACTCATCAAGGAACATTCTTAATCTTCAACTCAGTTGG
TTGTTAATGGAAAGACAATTCCTTCAAAATGAAACGAAACCAGAAAATAA
AAAGATTTTGGACGTTTTCAAAGATTACATGTATGATGTGGGAAAACTAT
TGAAAATACGGAAAGAAAAATTTGAGCAGTTCAATGAAATTTTGAAACTT
GAAATAGAAATCGCAAAAAAATACCCAAAAGAAGAAGATCAAAGAGATCC
AGAAAGTACATACAACAAAATGACTTTGTCAGAAATACAAGGGAAATATT
GTCAACAATTTAATTGGACAGAAATCGTCCGGCGGCGAATGAAACTCGTC
AACATCACAATGAGCAAAGACATTGAGATTATTGTCACTAATCCGACTAA
TTTACTTGATATTTGTGAATTATTCAAATCTTATGCATCAAAGAAGAGAA
TATTACATAACTACGTTTTGTGGCGAACCGTTTATCAAAGAATTAACTTC
CTCTCAGAGGATTTCCAAAGAATAAAAGATAAATTTCGGCGTGTTTATTA
TGGTGTGGTTGGAACAAAAGAACGATGGGAACATTGCGTATCTATTGTGC
AAGTTCACATGAGCTTAATCCTCGGAAATATGTACATAAAAAATAATTTC
AATAAACAATCAAAACCTCAAGTTTTAGAAATGATAAATTTATTAAAACA
AAAATTCCAAAATAATTTGTTAAGCAATGTTTGGATGGATGATCAAACAA
GATCGCATGCTTTAGAAAAAATTGATACAATGTGGCCTCTAATTGGATAT
ACGGATTCTATTCTTAATGTTACCTATCTAGAAGAAACTTTCAAAGATAT
AGAGATCAATGATCAAACGTATTTCGAAAACATTGATATGTTGACAAACA
GAGCCATGTATAGAAATTTCGAAAAGCTTAATAAACGTCCAGAAAATTCA
ACTATTGACACGCCACAAGAAGTGAATGCTTTTTATAGTCCGAATAAAAA
TGAAATTATTTTCCCGGCGGGCATATTACAAAATCCATTTTTTGAGCCCG
GATTTCCAAGATCTTTAAAATATGGAGGTATTGGCACTGCAATGGGTCAC
GAAATTATTCATGGATTTGATGATACCGGTTCCAAGTATGATTCAAAAGG
TGATTTAAGAGTTTGGTGGACAGATAGAACAAGACAGCTTTTCAAAACAA
AATCAGACTGTTTTGTTAAACAATACTCTAAATATTCAATTCATGGGCAT
TCAATCAATGGAGAAAATACTTTAGGAGAAAATATTGCAGATAATGGTGG
TGTGCGTTTAACATATCAGGTTTACAAAGATTTGGAGAAAAAGTATGGAA
AGGAAAAATTATTGCCAGGGTTGAATTATACACACGATCAATTGTTTTTC
ATTACTTTTGCCAGATTATGGTGCAATCTACAAACAAAACAGAGTATTAT
AATAGATATATTATCAAATGCACACACTCCCAATCATTACAGAGTTATTG
GGACCCTGTCGAATTTCAAGGAATTTGCAGAGGCATTCAACTGTCCAAAA
GGTTCTGGCATGAATCCCACAGATAAATGTATGGTGTGGTAAAACAGTCA
AATGTTATGAAACATGAGCTTTGTATATACTTTTAAGACAAAGTGTATCC
GTACTAATGATATGAATGATTCATTTATTTGCCATCATCTGCTGTTGTAC
GGAATCAGGAAATATCACTGACGTTATAATCTTATATCATTTGTTTATTT
ATTGATATTCAAACTTATATACATTATTATTTGTTTAA
back to top

protein sequence of SMED30035315-orf-1

>SMED30035315-orf-1 ID=SMED30035315-orf-1|Name=SMED30035315-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=786bp
MTNHYIQMSSDQYSRSIELGEVTPDIKIDGNIENQKMVASNSPEIDPIFK
GLRSEHRKMSWEKILLILIFIITIILLLLLVVLLSSTMGTRRVISNQNRE
LDSPCLTVSCLQAAVEIRKSLNTSVNPCYDFSQFVCGKWQSEQILPKGSS
RYSTFDVVNTDLFKIQKKLLENPEFKTNSGIYSKAVKLYDSCLNLDRINS
LGATPLVTYLNRTFGAYGGWEMLTNDLNPTLDKWDLAKVIEDPMVETPII
RIIVQEDEKNSSRNILNLQLSWLLMERQFLQNETKPENKKILDVFKDYMY
DVGKLLKIRKEKFEQFNEILKLEIEIAKKYPKEEDQRDPESTYNKMTLSE
IQGKYCQQFNWTEIVRRRMKLVNITMSKDIEIIVTNPTNLLDICELFKSY
ASKKRILHNYVLWRTVYQRINFLSEDFQRIKDKFRRVYYGVVGTKERWEH
CVSIVQVHMSLILGNMYIKNNFNKQSKPQVLEMINLLKQKFQNNLLSNVW
MDDQTRSHALEKIDTMWPLIGYTDSILNVTYLEETFKDIEINDQTYFENI
DMLTNRAMYRNFEKLNKRPENSTIDTPQEVNAFYSPNKNEIIFPAGILQN
PFFEPGFPRSLKYGGIGTAMGHEIIHGFDDTGSKYDSKGDLRVWWTDRTR
QLFKTKSDCFVKQYSKYSIHGHSINGENTLGENIADNGGVRLTYQVYKDL
EKKYGKEKLLPGLNYTHDQLFFITFARLWCNLQTKQSIIIDILSNAHTPN
HYRVIGTLSNFKEFAEAFNCPKGSGMNPTDKCMVW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042089Peptidase_M13_dom_2
IPR000718Peptidase_M13
IPR018497Peptidase_M13_C
IPR024079MetalloPept_cat_dom_sf
IPR008753Peptidase_M13_N
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007267cell-cell signaling
GO:0007420brain development
GO:0007507heart development
GO:0008152metabolic process
GO:0010002cardioblast differentiation
GO:0016486peptide hormone processing
GO:0032259methylation
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008237metallopeptidase activity
GO:0003824catalytic activity
GO:0005515protein binding
GO:0008168methyltransferase activity
GO:0008233peptidase activity
GO:0016740transferase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030658transport vesicle membrane
GO:0030659cytoplasmic vesicle membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018497Peptidase M13, C-terminal domainPRINTSPR00786NEPRILYSINcoord: 609..625
score: 59.84
coord: 679..690
score: 65.23
coord: 570..582
score: 47.75
coord: 588..600
score: 74.8
IPR018497Peptidase M13, C-terminal domainPFAMPF01431Peptidase_M13coord: 578..780
e-value: 6.6E-70
score: 234.9
IPR024079Metallopeptidase, catalytic domain superfamilyGENE3DG3DSA:3.40.390.10coord: 107..782
e-value: 8.0E-218
score: 727.2
IPR042089Peptidase M13, domain 2GENE3DG3DSA:1.10.1380.10coord: 150..566
e-value: 8.0E-218
score: 727.2
IPR008753Peptidase M13, N-terminal domainPFAMPF05649Peptidase_M13_Ncoord: 124..519
e-value: 5.3E-86
score: 289.7
NoneNo IPR availablePANTHERPTHR11733:SF127EEF1AKMT4-ECE2 READTHROUGH TRANSCRIPT PROTEIN-RELATEDcoord: 43..782
NoneNo IPR availablePROSITEPS51885NEPRILYSINcoord: 101..782
score: 112.893
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 101..782
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
IPR000718Peptidase M13PANTHERPTHR11733ZINC METALLOPROTEASE FAMILY M13 NEPRILYSIN-RELATEDcoord: 43..782
IPR000718Peptidase M13CDDcd08662M13coord: 122..779
e-value: 0.0
score: 653.281