Forkhead box C1

Overview
NameForkhead box C1
Smed IDSMED30035307
Length (bp)1828
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Forkhead box C1 (SMED30035307) t-SNE clustered cells

Violin plots show distribution of expression levels for Forkhead box C1 (SMED30035307) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Forkhead box C1 (SMED30035307) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Forkhead box C1 (SMED30035307) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035307

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30035307SMESG000015673.1 SmedASXL_007800SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30035307SMESG000015673.1 dd_Smed_v4_16297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035307SMESG000015673.1 dd_Smed_v4_16297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035307SMESG000015673.1 dd_Smed_v4_16297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035307SMESG000015673.1 dd_Smed_v4_16297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035307SMESG000015673.1 dd_Smed_v4_16297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035307SMESG000015673.1 dd_Smed_v4_16297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035307SMESG000015673.1 Contig9654newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035307SMESG000015673.1 Contig9654uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30035307SMESG000015673.1 dd_Smed_v6_16297_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30035307SMESG000015673.1 Contig9654newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035307SMESG000015673.1 Contig9654uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Forkhead box C1 vs. Ensembl Human
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 200.675 bits (509), Expect = 1.016e-56
Identity = 91/113 (80.53%), Postives = 105/113 (92.92%), Query Frame = 3
Query:  525 RDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDR 863
            +DLVKPPYSYIALITMA+   PEKK+TL+GIYQFIM++FP+YRENKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KDV +++E+R
Sbjct:   68 KDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEER 180          
BLAST of Forkhead box C1 vs. Ensembl Human
Match: FOXC1 (forkhead box C1 [Source:HGNC Symbol;Acc:HGNC:3800])

HSP 1 Score: 197.593 bits (501), Expect = 4.110e-55
Identity = 91/132 (68.94%), Postives = 111/132 (84.09%), Query Frame = 3
Query:  474 YGSHSNHPNMSSSRNPSRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKR 869
            YG ++  P         +D+VKPPYSYIALITMA+   P+KK+TL+GIYQFIM++FP+YR+NKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KD ++D+E++ R
Sbjct:   64 YGPYTPQPQ-------PKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKDR 188          
BLAST of Forkhead box C1 vs. Ensembl Human
Match: FOXB1 (forkhead box B1 [Source:HGNC Symbol;Acc:HGNC:3799])

HSP 1 Score: 162.155 bits (409), Expect = 2.745e-44
Identity = 69/98 (70.41%), Postives = 82/98 (83.67%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFK 830
            KPPYSYI+L  MA+ + PEK + LS IY+FIM++FPYYREN Q WQNS+RHNLS N+CFIKIPR   +PGKGS+WALHP   +MFENGSFLRRR+RFK
Sbjct:   13 KPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK 110          
BLAST of Forkhead box C1 vs. Ensembl Human
Match: FOXL1 (forkhead box L1 [Source:HGNC Symbol;Acc:HGNC:3817])

HSP 1 Score: 158.688 bits (400), Expect = 6.766e-43
Identity = 65/98 (66.33%), Postives = 85/98 (86.73%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFK 830
            KPPYSYIALI MA+   PE++VTL+GIYQFIM++FP+Y +N+QGWQNSIRHNLSLN+CF+K+PR+  +PGKGSYW L P+  +MFENG++ RR+R+ K
Sbjct:   49 KPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPK 146          
BLAST of Forkhead box C1 vs. Ensembl Human
Match: FOXA3 (forkhead box A3 [Source:HGNC Symbol;Acc:HGNC:5023])

HSP 1 Score: 157.918 bits (398), Expect = 1.845e-42
Identity = 68/105 (64.76%), Postives = 86/105 (81.90%), Query Frame = 3
Query:  534 VKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQ 848
             KPPYSYI+LITMA+   P K +TLS IYQ+IM+ FPYYREN+Q WQNSIRH+LS N+CF+K+ R   KPGKGSYWALHP + NMFENG +LRR++RFK ++ ++
Sbjct:  116 AKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVK 220          
BLAST of Forkhead box C1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 150.599 bits (379), Expect = 1.929e-39
Identity = 64/115 (55.65%), Postives = 84/115 (73.04%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQE 881
            KPPYSYI+LITMA+     +++TLS IY +IM+ FPYY+ N+Q WQNSIRH+LS N+CF+K+ R   KPGKGS+W LH    NMFENG +LRR++RFK K+    R+ R    Q+
Sbjct:  172 KPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSRKKRNANSQQ 286          
BLAST of Forkhead box C1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 149.443 bits (376), Expect = 2.546e-39
Identity = 64/115 (55.65%), Postives = 84/115 (73.04%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQE 881
            KPPYSYI+LITMA+     +++TLS IY +IM+ FPYY+ N+Q WQNSIRH+LS N+CF+K+ R   KPGKGS+W LH    NMFENG +LRR++RFK K+    R+ R    Q+
Sbjct:  141 KPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSRKKRNANSQQ 255          
BLAST of Forkhead box C1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 150.599 bits (379), Expect = 5.751e-39
Identity = 64/115 (55.65%), Postives = 84/115 (73.04%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQE 881
            KPPYSYI+LITMA+     +++TLS IY +IM+ FPYY+ N+Q WQNSIRH+LS N+CF+K+ R   KPGKGS+W LH    NMFENG +LRR++RFK K+    R+ R    Q+
Sbjct:  236 KPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSRKKRNANSQQ 350          
BLAST of Forkhead box C1 vs. Ensembl Celegans
Match: unc-130 (pep chromosome:WBcel235:II:11281986:11283953:1 gene:WBGene00006853.1 transcript:C47G2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-130)

HSP 1 Score: 143.28 bits (360), Expect = 8.359e-38
Identity = 63/99 (63.64%), Postives = 77/99 (77.78%), Query Frame = 3
Query:  534 VKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFK 830
             KPPYSYIALI M++   PEKK+TLS I +FI+ KF YY+E    WQNSIRHNLSLN+CF+K+ R    PGKG+YWAL P   +MF+NGSFLRRR+R+K
Sbjct:  126 AKPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARGPGNPGKGNYWALDPNCEDMFDNGSFLRRRKRYK 224          
BLAST of Forkhead box C1 vs. Ensembl Celegans
Match: lin-31 (pep chromosome:WBcel235:II:3982549:3986944:1 gene:WBGene00003017.1 transcript:K10G6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-31)

HSP 1 Score: 132.109 bits (331), Expect = 8.402e-35
Identity = 59/96 (61.46%), Postives = 73/96 (76.04%), Query Frame = 3
Query:  522 SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFL 809
            S D  KPPYSYI L  MA+    +K + L+ IY++IM++FP+YR+N Q WQNS+RHNLS N+CFIKIPR   +PGKGSYWA+HP A  MFENGS L
Sbjct:    8 SYDEQKPPYSYIWLTYMAIQDSDDKMLPLTEIYKYIMDRFPFYRKNTQRWQNSLRHNLSFNDCFIKIPRRADRPGKGSYWAVHPNASGMFENGSCL 103          
BLAST of Forkhead box C1 vs. Ensembl Fly
Match: croc (gene:FBgn0014143 transcript:FBtr0078395)

HSP 1 Score: 188.734 bits (478), Expect = 1.344e-52
Identity = 85/117 (72.65%), Postives = 105/117 (89.74%), Query Frame = 3
Query:  525 RDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQ 875
            +++VKPPYSYIALI MA+    +KKVTL+GIYQ+IME+FPYYR+NKQGWQNSIRHNLSLNECF+K+ RDDKKPGKGSYW L P +YNMF+NGSFLRRRRRFK KDV++++E+  ++Q
Sbjct:   66 KEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQ 182          
BLAST of Forkhead box C1 vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0339246)

HSP 1 Score: 165.236 bits (417), Expect = 3.104e-45
Identity = 82/187 (43.85%), Postives = 117/187 (62.57%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVISKNGDLNKSYSESVEHSDQSQSIIENELSQETKLGH--DSSINNVNHTN 1091
            KPPYSYI+L  MA+ + PEK + LS IY+FI ++FPYYR+N Q WQNS+RHNLS N+CFIK+PR   +PGKG+YWALHPQA++MFENGS LRRR+RFK     +D  + +     +    F +T      +N   +      D+N + +  ++   +S + + N L     L H   +S++  +HTN
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTT------RNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTN 193          
BLAST of Forkhead box C1 vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0084770)

HSP 1 Score: 165.236 bits (417), Expect = 3.104e-45
Identity = 82/187 (43.85%), Postives = 117/187 (62.57%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVISKNGDLNKSYSESVEHSDQSQSIIENELSQETKLGH--DSSINNVNHTN 1091
            KPPYSYI+L  MA+ + PEK + LS IY+FI ++FPYYR+N Q WQNS+RHNLS N+CFIK+PR   +PGKG+YWALHPQA++MFENGS LRRR+RFK     +D  + +     +    F +T      +N   +      D+N + +  ++   +S + + N L     L H   +S++  +HTN
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTT------RNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTN 193          
BLAST of Forkhead box C1 vs. Ensembl Fly
Match: fd96Cb (gene:FBgn0004898 transcript:FBtr0084771)

HSP 1 Score: 155.221 bits (391), Expect = 1.224e-42
Identity = 66/110 (60.00%), Postives = 87/110 (79.09%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRK 866
            KPPYSYI+L  MA+   P++ + LS IY+FIM++FP+YR+N Q WQNS+RHNLS N+CFIK+PR+  K GKGSYW LHP A++MFENGS LRRR+RF+ K + +D  + K
Sbjct:   13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWK 122          
BLAST of Forkhead box C1 vs. Ensembl Fly
Match: fd59A (gene:FBgn0004896 transcript:FBtr0071898)

HSP 1 Score: 159.844 bits (403), Expect = 1.434e-42
Identity = 69/106 (65.09%), Postives = 84/106 (79.25%), Query Frame = 3
Query:  531 LVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQ 848
            LVKPPYSYIALITMA+   P KK+TLSGI  FIM +FPYY++    WQNSIRHNLSLN+CFIK+PR+   PGKG++W L P A +MF+NGSFLRRR+R+K    +Q
Sbjct:   83 LVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQ 188          
BLAST of Forkhead box C1 vs. Ensembl Zebrafish
Match: foxc1b (forkhead box C1b [Source:NCBI gene;Acc:79375])

HSP 1 Score: 205.682 bits (522), Expect = 1.635e-59
Identity = 103/190 (54.21%), Postives = 137/190 (72.11%), Query Frame = 3
Query:  414 YSTSYSMGNSPIPNARFLTHYGSHSNHPN-MSSSRNP------SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVISKNG 962
            Y T+   G + +P    +  + +H  +P  M+ +  P       +D+VKPPYSYIALITMA+    +KK+TL+GIYQFIME+FP+YR+NKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KDVL+++EDR R+ ++   N   +  +D  +  +   + ++NG
Sbjct:   26 YRTATGGGYTGMPAPMSMYSHATHEQYPGGMARAYGPYAPAQQPKDMVKPPYSYIALITMAIQNSSDKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVLREKEDRDRQGKD---NPGQACEQDAQQPVKLRDIKTENG 212          
BLAST of Forkhead box C1 vs. Ensembl Zebrafish
Match: foxc1a (forkhead box C1a [Source:NCBI gene;Acc:100148408])

HSP 1 Score: 206.453 bits (524), Expect = 2.430e-59
Identity = 99/161 (61.49%), Postives = 124/161 (77.02%), Query Frame = 3
Query:  414 YSTSYSMGNSPIPNARFLTHYGSHSNHP-NMSSSRNP------SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQ 875
            Y  +   G + +P    +  + +H  +P +M+ +  P       +D+VKPPYSYIALITMA+   P+KKVTL+GIYQFIME+FP+YR+NKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KD ++D+EDR  K+
Sbjct:   26 YRAAAGGGYTGMPAPMTMYSHAAHDQYPASMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNSPDKKVTLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAMKDKEDRGVKE 186          
BLAST of Forkhead box C1 vs. Ensembl Zebrafish
Match: foxl1 (forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1181])

HSP 1 Score: 165.622 bits (418), Expect = 1.878e-45
Identity = 75/141 (53.19%), Postives = 100/141 (70.92%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVISKN 959
            KPPYSYIALI MA+   P+K+ TLSGIYQFIM++FPYY +NKQGWQNSIRHNLSLN+CFIK+PR+  +PGKGSYW L  +  +MFENG++ RR+R+ + +D    +   KR +        TS       ++EK+S + +N
Sbjct:   52 KPPYSYIALIAMAIKNAPDKRATLSGIYQFIMDRFPYYHDNKQGWQNSIRHNLSLNDCFIKVPREKGRPGKGSYWTLDTKCLDMFENGNYRRRKRKCRTQDTGDTKVGHKRTR-------VTSFKLHQGAQSEKVSPLKQN 185          
BLAST of Forkhead box C1 vs. Ensembl Zebrafish
Match: foxl1 (forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1181])

HSP 1 Score: 165.622 bits (418), Expect = 1.878e-45
Identity = 75/141 (53.19%), Postives = 100/141 (70.92%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVISKN 959
            KPPYSYIALI MA+   P+K+ TLSGIYQFIM++FPYY +NKQGWQNSIRHNLSLN+CFIK+PR+  +PGKGSYW L  +  +MFENG++ RR+R+ + +D    +   KR +        TS       ++EK+S + +N
Sbjct:   52 KPPYSYIALIAMAIKNAPDKRATLSGIYQFIMDRFPYYHDNKQGWQNSIRHNLSLNDCFIKVPREKGRPGKGSYWTLDTKCLDMFENGNYRRRKRKCRTQDTGDTKVGHKRTR-------VTSFKLHQGAQSEKVSPLKQN 185          
BLAST of Forkhead box C1 vs. Ensembl Zebrafish
Match: foxb1a (forkhead box B1a [Source:ZFIN;Acc:ZDB-GENE-990616-47])

HSP 1 Score: 161.77 bits (408), Expect = 9.839e-45
Identity = 69/99 (69.70%), Postives = 82/99 (82.83%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKA 833
            KPPYSYI+L  MA+ + PEK + LS IY+FIM++FPYYREN Q WQNS+RHNLS N+CFIKIPR   +PGKGS+WALHP   +MFENGSFLRRR+RFK 
Sbjct:   13 KPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKV 111          
BLAST of Forkhead box C1 vs. Ensembl Xenopus
Match: foxc2 (forkhead box C2 [Source:NCBI gene;Acc:407875])

HSP 1 Score: 204.142 bits (518), Expect = 1.877e-58
Identity = 99/147 (67.35%), Postives = 118/147 (80.27%), Query Frame = 3
Query:  465 LTHYGSHSNH-PNMSSSRNP--------SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQ 878
            ++ Y +H  + P M+ S  P         +DLVKPPYSYIALITMA+   P+KK+TL+GIYQFIM++FP+YRENKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KDV +++EDR  K Q
Sbjct:   38 MSVYPAHEQYTPGMARSYGPYHHHQPAAPKDLVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSREKEDRILKDQ 184          
BLAST of Forkhead box C1 vs. Ensembl Xenopus
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:Xenbase;Acc:XB-GENE-5957388])

HSP 1 Score: 201.83 bits (512), Expect = 3.462e-57
Identity = 93/121 (76.86%), Postives = 109/121 (90.08%), Query Frame = 3
Query:  525 RDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQD--REDRKRKQQE 881
            +D+VKPPYSYIALITMA+   PEKK+TL+GIYQFIME+FP+YR+NKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KDV++D  +ED+ R  +E
Sbjct:   75 KDMVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVVKDATKEDKDRLLKE 195          
BLAST of Forkhead box C1 vs. Ensembl Xenopus
Match: FOXL1 (forkhead box L1 [Source:HGNC Symbol;Acc:HGNC:3817])

HSP 1 Score: 163.696 bits (413), Expect = 2.980e-44
Identity = 73/126 (57.94%), Postives = 96/126 (76.19%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSK 914
            KPPYSYIALI MA+   P+ +VTL+GIYQFIM++FP+Y +NKQGWQNSIRHNLSLN+CFIK+PR+  +PGKGSYW L P+  +MFENG+F RR+R  K K +L  +E ++ K +  E  +  +  K
Sbjct:   51 KPPYSYIALIAMAIKDSPDHRVTLNGIYQFIMDRFPFYHDNKQGWQNSIRHNLSLNDCFIKVPREKGRPGKGSYWTLDPKCLDMFENGNFRRRKR--KPKPILC-QEGKRHKAEAAEYRLADAACK 173          
BLAST of Forkhead box C1 vs. Ensembl Xenopus
Match: foxa2 (forkhead box A2 [Source:NCBI gene;Acc:395063])

HSP 1 Score: 164.466 bits (415), Expect = 4.245e-44
Identity = 74/138 (53.62%), Postives = 98/138 (71.01%), Query Frame = 3
Query:  498 NMSSSRNP-----SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNI 896
            N++ SR+P     S    KPPYSYI+LITMA+   P K +TLS IYQ+IM+ FP+YR+N+Q WQNSIRH+LS N+CF+K+PR   KPGKGS+W LHP + NMFENG +LRR++RFK +     RE   +K  E   ++
Sbjct:  131 NINRSRDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKKPSLREGGGKKLSEGSSSV 268          
BLAST of Forkhead box C1 vs. Ensembl Xenopus
Match: serpinc1 (serpin peptidase inhibitor, clade C (antithrombin), member 1 [Source:Xenbase;Acc:XB-GENE-975782])

HSP 1 Score: 159.458 bits (402), Expect = 2.395e-43
Identity = 68/99 (68.69%), Postives = 81/99 (81.82%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKA 833
            KPPYSYI+L  MA+ +  EK + LS IY+FIM++FPYYREN Q WQNS+RHNLS N+CFIKIPR   +PGKGS+WALHP   +MFENGSFLRRR+RFK 
Sbjct:   13 KPPYSYISLTAMAIQSSQEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKV 111          
BLAST of Forkhead box C1 vs. Ensembl Mouse
Match: Foxc2 (forkhead box C2 [Source:MGI Symbol;Acc:MGI:1347481])

HSP 1 Score: 205.297 bits (521), Expect = 1.098e-58
Identity = 106/176 (60.23%), Postives = 123/176 (69.89%), Query Frame = 3
Query:  477 GSHSNHP-----NMSSSRNP-------SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDR---KRKQQEDECNIFTSTSKDDDEKNEKLSVISKN 959
            G +S HP      M  S  P        +DLVKPPYSYIALITMA+   PEKK+TL+GIYQFIM++FP+YRENKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KDV +D+E+R   K           T T   D  K  +  V+ K+
Sbjct:   39 GVYSGHPEQYGAGMGRSYAPYHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVPKDKEERAHLKEPPSTTAKGAPTGTPVADGPKEAEKKVVVKS 214          
BLAST of Forkhead box C1 vs. Ensembl Mouse
Match: Foxc1 (forkhead box C1 [Source:MGI Symbol;Acc:MGI:1347466])

HSP 1 Score: 197.593 bits (501), Expect = 2.499e-55
Identity = 91/132 (68.94%), Postives = 111/132 (84.09%), Query Frame = 3
Query:  474 YGSHSNHPNMSSSRNPSRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKR 869
            YG ++  P         +D+VKPPYSYIALITMA+   P+KK+TL+GIYQFIM++FP+YR+NKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KD ++D+E++ R
Sbjct:   64 YGPYTPQPQ-------PKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKGR 188          
BLAST of Forkhead box C1 vs. Ensembl Mouse
Match: Foxl1 (forkhead box L1 [Source:MGI Symbol;Acc:MGI:1347469])

HSP 1 Score: 164.081 bits (414), Expect = 5.141e-45
Identity = 70/128 (54.69%), Postives = 93/128 (72.66%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDD 920
            KPPYSYIALI MA+   PE++VTL+GIYQFIM++FP+Y +N+QGWQNSIRHNLSLNECF+K+PR+  +PGKGSYW L P+  +MFENG++ RR+R  K K      E ++ + +  E  +       D
Sbjct:   49 KPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRKR--KPKPAAGSPEAKRTRVEPPESEVGCDVGSPD 174          
BLAST of Forkhead box C1 vs. Ensembl Mouse
Match: Foxb1 (forkhead box B1 [Source:MGI Symbol;Acc:MGI:1927549])

HSP 1 Score: 162.155 bits (409), Expect = 1.810e-44
Identity = 69/98 (70.41%), Postives = 82/98 (83.67%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFK 830
            KPPYSYI+L  MA+ + PEK + LS IY+FIM++FPYYREN Q WQNS+RHNLS N+CFIKIPR   +PGKGS+WALHP   +MFENGSFLRRR+RFK
Sbjct:   13 KPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK 110          
BLAST of Forkhead box C1 vs. Ensembl Mouse
Match: Foxa3 (forkhead box A3 [Source:MGI Symbol;Acc:MGI:1347477])

HSP 1 Score: 158.303 bits (399), Expect = 9.456e-43
Identity = 68/102 (66.67%), Postives = 84/102 (82.35%), Query Frame = 3
Query:  534 VKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKD 839
             KPPYSYI+LITMA+   P K +TLS IYQ+IM+ FPYYREN+Q WQNSIRH+LS N+CF+K+ R   KPGKGSYWALHP + NMFENG +LRR++RFK ++
Sbjct:  118 AKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEE 219          
BLAST of Forkhead box C1 vs. UniProt/SwissProt
Match: sp|Q9DE24|FXC1B_DANRE (Forkhead box C1-B OS=Danio rerio OX=7955 GN=foxc1b PE=2 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 1.234e-58
Identity = 103/190 (54.21%), Postives = 137/190 (72.11%), Query Frame = 3
Query:  414 YSTSYSMGNSPIPNARFLTHYGSHSNHPN-MSSSRNP------SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVISKNG 962
            Y T+   G + +P    +  + +H  +P  M+ +  P       +D+VKPPYSYIALITMA+    +KK+TL+GIYQFIME+FP+YR+NKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KDVL+++EDR R+ ++   N   +  +D  +  +   + ++NG
Sbjct:   26 YRTATGGGYTGMPAPMSMYSHATHEQYPGGMARAYGPYAPAQQPKDMVKPPYSYIALITMAIQNSSDKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVLREKEDRDRQGKD---NPGQACEQDAQQPVKLRDIKTENG 212          
BLAST of Forkhead box C1 vs. UniProt/SwissProt
Match: sp|Q9DE25|FXC1A_DANRE (Forkhead box C1-A OS=Danio rerio OX=7955 GN=foxc1a PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.834e-58
Identity = 99/161 (61.49%), Postives = 124/161 (77.02%), Query Frame = 3
Query:  414 YSTSYSMGNSPIPNARFLTHYGSHSNHP-NMSSSRNP------SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQ 875
            Y  +   G + +P    +  + +H  +P +M+ +  P       +D+VKPPYSYIALITMA+   P+KKVTL+GIYQFIME+FP+YR+NKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KD ++D+EDR  K+
Sbjct:   26 YRAAAGGGYTGMPAPMTMYSHAAHDQYPASMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNSPDKKVTLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAMKDKEDRGVKE 186          
BLAST of Forkhead box C1 vs. UniProt/SwissProt
Match: sp|Q63246|FOXC2_RAT (Forkhead box protein C2 OS=Rattus norvegicus OX=10116 GN=Foxc2 PE=1 SV=2)

HSP 1 Score: 205.682 bits (522), Expect = 6.191e-58
Identity = 105/176 (59.66%), Postives = 125/176 (71.02%), Query Frame = 3
Query:  477 GSHSNHP-----NMSSSRNP-------SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIF---TSTSKDDDEKNEKLSVISKN 959
            G +S HP      M  S  P        +DLVKPPYSYIALITMA+   PEKK+TL+GIYQFIM++FP+YRENKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KDV +D+E+R   ++    +     T T   D  K  +  V+ K+
Sbjct:   39 GVYSGHPEQYGAGMGRSYAPYHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVPKDKEERAHLKEPPPASAKGAPTGTPVADGPKEAEKKVVVKS 214          
BLAST of Forkhead box C1 vs. UniProt/SwissProt
Match: sp|Q61850|FOXC2_MOUSE (Forkhead box protein C2 OS=Mus musculus OX=10090 GN=Foxc2 PE=1 SV=2)

HSP 1 Score: 205.297 bits (521), Expect = 7.683e-58
Identity = 106/176 (60.23%), Postives = 123/176 (69.89%), Query Frame = 3
Query:  477 GSHSNHP-----NMSSSRNP-------SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDR---KRKQQEDECNIFTSTSKDDDEKNEKLSVISKN 959
            G +S HP      M  S  P        +DLVKPPYSYIALITMA+   PEKK+TL+GIYQFIM++FP+YRENKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KDV +D+E+R   K           T T   D  K  +  V+ K+
Sbjct:   39 GVYSGHPEQYGAGMGRSYAPYHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVPKDKEERAHLKEPPSTTAKGAPTGTPVADGPKEAEKKVVVKS 214          
BLAST of Forkhead box C1 vs. UniProt/SwissProt
Match: sp|Q6NVT7|FOXC2_XENTR (Forkhead box protein C2 OS=Xenopus tropicalis OX=8364 GN=foxc2 PE=2 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 9.866e-58
Identity = 99/147 (67.35%), Postives = 118/147 (80.27%), Query Frame = 3
Query:  465 LTHYGSHSNH-PNMSSSRNP--------SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQ 878
            ++ Y +H  + P M+ S  P         +DLVKPPYSYIALITMA+   P+KK+TL+GIYQFIM++FP+YRENKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KDV +++EDR  K Q
Sbjct:   39 MSVYPAHEQYTPGMARSYGPYHHHQPAAPKDLVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSREKEDRILKDQ 185          
BLAST of Forkhead box C1 vs. TrEMBL
Match: A0A2Z4FS11 (FoxC OS=Branchiostoma lanceolatum OX=7740 PE=2 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 5.560e-61
Identity = 108/189 (57.14%), Postives = 136/189 (71.96%), Query Frame = 3
Query:  333 ANPGQ-GLIQQTYEHMSSYYGNSSLIPPYSTSYSMGNSPIPNARFL-THYGSHSN----HPNMSSSRNPSRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQE 881
              PG  G++   +   SSYY          TSYS  +  +P   +    YGS +      P  +S  + S+D+VKPPYSYIALI MA+   P+KKVTL+GIYQFIM++FPYYRENKQGWQNSIRHNLSLNECFIK+PRDDKKPGKGSYW+L P +YNMF+NGS+LRRRRRFK  D +++RED+ +K+Q+
Sbjct:   17 VGPGSLGVVSSLFGDQSSYYRQPL------TSYSGVSGGMPVGMYAHEQYGSVARPSPYGPAYASHHHTSKDMVKPPYSYIALIAMAIQNAPDKKVTLNGIYQFIMDRFPYYRENKQGWQNSIRHNLSLNECFIKVPRDDKKPGKGSYWSLDPDSYNMFDNGSYLRRRRRFKKADAVKEREDKSKKEQD 199          
BLAST of Forkhead box C1 vs. TrEMBL
Match: B3UYB7 (Winged helix/forkhead transcription factor FoxC OS=Branchiostoma floridae OX=7739 PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 2.432e-59
Identity = 108/186 (58.06%), Postives = 134/186 (72.04%), Query Frame = 3
Query:  333 ANPGQ-GLIQQTYEHMSSYYGNSSLIPPYSTSYSMGNSPIPNARFL-THYGSHSN----HPNMSSSRNPSRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRK 872
              PG  G++   +   SSYY       P S SYS  +  +P   +    YGS +      P  +S  + S+D+VKPPYSYIALI MA+   P+KKVTL+GIYQFIM++FPYYRENKQGWQNSIRHNLSLNECFIK+PRDDKKPGKGSYW+L P +YNMF+NGS+LRRRRRFK  D +++RED+ +K
Sbjct:   17 VGPGSLGVVSSLFGDQSSYYRQ-----PLS-SYSGVSGGMPVGMYAHEQYGSVARPSPYGPAYASHHHTSKDMVKPPYSYIALIAMAIQNAPDKKVTLNGIYQFIMDRFPYYRENKQGWQNSIRHNLSLNECFIKVPRDDKKPGKGSYWSLDPDSYNMFDNGSYLRRRRRFKKADAVKEREDKVKK 196          
BLAST of Forkhead box C1 vs. TrEMBL
Match: K7J6X2 (Fork-head domain-containing protein OS=Nasonia vitripennis OX=7425 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 2.488e-59
Identity = 103/168 (61.31%), Postives = 129/168 (76.79%), Query Frame = 3
Query:  519 PSRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDD-DEKNEKLSVISKNGDLNKSYSESVEHS---DQS 1010
            P +D+VKPPYSYIALITMA+   P+KK+TL+GIYQFIME+FPYYRENKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW+L P +YNMF+NGS+LRRRRRFK +D L+++E+  ++Q      +  +T+K   DE    L++      L  S S+SV  S   DQS
Sbjct:   65 PGKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMERFPYYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWSLDPDSYNMFDNGSYLRRRRRFKKQDALKEKEEALKRQ-----GLLPATAKQRLDETKSSLNIA-----LQSSASDSVGKSKLLDQS 222          
BLAST of Forkhead box C1 vs. TrEMBL
Match: A0A3Q1BCC4 (Forkhead box C1 OS=Amphiprion ocellaris OX=80972 GN=FOXC1 (1 of many) PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.012e-58
Identity = 102/179 (56.98%), Postives = 130/179 (72.63%), Query Frame = 3
Query:  435 GNSPIPNARFLTHYGSHSNHP-NMSSSRNP------SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVI 950
            G + +P    +  + +H  +P +M+ +  P       +D+VKPPYSYIALITMA+   PEKK+TL+GIYQFIME+FP+YR+NKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KDV +D+E+R R+ ++         S       EKL ++
Sbjct:   31 GYTGMPAPMSMYSHAAHDQYPASMARAYGPYTPQHQPKDMVKPPYSYIALITMAIQNSPEKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVQRDKEERDRQGKDPSARTTAPGSHQGSLLREKLKLV 209          
BLAST of Forkhead box C1 vs. TrEMBL
Match: A0A401P4Q8 (Fork-head domain-containing protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0010347 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.726e-58
Identity = 110/198 (55.56%), Postives = 145/198 (73.23%), Query Frame = 3
Query:  525 RDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVISKNGDLNK-----SYSESVEHSDQSQSIIEN---ELSQETKLGHDSSINNVNHTNN 1094
            +DLVKPPYSYIALITMA+   P+KK+TL+GIYQFIM++FP+YRENKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KD  +D+E+R R+Q+E +     S+  D  ++  +  V+ KN  ++      +  ES++  D S S+I++    ++    +  ++SI   N TNN
Sbjct:   67 KDLVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAARDKEERDRQQKEPKGGQNVSSQTDTCKEGAEKKVVVKNEAMSPGMPVITKVESLDSPDNS-SLIQDSPRSVASTPSVSTENSIPEPNPTNN 263          
BLAST of Forkhead box C1 vs. Ensembl Cavefish
Match: foxc1b (forkhead box C1b [Source:NCBI gene;Acc:79375])

HSP 1 Score: 198.364 bits (503), Expect = 1.703e-59
Identity = 92/113 (81.42%), Postives = 105/113 (92.92%), Query Frame = 3
Query:  525 RDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDR 863
            +D VKPPYSYIALITMA+ +  EK+VTL+GIYQFIME+FP+YRENKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KDVL+D+E+R
Sbjct:   68 KDAVKPPYSYIALITMAIQSSAEKRVTLNGIYQFIMERFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVLRDKEER 180          
BLAST of Forkhead box C1 vs. Ensembl Cavefish
Match: FOXC1 (forkhead box C1 [Source:HGNC Symbol;Acc:HGNC:3800])

HSP 1 Score: 202.601 bits (514), Expect = 2.193e-57
Identity = 90/116 (77.59%), Postives = 107/116 (92.24%), Query Frame = 3
Query:  525 RDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRK 872
            +D+VKPPYSYIALITMA+   P+KK+TL+GIYQFIME+FP+YR+NKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KD ++++EDR+ K
Sbjct:   79 KDMVKPPYSYIALITMAIQNSPDKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAMKEKEDRQVK 194          
BLAST of Forkhead box C1 vs. Ensembl Cavefish
Match: ENSAMXT00000003861.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000133.1:1175856:1177001:-1 gene:ENSAMXG00000003780.2 transcript:ENSAMXT00000003861.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.155 bits (409), Expect = 3.478e-46
Identity = 70/99 (70.71%), Postives = 83/99 (83.84%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKA 833
            KPPYSYI+L  MA+ + PEK + LS IY+FIME+FPYYREN Q WQNS+RHNLS N+CFIKIPR   +PGKGS+WALHP+  +MFENGSFLRRR+RFK 
Sbjct:   13 KPPYSYISLTAMAIQSCPEKMLPLSDIYKFIMERFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPRCGDMFENGSFLRRRKRFKV 111          
BLAST of Forkhead box C1 vs. Ensembl Cavefish
Match: foxl1 (forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1181])

HSP 1 Score: 159.073 bits (401), Expect = 7.321e-45
Identity = 68/111 (61.26%), Postives = 90/111 (81.08%), Query Frame = 3
Query:  504 SSSRNPSRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAK 836
            S+ R P +   KPPYSYIALI MA+ + PE++ TLSGIYQFIM+ FP+Y +NKQGWQNSIRHNLSLN+CF+K+PR+  +PGKGSYW L P+  +MFENG++ RR+R+ + +
Sbjct:   61 SARREPPQ---KPPYSYIALIAMAIKSAPEERATLSGIYQFIMDNFPFYHDNKQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPKCLDMFENGNYRRRKRKARGQ 168          
BLAST of Forkhead box C1 vs. Ensembl Cavefish
Match: foxb1a (forkhead box B1 [Source:NCBI gene;Acc:103044512])

HSP 1 Score: 162.155 bits (409), Expect = 1.192e-44
Identity = 69/98 (70.41%), Postives = 82/98 (83.67%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFK 830
            KPPYSYI+L  MA+ + PEK + LS IY+FIM++FPYYREN Q WQNS+RHNLS N+CFIKIPR   +PGKGS+WALHP   +MFENGSFLRRR+RFK
Sbjct:   13 KPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK 110          
BLAST of Forkhead box C1 vs. Ensembl Sea Lamprey
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 192.971 bits (489), Expect = 8.878e-59
Identity = 96/154 (62.34%), Postives = 115/154 (74.68%), Query Frame = 3
Query:  351 LIQQTYEHMSSYYGNSSLIPPYSTSYSMGNSPIPNARFLTHYGSHSNHPNMSSSRNPSRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLR 812
            L +Q +   +  YG     P     YS  N+   +A    HYG +S HP+ +      +DLVKPPYSYIALITMA+ + P+KKVTL+GIYQFIM+KFP+YRENKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW+L P +YNMFENGSFLR
Sbjct:   23 LSEQNFYRSAGGYGGLPAAP--VGMYSAANADPYSAGLSRHYGPYS-HPHQAP-----KDLVKPPYSYIALITMAIQSAPDKKVTLNGIYQFIMDKFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWSLDPDSYNMFENGSFLR 168          
BLAST of Forkhead box C1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002547.1 (pep scaffold:Pmarinus_7.0:GL485262:1354:7435:1 gene:ENSPMAG00000002324.1 transcript:ENSPMAT00000002547.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.844 bits (403), Expect = 1.784e-45
Identity = 67/95 (70.53%), Postives = 79/95 (83.16%), Query Frame = 3
Query:  525 RDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFL 809
            +DLVKPPYSYIALI MA+    E + TLS IYQFI  +FP+YRENKQGWQNSIRHNLSLNECF+ + RDD++PGKGS+W L P ++ MFENGSFL
Sbjct:   22 KDLVKPPYSYIALIAMAIQNSAEGRATLSAIYQFIAGRFPFYRENKQGWQNSIRHNLSLNECFVTVARDDRRPGKGSFWTLDPDSHGMFENGSFL 116          
BLAST of Forkhead box C1 vs. Ensembl Sea Lamprey
Match: foxb2 (forkhead box B2 [Source:ZFIN;Acc:ZDB-GENE-081104-320])

HSP 1 Score: 159.458 bits (402), Expect = 5.506e-44
Identity = 69/98 (70.41%), Postives = 81/98 (82.65%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFK 830
            KPPYSYI+L  MA+ +  EK + LS IY+FIME+FPYYREN Q WQNS+RHNLS N+CFIKIPR   +PGKGS+WALHP   +MFENGSFLRRR+RFK
Sbjct:   13 KPPYSYISLTAMAIQSSAEKMLPLSEIYKFIMERFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPACGDMFENGSFLRRRKRFK 110          
BLAST of Forkhead box C1 vs. Ensembl Sea Lamprey
Match: foxa2 (forkhead box A2 [Source:NCBI gene;Acc:30126])

HSP 1 Score: 156.762 bits (395), Expect = 3.794e-42
Identity = 70/125 (56.00%), Postives = 91/125 (72.80%), Query Frame = 3
Query:  534 VKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTST 908
             KPPYSYI+LITMA+     K +TL+ IY +IM+ FP+YR+N+Q WQNSIRH+LS N+CF+K+PR   KPGKGS+WALHP + NMFENG +LRR++RFK         DRK+K  +D     TS+
Sbjct:  160 AKPPYSYISLITMAIQQSTHKMMTLNEIYSWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWALHPDSGNMFENGCYLRRQKRFKC--------DRKQKMPQDGSRSPTSS 276          
BLAST of Forkhead box C1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005206.1 (pep scaffold:Pmarinus_7.0:GL479371:8768:18483:1 gene:ENSPMAG00000004735.1 transcript:ENSPMAT00000005206.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 4.958e-40
Identity = 62/100 (62.00%), Postives = 80/100 (80.00%), Query Frame = 3
Query:  534 VKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKA 833
             KPPYSYI+LITMA+     K +TL+ IY +I + FP+YR+N+Q WQNSIRH+LS N+CF+K+PR   KPGKGS+WALHP + NMFENG +LRR++RFK 
Sbjct:  154 AKPPYSYISLITMAIQQSSGKMLTLNEIYSWITDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWALHPDSGNMFENGCYLRRQKRFKC 253          
BLAST of Forkhead box C1 vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 98.2117 bits (243), Expect = 7.922e-22
Identity = 47/109 (43.12%), Postives = 64/109 (58.72%), Query Frame = 3
Query:  534 VKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWAL----HPQAYNMFENGSFLRRRRRFKAKDVLQ 848
            VKPP+SY  +IT A+ + PE  ++L+ IY++I   + YYR  K GWQNSIRHNLSLN+ F K+PR   +PGKG  W +      +  N +  G   + RR       LQ
Sbjct:  339 VKPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISESYQQEFLNKWNTGKVGKIRRGSSVARQLQ 447          
BLAST of Forkhead box C1 vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 93.5893 bits (231), Expect = 1.629e-20
Identity = 51/105 (48.57%), Postives = 61/105 (58.10%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQD 851
            KPPYSY  LI +A+    E K+TLS IY +I   FPYY++    WQNSIRHNLSLN+ FIK  +     GKG +W + P A   F  G    R   F  KD LQD
Sbjct:  109 KPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSCD--GKGHFWEVRPGAETKFFKGE--NRGYEF-VKDSLQD 208          
BLAST of Forkhead box C1 vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 89.7373 bits (221), Expect = 2.107e-19
Identity = 42/109 (38.53%), Postives = 64/109 (58.72%), Query Frame = 3
Query:  534 VKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFEN----GSFLRRRRRFKAKDVLQ 848
            +KPP SY ++IT A+ + PE  ++L+ IY+FI + + +YR ++  WQNS+RHNLSLN+ F K+P+   + GKG  W +  +    F N    G   + RR       LQ
Sbjct:  302 IKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDFLNKWNAGKLSKIRRGASVTRQLQ 410          
BLAST of Forkhead box C1 vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 70.8626 bits (172), Expect = 3.403e-13
Identity = 40/101 (39.60%), Postives = 54/101 (53.47%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKK-VTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAK 836
            KP  SY A++T  +  +   K ++LS IY  I E FPYY+    GWQ+S+RHNLSLN+ F K+     K GKG  W L         +  ++  R R K K
Sbjct:  461 KPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKV----SKEGKGWLWGL---------DEEYIAERERQKKK 548          
BLAST of Forkhead box C1 vs. Ensembl Nematostella
Match: EDO33900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQU5])

HSP 1 Score: 187.578 bits (475), Expect = 5.886e-53
Identity = 110/236 (46.61%), Postives = 145/236 (61.44%), Query Frame = 3
Query:  402 LIPP------YSTSYSMGNSPIPNARFLTHYGSHSNH------PNMSSSRNPSR-DLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVISKNGDLNKSYSESVEHSDQSQSIIENELSQETKLGHDSSI 1070
            +IPP      Y   Y  G+SP  +  F   YG +         P +  S++P+R D+VKPPYSYIALI MA+ + PEK++TLSGIY FIM++FPYYR NKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGS+W L P + NMFENGS+LRRR+RF+ KDV +  E   ++ + D  ++  ST++ +                    + S E +DQ++    N  S   K   DS I
Sbjct:   22 MIPPVYANQGYEGFYRPGSSPYSSVHFPV-YGQYDARQERYYGPPLPRSQHPTRQDMVKPPYSYIALIAMAIQSAPEKRITLSGIYSFIMDRFPYYRNNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSFWMLDPDSLNMFENGSYLRRRKRFRKKDVQKSMEGESQR-KSDGTSVENSTARSETS------------------TTSAEQNDQNEGEDSNSSSGAAKAESDSPI 237          
BLAST of Forkhead box C1 vs. Ensembl Nematostella
Match: EDO42492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1E3])

HSP 1 Score: 161.384 bits (407), Expect = 3.983e-45
Identity = 68/101 (67.33%), Postives = 83/101 (82.18%), Query Frame = 3
Query:  534 VKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAK 836
             KPPYSYI+LITMA+   P K +TLS IYQFIM+ FPYYR+N+Q WQNSIRH+LS N+CF+K+PR   +PGKGSYW LHP   NMFENG +LRR++RFKA+
Sbjct:   39 AKPPYSYISLITMAIQQSPNKMLTLSEIYQFIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDRPGKGSYWTLHPDCGNMFENGCYLRRQKRFKAE 139          
BLAST of Forkhead box C1 vs. Ensembl Nematostella
Match: EDO39562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S5])

HSP 1 Score: 160.229 bits (404), Expect = 4.597e-45
Identity = 75/145 (51.72%), Postives = 100/145 (68.97%), Query Frame = 3
Query:  534 VKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDE--KNEKLSVISKNG 962
             KPPYSYI+L  MA+ + P+K ++LS IYQFIM+ FP+YR+N Q WQNS+RHNLS N+CF+KIPR   +PGKGS WALHP    MFENGSFLRRR+RFK+          +R++      + ++T +D+DE   +E+ S  S  G
Sbjct:   12 AKPPYSYISLTAMAIQSSPQKMLSLSEIYQFIMDHFPFYRDNTQRWQNSLRHNLSFNDCFVKIPRRPDQPGKGSLWALHPDCGTMFENGSFLRRRKRFKS----------ERERTSKLAKLISATREDEDELSPSEQESAPSPTG 146          
BLAST of Forkhead box C1 vs. Ensembl Nematostella
Match: EDO39529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S2])

HSP 1 Score: 147.517 bits (371), Expect = 3.311e-42
Identity = 66/104 (63.46%), Postives = 84/104 (80.77%), Query Frame = 3
Query:  528 DLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDD-KKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAK 836
            D VKPP+SYIALITM++ A P +  TL+ IY+FIM +FPY+R+N+Q WQNSIRHNLSLN+CF+K+PR    KPGKG+YW LHP   +MF +GSFLRR +RFK +
Sbjct:   13 DEVKPPFSYIALITMSIEASPYRMRTLNEIYEFIMTRFPYFRKNQQKWQNSIRHNLSLNDCFVKVPRSIFGKPGKGNYWTLHPSCGDMFGSGSFLRRPKRFKCR 116          
BLAST of Forkhead box C1 vs. Ensembl Nematostella
Match: EDO42654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W7])

HSP 1 Score: 141.739 bits (356), Expect = 2.375e-40
Identity = 63/92 (68.48%), Postives = 75/92 (81.52%), Query Frame = 3
Query:  531 LVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSF 806
            L KPPYSY+ALI+MA+     +K+TLSGIYQFI+E FPYYR NK+GWQNSIRHNLSLN+CF+KIPR+   PGKG YWAL P    MFE+G+F
Sbjct:    1 LPKPPYSYVALISMAIKQSKGQKITLSGIYQFIIENFPYYRLNKRGWQNSIRHNLSLNKCFVKIPRERSDPGKGCYWALDPAYEEMFEDGNF 92          
BLAST of Forkhead box C1 vs. Ensembl Medaka
Match: foxc1 (forkhead box C1 [Source:NCBI gene;Acc:100301605])

HSP 1 Score: 204.912 bits (520), Expect = 5.706e-59
Identity = 97/152 (63.82%), Postives = 119/152 (78.29%), Query Frame = 3
Query:  435 GNSPIPNARFLTHYGSHSNHPNMSSSRNP------SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRK 872
            G + +P    +  + +H  +P   +   P       +D+VKPPYSYIALITMA+   PEKK+TL+GIYQFIME+FP+YR+NKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KDV +++EDR R+
Sbjct:   31 GYTGMPAPMSMYSHAAHDQYPASMARYGPYTPPHQPKDMVKPPYSYIALITMAIQNSPEKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVQREKEDRDRQ 182          
BLAST of Forkhead box C1 vs. Ensembl Medaka
Match: foxc1a (forkhead box C1-A [Source:NCBI gene;Acc:111949083])

HSP 1 Score: 202.986 bits (515), Expect = 4.051e-58
Identity = 98/161 (60.87%), Postives = 125/161 (77.64%), Query Frame = 3
Query:  414 YSTSYSMGNSPIPNARFLTHYGSHSNHP-NMSSSRNP------SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQ 875
            Y  +   G + +P    +  + +H  +P +M+ +  P       +D+VKPPYSYIALITMA+   P+KKVTL+GIYQFIME+FP+YR+NKQGWQNSIRHNLSLNECF+K+PRDDKKPGKGSYW L P +YNMFENGSFLRRRRRFK KD L+++E+R +K+
Sbjct:   26 YRAAAGGGYTGMPAPMNMYSHAAHDQYPASMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNSPDKKVTLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDALKEKEERLQKE 186          
BLAST of Forkhead box C1 vs. Ensembl Medaka
Match: foxb1 (forkhead box B1 [Source:NCBI gene;Acc:100301603])

HSP 1 Score: 167.548 bits (423), Expect = 1.071e-46
Identity = 84/174 (48.28%), Postives = 109/174 (62.64%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVISKNG---------DLNKSYSESVEHSDQSQSIIENE 1031
            KPPYSYI+L  MA+ + PEK + LS IY+FIM++FPYYREN Q WQNS+RHNLS N+CFIKIPR   +PGKGS+WALHP   +MFENGSFLRRR+RFK   VL   +     +Q D  +     +K       +LS ++  G         +L  S S + +H    ++II  E
Sbjct:   13 KPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPNCGDMFENGSFLRRRKRFK---VLAASDTLIPTKQSDAAHYLQQQAK------LRLSALAATGTHLPQMSTYNLGVSQSTTFKHPFAIENIIARE 177          
BLAST of Forkhead box C1 vs. Ensembl Medaka
Match: foxa2 (Me-HNF3b protein [Source:NCBI gene;Acc:100049256])

HSP 1 Score: 164.081 bits (414), Expect = 2.059e-44
Identity = 79/168 (47.02%), Postives = 110/168 (65.48%), Query Frame = 3
Query:  498 NMSSSRNP-----SRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVISKNGDLNKSYSE 986
            N++ SR+P     S    KPPYSYI+LITMA+   P K +TL+ IYQ+IM+ FP+YR+N+Q WQNSIRH+LS N+CF+K+PR   KPGKGS+W LHP + NMFENG +LRR++RFK +  +  +E  ++       N    +S D    NE     S +G+  +S S+
Sbjct:  132 NINRSRDPKTYRRSYTHAKPPYSYISLITMAIQQSPSKMLTLAEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKKMSMKEPGRKGGDGGSAN----SSSDSCNGNESPHSNSSSGEHKRSLSD 295          
BLAST of Forkhead box C1 vs. Ensembl Medaka
Match: ENSORLT00000046813.1 (forkhead box protein B1-like [Source:NCBI gene;Acc:111947185])

HSP 1 Score: 159.844 bits (403), Expect = 6.637e-44
Identity = 69/99 (69.70%), Postives = 82/99 (82.83%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKA 833
            KPPYSYI+L  MA+ + PEK + LS IY+FIM++FPYYREN Q WQNS+RHNLS N+CFIKIPR   +PGKGS+WALHP   +MFENGSFLRRR+RFK 
Sbjct:   13 KPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPNCGDMFENGSFLRRRKRFKV 111          
BLAST of Forkhead box C1 vs. Planmine SMEST
Match: SMESG000015673.1 (SMESG000015673.1)

HSP 1 Score: 846.269 bits (2185), Expect = 0.000e+0
Identity = 434/435 (99.77%), Postives = 435/435 (100.00%), Query Frame = 3
Query:  321 MSCLANPGQGLIQQTYEHMSSYYGNSSLIPPYSTSYSMGNSPIPNARFLTHYGSHSNHPNMSSSRNPSRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVISKNGDLNKSYSESVEHSDQSQSIIENELSQETKLGHDSSINNVNHTNNETFQNRTSQFETSLGGSEDNPFHFDDNKNLTSXXXXXXXXXMKNESSDSIPFPLTLTNTNEGLSVNNNTNSDYFQFMGRYAGQESTDVSTAFSSVTNHSGDLEDHIQNYQQLSAFQNYTNPHSSLTXXXXXXXXXXXHDTNSVLGYPISNNYNASSSILGCNPNMPFSGSLSPHSAQ 1625
            MSCLANPGQGLIQQTYEHMSSYYGNSSLIPPYSTSYSMGNSPIPNARFLTHYGSHSNHPNMSSSRNPSRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVISKNGDLNKSYSESVEHSDQSQSI+ENELSQETKLGHDSSINNVNHTNNETFQNRTSQFETSLGGSEDNPFHFDDNKNLTSFNNFGNGFFMKNESSDSIPFPLTLTNTNEGLSVNNNTNSDYFQFMGRYAGQESTDVSTAFSSVTNHSGDLEDHIQNYQQLSAFQNYTNPHSSLTAAAAAAWYAAAHDTNSVLGYPISNNYNASSSILGCNPNMPFSGSLSPHSAQ
Sbjct:    1 MSCLANPGQGLIQQTYEHMSSYYGNSSLIPPYSTSYSMGNSPIPNARFLTHYGSHSNHPNMSSSRNPSRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKLSVISKNGDLNKSYSESVEHSDQSQSIVENELSQETKLGHDSSINNVNHTNNETFQNRTSQFETSLGGSEDNPFHFDDNKNLTSFNNFGNGFFMKNESSDSIPFPLTLTNTNEGLSVNNNTNSDYFQFMGRYAGQESTDVSTAFSSVTNHSGDLEDHIQNYQQLSAFQNYTNPHSSLTAAAAAAWYAAAHDTNSVLGYPISNNYNASSSILGCNPNMPFSGSLSPHSAQ 435          
BLAST of Forkhead box C1 vs. Planmine SMEST
Match: SMESG000004239.1 (SMESG000004239.1)

HSP 1 Score: 194.126 bits (492), Expect = 1.088e-55
Identity = 85/109 (77.98%), Postives = 97/109 (88.99%), Query Frame = 3
Query:  513 RNPSRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKD 839
            +N +R LVKPPYSYIALITMA+ + P+ ++TL+GIYQFI E+FPYYRENKQGWQNSIRHNLSLNECFIK+ R D++ GKGSYW LHP AYNMFENGSFLRRRRRFK KD
Sbjct:  138 KNDNRSLVKPPYSYIALITMAITSQPDHRITLNGIYQFISERFPYYRENKQGWQNSIRHNLSLNECFIKVSRGDQRSGKGSYWTLHPNAYNMFENGSFLRRRRRFKYKD 246          
BLAST of Forkhead box C1 vs. Planmine SMEST
Match: SMESG000067799.1 (SMESG000067799.1)

HSP 1 Score: 155.221 bits (391), Expect = 8.318e-43
Identity = 67/98 (68.37%), Postives = 81/98 (82.65%), Query Frame = 3
Query:  537 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFK 830
            KPPYSYI+LITMA+   P+K  TLS IYQFIM+ FPYY++N+Q WQNSIRH+LS N+CFIK  R  +KPGKGS+W LHP + NMFENG FLRR++RFK
Sbjct:   46 KPPYSYISLITMAIQNSPQKMCTLSEIYQFIMDSFPYYQQNQQRWQNSIRHSLSFNDCFIKASRCTEKPGKGSFWVLHPDSGNMFENGCFLRRQKRFK 143          
BLAST of Forkhead box C1 vs. Planmine SMEST
Match: SMESG000021434.1 (SMESG000021434.1)

HSP 1 Score: 154.066 bits (388), Expect = 3.071e-42
Identity = 70/115 (60.87%), Postives = 86/115 (74.78%), Query Frame = 3
Query:  531 LVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQ 875
            L KPPYSYIALI MA+   P+KK+TLSGIY+FI + FP+Y  NKQGWQNSIRHNLSLN+CFIKI RD   PGKG+YW L+     MF++G+F RRRR+ K+    QD +D +  Q
Sbjct:   62 LEKPPYSYIALIAMAIRNTPDKKITLSGIYKFITDNFPFYHRNKQGWQNSIRHNLSLNDCFIKIARDKNNPGKGNYWTLNENFEEMFDHGNFRRRRRKTKSLTNKQDCQDSESHQ 176          
BLAST of Forkhead box C1 vs. Planmine SMEST
Match: SMESG000065670.1 (SMESG000065670.1)

HSP 1 Score: 158.688 bits (400), Expect = 5.139e-42
Identity = 67/99 (67.68%), Postives = 81/99 (81.82%), Query Frame = 3
Query:  534 VKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFK 830
             KPPYSYI+LITMA+   P    TLS IYQFIM+ FPYYR+N+Q WQNSIRH+LS N+CF+K+ R  +KPGKGSYW LHPQ+ NMFENG +LRR++RFK
Sbjct:  107 AKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 205          
The following BLAST results are available for this feature:
BLAST of Forkhead box C1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXC21.016e-5680.53forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
FOXC14.110e-5568.94forkhead box C1 [Source:HGNC Symbol;Acc:HGNC:3800][more]
FOXB12.745e-4470.41forkhead box B1 [Source:HGNC Symbol;Acc:HGNC:3799][more]
FOXL16.766e-4366.33forkhead box L1 [Source:HGNC Symbol;Acc:HGNC:3817][more]
FOXA31.845e-4264.76forkhead box A3 [Source:HGNC Symbol;Acc:HGNC:5023][more]
back to top
BLAST of Forkhead box C1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pha-41.929e-3955.65Defective pharyngeal development protein 4 [Sourc... [more]
pha-42.546e-3955.65Defective pharyngeal development protein 4 [Sourc... [more]
pha-45.751e-3955.65Defective pharyngeal development protein 4 [Sourc... [more]
unc-1308.359e-3863.64pep chromosome:WBcel235:II:11281986:11283953:1 gen... [more]
lin-318.402e-3561.46pep chromosome:WBcel235:II:3982549:3986944:1 gene:... [more]
back to top
BLAST of Forkhead box C1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
croc1.344e-5272.65gene:FBgn0014143 transcript:FBtr0078395[more]
fd96Ca3.104e-4543.85gene:FBgn0004897 transcript:FBtr0339246[more]
fd96Ca3.104e-4543.85gene:FBgn0004897 transcript:FBtr0084770[more]
fd96Cb1.224e-4260.00gene:FBgn0004898 transcript:FBtr0084771[more]
fd59A1.434e-4265.09gene:FBgn0004896 transcript:FBtr0071898[more]
back to top
BLAST of Forkhead box C1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxc1b1.635e-5954.21forkhead box C1b [Source:NCBI gene;Acc:79375][more]
foxc1a2.430e-5961.49forkhead box C1a [Source:NCBI gene;Acc:100148408][more]
foxl11.878e-4553.19forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1... [more]
foxl11.878e-4553.19forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1... [more]
foxb1a9.839e-4569.70forkhead box B1a [Source:ZFIN;Acc:ZDB-GENE-990616-... [more]
back to top
BLAST of Forkhead box C1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxc21.877e-5867.35forkhead box C2 [Source:NCBI gene;Acc:407875][more]
myh103.462e-5776.86myosin, heavy chain 10, non-muscle [Source:Xenbase... [more]
FOXL12.980e-4457.94forkhead box L1 [Source:HGNC Symbol;Acc:HGNC:3817][more]
foxa24.245e-4453.62forkhead box A2 [Source:NCBI gene;Acc:395063][more]
serpinc12.395e-4368.69serpin peptidase inhibitor, clade C (antithrombin)... [more]
back to top
BLAST of Forkhead box C1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxc21.098e-5860.23forkhead box C2 [Source:MGI Symbol;Acc:MGI:1347481... [more]
Foxc12.499e-5568.94forkhead box C1 [Source:MGI Symbol;Acc:MGI:1347466... [more]
Foxl15.141e-4554.69forkhead box L1 [Source:MGI Symbol;Acc:MGI:1347469... [more]
Foxb11.810e-4470.41forkhead box B1 [Source:MGI Symbol;Acc:MGI:1927549... [more]
Foxa39.456e-4366.67forkhead box A3 [Source:MGI Symbol;Acc:MGI:1347477... [more]
back to top
BLAST of Forkhead box C1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DE24|FXC1B_DANRE1.234e-5854.21Forkhead box C1-B OS=Danio rerio OX=7955 GN=foxc1b... [more]
sp|Q9DE25|FXC1A_DANRE1.834e-5861.49Forkhead box C1-A OS=Danio rerio OX=7955 GN=foxc1a... [more]
sp|Q63246|FOXC2_RAT6.191e-5859.66Forkhead box protein C2 OS=Rattus norvegicus OX=10... [more]
sp|Q61850|FOXC2_MOUSE7.683e-5860.23Forkhead box protein C2 OS=Mus musculus OX=10090 G... [more]
sp|Q6NVT7|FOXC2_XENTR9.866e-5867.35Forkhead box protein C2 OS=Xenopus tropicalis OX=8... [more]
back to top
BLAST of Forkhead box C1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Z4FS115.560e-6157.14FoxC OS=Branchiostoma lanceolatum OX=7740 PE=2 SV=... [more]
B3UYB72.432e-5958.06Winged helix/forkhead transcription factor FoxC OS... [more]
K7J6X22.488e-5961.31Fork-head domain-containing protein OS=Nasonia vit... [more]
A0A3Q1BCC41.012e-5856.98Forkhead box C1 OS=Amphiprion ocellaris OX=80972 G... [more]
A0A401P4Q81.726e-5855.56Fork-head domain-containing protein OS=Scyliorhinu... [more]
back to top
BLAST of Forkhead box C1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxc1b1.703e-5981.42forkhead box C1b [Source:NCBI gene;Acc:79375][more]
FOXC12.193e-5777.59forkhead box C1 [Source:HGNC Symbol;Acc:HGNC:3800][more]
ENSAMXT00000003861.23.478e-4670.71pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
foxl17.321e-4561.26forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1... [more]
foxb1a1.192e-4470.41forkhead box B1 [Source:NCBI gene;Acc:103044512][more]
back to top
BLAST of Forkhead box C1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXC28.878e-5962.34forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
ENSPMAT00000002547.11.784e-4570.53pep scaffold:Pmarinus_7.0:GL485262:1354:7435:1 gen... [more]
foxb25.506e-4470.41forkhead box B2 [Source:ZFIN;Acc:ZDB-GENE-081104-3... [more]
foxa23.794e-4256.00forkhead box A2 [Source:NCBI gene;Acc:30126][more]
ENSPMAT00000005206.14.958e-4062.00pep scaffold:Pmarinus_7.0:GL479371:8768:18483:1 ge... [more]
back to top
BLAST of Forkhead box C1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
FKH27.922e-2243.12Forkhead family transcription factor; rate-limitin... [more]
HCM11.629e-2048.57Forkhead transcription factor; drives S-phase acti... [more]
FKH12.107e-1938.53Forkhead family transcription factor; rate-limitin... [more]
FHL13.403e-1339.60Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of Forkhead box C1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO339005.886e-5346.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424923.983e-4567.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395624.597e-4551.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395293.311e-4263.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426542.375e-4068.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Forkhead box C1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxc15.706e-5963.82forkhead box C1 [Source:NCBI gene;Acc:100301605][more]
foxc1a4.051e-5860.87forkhead box C1-A [Source:NCBI gene;Acc:111949083][more]
foxb11.071e-4648.28forkhead box B1 [Source:NCBI gene;Acc:100301603][more]
foxa22.059e-4447.02Me-HNF3b protein [Source:NCBI gene;Acc:100049256][more]
ENSORLT00000046813.16.637e-4469.70forkhead box protein B1-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Forkhead box C1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015673.10.000e+099.77SMESG000015673.1[more]
SMESG000004239.11.088e-5577.98SMESG000004239.1[more]
SMESG000067799.18.318e-4368.37SMESG000067799.1[more]
SMESG000021434.13.071e-4260.87SMESG000021434.1[more]
SMESG000065670.15.139e-4267.68SMESG000065670.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035307 ID=SMED30035307|Name=Forkhead box C1|organism=Schmidtea mediterranea sexual|type=transcript|length=1828bp
CAAACTTAAGCTTATTTAAAGAAATAAATCGTTAATATTCAATGCAGCTT
TGCAAATTCGAAGTTAATTCATCAAATAGTTCAATAACAGCTTCCGGATC
AAATGGACCATTATTTTTGCCGTCTTTAGCAACGGTAGCTAACAACTGTC
ATTTACCTCTAAATGTCAGTAACAGCAATAACAACCAAAATGATGAACCT
CCTTTTATTTCATGGAATCCAACTAACATGGCTGCTTGCTACAATCAAGG
ACTTGCATCTCCAAAACCAGCATCATTTTGGGCTGCTTCAAACAATGGAT
CGCTTAATTCAAACAATTTTATGTCTTGCCTAGCTAATCCTGGTCAAGGT
TTAATTCAACAGACATATGAACACATGTCCAGTTATTATGGGAATTCTAG
TCTTATCCCACCATACAGCACGAGTTATTCAATGGGCAATAGTCCAATTC
CAAATGCAAGGTTTCTGACACACTACGGAAGCCATTCAAATCATCCAAAT
ATGTCCTCATCAAGAAATCCATCAAGAGATCTTGTAAAACCTCCCTATTC
ATATATAGCTTTGATTACCATGGCTGTTCATGCGCATCCAGAAAAAAAAG
TCACCTTAAGTGGGATATATCAATTTATAATGGAAAAATTCCCATACTAT
CGTGAAAATAAACAAGGCTGGCAAAATTCAATTCGACACAATTTATCGTT
AAATGAATGTTTTATAAAAATACCAAGAGATGACAAGAAACCCGGAAAAG
GTTCATATTGGGCACTGCACCCTCAAGCGTACAATATGTTTGAAAACGGT
TCTTTTTTAAGAAGGCGACGACGATTTAAAGCAAAAGATGTTCTCCAGGA
TCGTGAAGATAGGAAAAGAAAACAACAGGAAGATGAATGTAACATTTTTA
CATCTACAAGCAAAGATGACGATGAAAAAAATGAAAAACTTTCAGTTATA
TCTAAAAATGGAGATTTAAACAAAAGTTATTCAGAAAGTGTCGAACATTC
AGATCAGAGTCAAAGTATAATAGAGAATGAATTATCACAAGAAACAAAAC
TTGGTCATGATTCATCAATTAACAACGTGAACCATACAAACAATGAAACA
TTCCAAAATAGAACATCACAATTCGAAACATCTTTAGGTGGATCAGAGGA
TAACCCTTTTCATTTCGACGATAACAAGAATTTAACTTCATTTAACAATT
TTGGCAATGGATTTTTCATGAAAAATGAATCATCAGATTCAATACCATTT
CCATTAACTCTGACAAACACAAATGAAGGGCTCTCAGTAAATAATAATAC
GAATTCAGACTACTTTCAATTCATGGGTAGATATGCAGGTCAAGAATCAA
CTGACGTTTCCACGGCGTTTAGTTCTGTCACAAATCACAGTGGAGATTTA
GAAGATCATATTCAAAATTATCAGCAATTGTCTGCATTTCAAAATTACAC
TAACCCACATTCTAGTCTGACAGCAGCCGCTGCAGCTGCTTGGTATGCAG
CAGCTCATGATACCAATTCAGTCCTAGGATATCCAATTTCTAATAACTAC
AATGCATCATCTAGCATATTAGGCTGCAATCCGAATATGCCTTTTTCTGG
TTCCTTGTCTCCTCATTCAGCACAGGTATCAAATACCAGTTCATCGATGA
CCACTAGTCAAAGCAATACAATATCATCATTTTTCAATAACACTGATTTG
GTGGGCTCATTAAATTTCGGTGCTGGAATACTCTCTTCAAATAGTCCTAA
TTATATTCCAACACATCATCCCAGTTTAACAAATTATTACTTAATTTAAT
ATATCATTTTTGATTATTTTGTAAATAA
back to top

protein sequence of SMED30035307-orf-1

>SMED30035307-orf-1 ID=SMED30035307-orf-1|Name=SMED30035307-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=586bp
MQLCKFEVNSSNSSITASGSNGPLFLPSLATVANNCHLPLNVSNSNNNQN
DEPPFISWNPTNMAACYNQGLASPKPASFWAASNNGSLNSNNFMSCLANP
GQGLIQQTYEHMSSYYGNSSLIPPYSTSYSMGNSPIPNARFLTHYGSHSN
HPNMSSSRNPSRDLVKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKF
PYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMF
ENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDDDEKNEKL
SVISKNGDLNKSYSESVEHSDQSQSIIENELSQETKLGHDSSINNVNHTN
NETFQNRTSQFETSLGGSEDNPFHFDDNKNLTSFNNFGNGFFMKNESSDS
IPFPLTLTNTNEGLSVNNNTNSDYFQFMGRYAGQESTDVSTAFSSVTNHS
GDLEDHIQNYQQLSAFQNYTNPHSSLTAAAAAAWYAAAHDTNSVLGYPIS
NNYNASSSILGCNPNMPFSGSLSPHSAQVSNTSSSMTTSQSNTISSFFNN
TDLVGSLNFGAGILSSNSPNYIPTHHPSLTNYYLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008045motor neuron axon guidance
GO:0033339pectoral fin development
GO:0051216cartilage development
GO:0060059embryonic retina morphogenesis in camera-type eye
GO:0006355regulation of transcription, DNA-templated
GO:0001568blood vessel development
GO:0001755neural crest cell migration
GO:0001756somitogenesis
GO:0001944vasculature development
GO:0006351transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0007507heart development
GO:0030325adrenal gland development
GO:0039021pronephric glomerulus development
GO:0040036regulation of fibroblast growth factor receptor signaling pathway
GO:0043010camera-type eye development
GO:0043114regulation of vascular permeability
GO:0048387negative regulation of retinoic acid receptor signaling pathway
GO:0061300cerebellum vasculature development
GO:0061386closure of optic fissure
GO:0072015glomerular visceral epithelial cell development
GO:0072149glomerular visceral epithelial cell fate commitment
GO:1902366regulation of Notch signaling pathway involved in somitogenesis
GO:2000583regulation of platelet-derived growth factor receptor-alpha signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000420parapharyngeal region
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR030456TF_fork_head_CS_2
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
GO:0003682chromatin binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 166..179
score: 73.13
coord: 210..227
score: 77.69
coord: 187..204
score: 57.85
IPR001766Fork head domainSMARTSM00339forkneu4coord: 164..254
e-value: 7.8E-57
score: 204.8
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 166..251
e-value: 4.0E-38
score: 129.6
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 166..260
score: 40.524
IPR001766Fork head domainCDDcd00059FHcoord: 166..243
e-value: 6.14943E-48
score: 159.642
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 165..265
e-value: 7.8E-46
score: 156.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 266..298
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 311..332
NoneNo IPR availablePANTHERPTHR11829:SF189FORKHEAD BOX PROTEIN C2coord: 149..298
NoneNo IPR availablePANTHERPTHR11829FORKHEAD BOX PROTEINcoord: 149..298
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 210..216
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 165..260