EF-hand domain-containing protein

Overview
NameEF-hand domain-containing protein
Smed IDSMED30035304
Length (bp)781
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035304

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30035304h1SMcG0018204 Contig4731_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30035304h1SMcG0018204 Contig4731_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30035304h1SMcG0018204 Contig4731_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile stagecDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|P14202|TEGU_SCHMA (Tegument antigen OS=Schistosoma mansoni OX=6183 GN=A12 PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.756e-8
Identity = 45/212 (21.23%), Postives = 82/212 (38.68%), Query Frame = 2
Query:   89 MEMLVDTFGILDHSKSEKINLEELQNYLRNNFNYDFHL-----QKFQKLFGSHGLMNLDEFCDSLGLDINKVRQSLGYTNKNNDNNMSRQQP---VIGPSISKMPGGEHTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTP 700
            ME  +  F  +D   +E I+ +EL  Y +  +  D  L      +F         ++++EFC   GL ++++R+      K  D    +  P   +I  ++SK    E   +                                E +    R G   +E+  ++K  LD+    +W V+++ G YW + S+EP   I   +  Y+   W+TP
Sbjct:   10 MEEFIRAFLEIDADSNEMIDKQELIKYCQK-YRLDMKLIDPWIARFDT--DKDNKISIEEFCRGFGLKVSEIRREKDELKKERDGKFPKLPPNIEIIAATMSKTKQYEICCQ------------------------------FKEYVDNTSRTGNDMREVANKMKSLLDNTYGRVWQVVLLTGSYWMNFSHEPFLSIQFKYNNYVCLAWRTP 188          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8H730 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008204g1 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.428e-21
Identity = 61/209 (29.19%), Postives = 103/209 (49.28%), Query Frame = 2
Query:   98 LVDTFGILDHSKSEKINLEELQNYLRNNFNYDFHL-QKFQKLFGSH--GLMNLDEFCDSLGLD-----INKVRQSLGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTP 700
             +D F  +D  +SE I  +EL  Y+ ++  ++ +  +K+ KLF  +  G + LDE+C+ LGL+     I ++ Q      +NN                ++P      ED+    +S+ +              +M+  + EI     R+G  EK++  R+KQQLD Q   LWHV+M+ G YW+S+S+EP        G++++ CWKTP
Sbjct:   44 FLDAFFAVDKDRSESITPDELAAYMTSSSQFEANFGEKWMKLFDENDDGAITLDEYCNVLGLNPKQARIYRLNQLKAECLRNN----------------RLP------EDVTVIASSMGL--------------EMQVDLTEIFRDAQRRGKDEKDVAGRLKQQLDGQFGKLWHVVMVTGQYWASYSHEPGLSFFFKIGRHIVMCWKTP 216          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8JCG4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008204g2 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.428e-21
Identity = 61/209 (29.19%), Postives = 103/209 (49.28%), Query Frame = 2
Query:   98 LVDTFGILDHSKSEKINLEELQNYLRNNFNYDFHL-QKFQKLFGSH--GLMNLDEFCDSLGLD-----INKVRQSLGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTP 700
             +D F  +D  +SE I  +EL  Y+ ++  ++ +  +K+ KLF  +  G + LDE+C+ LGL+     I ++ Q      +NN                ++P      ED+    +S+ +              +M+  + EI     R+G  EK++  R+KQQLD Q   LWHV+M+ G YW+S+S+EP        G++++ CWKTP
Sbjct:   44 FLDAFFAVDKDRSESITPDELAAYMTSSSQFEANFGEKWMKLFDENDDGAITLDEYCNVLGLNPKQARIYRLNQLKAECLRNN----------------RLP------EDVTVIASSMGL--------------EMQVDLTEIFRDAQRRGKDEKDVAGRLKQQLDGQFGKLWHVVMVTGQYWASYSHEPGLSFFFKIGRHIVMCWKTP 216          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8H6V5 (Dynein light chain OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034129g1 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 6.384e-21
Identity = 65/207 (31.40%), Postives = 101/207 (48.79%), Query Frame = 2
Query:   92 EMLVDTFGILDHSKSEKINLEELQNYLRNNFNYD-FHLQKFQKLFGS--HGLMNLDEFCDSLGLDINKVRQSLGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPI-VTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTP 700
            +  +D +  +D     +I   +L  Y+R N NYD   ++K+ KLF S   G + LDE+C +LGL+  KV+                        I+KM  G            SLP  +TV S     D+  +++ +IIEI+    R  + EK++ + IKQQ D++M  LWHV++I G +W  +S+EP        GKY+   W+TP
Sbjct:    3 DAFIDAYFAIDTEGKGEITSAQLTRYMRQN-NYDEAFVRKWLKLFDSDNSGTITLDEYCQTLGLEAKKVK---------------------ADYIAKMRSG------------SLPSDITVIS----SDMTLELQLRIIEIVRDGQRLNSMEKDMAKYIKQQCDAKMERLWHVVIINGQFWCWYSHEPGYSFIFRLGKYIFCIWRTP 171          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A267F2V4 (Dynein light chain (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034129g2 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 6.982e-21
Identity = 65/207 (31.40%), Postives = 101/207 (48.79%), Query Frame = 2
Query:   92 EMLVDTFGILDHSKSEKINLEELQNYLRNNFNYD-FHLQKFQKLFGS--HGLMNLDEFCDSLGLDINKVRQSLGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPI-VTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTP 700
            +  +D +  +D     +I   +L  Y+R N NYD   ++K+ KLF S   G + LDE+C +LGL+  KV+                        I+KM  G            SLP  +TV S     D+  +++ +IIEI+    R  + EK++ + IKQQ D++M  LWHV++I G +W  +S+EP        GKY+   W+TP
Sbjct:    7 DAFIDAYFAIDTEGKGEITSAQLTRYMRQN-NYDEAFVRKWLKLFDSDNSGTITLDEYCQTLGLEAKKVK---------------------ADYIAKMRSG------------SLPSDITVIS----SDMTLELQLRIIEIVRDGQRLNSMEKDMAKYIKQQCDAKMERLWHVVIINGQFWCWYSHEPGYSFIFRLGKYIFCIWRTP 175          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8HXX8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028751g1 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.962e-20
Identity = 58/204 (28.43%), Postives = 103/204 (50.49%), Query Frame = 2
Query:   98 LVDTFGILDHSKSEKINLEELQNYLRNNFNYDFHL-QKFQKLFGSH--GLMNLDEFCDSLGLDINKVRQSLGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTP 700
             +D F  +D  +SE I  +EL  Y+ ++  ++ +  +K+ KLF  +  G + LDE+C+ LGL+  + R  +   N+     +           +++P      ED+    +S+ +              +M+  + EI     R+G  EK++  R+KQ+LD Q   LWHV+M+ G YW+S+S+EP        G++++ CWKTP
Sbjct:   44 FLDAFFAVDKDRSESITPDELAAYMTSSSQFEANFGEKWMKLFDENDDGAITLDEYCNVLGLNPKQAR--IYRLNQLKAECLRS---------NRLP------EDVTVIASSMGL--------------EMQVDLTEIFRDAQRRGKDEKDVAGRLKQKLDGQFGKLWHVVMVTGQYWASYSHEPGLSFFFKIGRHIVMCWKTP 216          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000038910.1 (SMESG000038910.1)

HSP 1 Score: 431.795 bits (1109), Expect = 9.287e-156
Identity = 207/209 (99.04%), Postives = 208/209 (99.52%), Query Frame = 2
Query:   89 MEMLVDTFGILDHSKSEKINLEELQNYLRNNFNYDFHLQKFQKLFGSHGLMNLDEFCDSLGLDINKVRQSLGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTPIPQDM 715
            MEMLVDTFGILDHSKSEKINLEELQNYLRNNFNYDFHLQKFQKLFGSHGLM+LDEFCDSLGLDINKVRQ LGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTPIPQDM
Sbjct:    1 MEMLVDTFGILDHSKSEKINLEELQNYLRNNFNYDFHLQKFQKLFGSHGLMSLDEFCDSLGLDINKVRQRLGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTPIPQDM 209          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000038910.1 (SMESG000038910.1)

HSP 1 Score: 428.328 bits (1100), Expect = 2.451e-154
Identity = 205/207 (99.03%), Postives = 206/207 (99.52%), Query Frame = 2
Query:   95 MLVDTFGILDHSKSEKINLEELQNYLRNNFNYDFHLQKFQKLFGSHGLMNLDEFCDSLGLDINKVRQSLGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTPIPQDM 715
            MLVDTFGILDHSKSEKINLEELQNYLRNNFNYDFHLQKFQKLFGSHGLM+LDEFCDSLGLDINKVRQ LGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTPIPQDM
Sbjct:    1 MLVDTFGILDHSKSEKINLEELQNYLRNNFNYDFHLQKFQKLFGSHGLMSLDEFCDSLGLDINKVRQRLGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTPIPQDM 207          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000026622.1 (SMESG000026622.1)

HSP 1 Score: 76.2554 bits (186), Expect = 6.994e-17
Identity = 57/207 (27.54%), Postives = 98/207 (47.34%), Query Frame = 2
Query:   89 MEMLVDTFGILDHSKSEKINLEELQNYLRNNFNYDFHLQKFQKLFGSH--GLMNLDEFCDSLGLDINKVRQSLGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTPI 703
            M+  +  F  +D  +SE+I + EL+ Y+R N   D  ++K+  +F S+  G++ LDE+C  LGL  N+ R             + R+Q  I  S   +P              +LP   V+ +Q+   +  +ME ++++I +  + K     ++ + IK++LD    P WH + + G +WS  S  P        GKY+   WKT I
Sbjct:    1 MDNFLTAFFNIDSDQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSVLGLVTNEAR-------------IMREQFNIEHS--AIPK-------------TLP-DDVKIIQSS--VTSEMEIEMVDIEINGWSKCQNAPQVSKFIKEELDKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKTEI 176          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000008592.1 (SMESG000008592.1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.130e-14
Identity = 53/204 (25.98%), Postives = 95/204 (46.57%), Query Frame = 2
Query:   98 LVDTFGILDHSKSEKINLEELQNYL-RNNFNYDFHLQKFQKLF--GSHGLMNLDEFCDSLGLDINKVRQSLGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTP 700
            L+  F  +D   S +I  +EL NY+ + ++   F + K+ ++F   + G + L+EFCD+LGL  N+       T +     M +  P         P  E TNE+I         + V  ++ DPD   +  Q  I++     +    EK+I + IK++LD +   +WHV++ R  + S  S++   ++      +    W+TP
Sbjct:    3 LIKAFEEIDTDYSGEITKDELINYMIKKDYEMGF-VNKWMEIFDPNNTGRITLEEFCDALGLQPNEDYLQQVQTKQEESKPMIQICP---------PFNEETNEEI---------IDVEIIREDPDTTAEFRQFAIDVSHQASKDHKLEKDIAKSIKKKLDEEYNKIWHVVVARSTFGSFISHKSGKFMHYKIENFCYLIWQTP 187          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000081370.1 (SMESG000081370.1)

HSP 1 Score: 63.929 bits (154), Expect = 2.327e-12
Identity = 50/208 (24.04%), Postives = 97/208 (46.63%), Query Frame = 2
Query:   86 NMEMLVDTFGILDHSKSEKINLEELQNYLRNNFNYDFHLQKFQKLFG--SHGLMNLDEFCDSLGLDINKVRQSLGYTNKNNDNNMSRQQPVIGPSISKMPGGEHTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRK-GTAEKEIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITCWKTP 700
            +++MLV+ F  +D + + +I+ +ELQ+Y++     D  ++K+ + F     G ++L+EF   L +               +D+   R  PV                     E  + I++        + P   +  ++ I+   F+  G  +KEI + +K++LDSQ+  LWH ++++G YW  +S+EP N +   F   +   +KTP
Sbjct:    9 DVQMLVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEFVSRLEI---------------SDDFYDR--PVT-------------------HENDVEIISA------GNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTP 174          
The following BLAST results are available for this feature:
BLAST of EF-hand domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P14202|TEGU_SCHMA1.756e-821.23Tegument antigen OS=Schistosoma mansoni OX=6183 GN... [more]
back to top
BLAST of EF-hand domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H7303.428e-2129.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JCG43.428e-2129.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H6V56.384e-2131.40Dynein light chain OS=Macrostomum lignano OX=28230... [more]
A0A267F2V46.982e-2131.40Dynein light chain (Fragment) OS=Macrostomum ligna... [more]
A0A1I8HXX83.962e-2028.43Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038910.19.287e-15699.04SMESG000038910.1[more]
SMESG000038910.12.451e-15499.03SMESG000038910.1[more]
SMESG000026622.16.994e-1727.54SMESG000026622.1[more]
SMESG000008592.16.130e-1425.98SMESG000008592.1[more]
SMESG000081370.12.327e-1224.04SMESG000081370.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035304 ID=SMED30035304|Name=EF-hand domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=781bp
TAATTTTTAAGCAATAATTTTCATTGATTATAAATAAAATCCTTATTTTT
GAAATTATTTATCCCAATATTAAATACAAAATTGAAATATGGAAATGCTC
GTGGACACTTTTGGAATTTTGGACCACTCAAAATCCGAAAAAATCAATTT
GGAAGAATTGCAAAACTATCTCAGAAATAATTTTAATTATGATTTCCATT
TACAGAAATTTCAAAAGCTTTTTGGTTCTCATGGTTTGATGAATTTGGAT
GAATTTTGTGACAGTTTGGGTTTGGATATCAATAAAGTCCGCCAAAGTCT
TGGGTATACCAATAAAAACAATGATAACAACATGTCTCGACAACAACCAG
TTATTGGTCCTTCAATATCCAAAATGCCAGGAGGAGAACATACCAATGAA
GATATAATGAAACAAGAGACGTCTTTACCCATTGTTACAGTTCGTTCATT
ACAAACCGATCCTGATTTACCAAAAGATATGGAACAAAAAATAATTGAGA
TTATTGTCGGCGAATTTAGAAAAGGAACAGCAGAAAAGGAAATTCCCGAA
AGAATAAAACAACAATTAGACAGTCAAATGGCTCCACTGTGGCATGTTTT
AATGATCCGTGGAGATTATTGGAGCAGCCATTCGTACGAGCCGCCAAATT
ACATCACTTTGGGATTCGGAAAGTATCTAATAACGTGCTGGAAGACCCCA
ATTCCGCAAGACATGTAGAAAAATATAATCAAGCAGTTATTGAATAATGT
TGCTACACAAAGCATTTATTTAATAGGGATA
back to top

protein sequence of SMED30035304-orf-1

>SMED30035304-orf-1 ID=SMED30035304-orf-1|Name=SMED30035304-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=210bp
MEMLVDTFGILDHSKSEKINLEELQNYLRNNFNYDFHLQKFQKLFGSHGL
MNLDEFCDSLGLDINKVRQSLGYTNKNNDNNMSRQQPVIGPSISKMPGGE
HTNEDIMKQETSLPIVTVRSLQTDPDLPKDMEQKIIEIIVGEFRKGTAEK
EIPERIKQQLDSQMAPLWHVLMIRGDYWSSHSYEPPNYITLGFGKYLITC
WKTPIPQDM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037177DLC_sf
IPR001372Dynein_light_chain_typ-1/2
IPR011992EF-hand-dom_pair
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001372Dynein light chain, type 1/2SMARTSM01375Dynein_light_2coord: 115..203
e-value: 7.5E-6
score: 35.4
IPR001372Dynein light chain, type 1/2PFAMPF01221Dynein_lightcoord: 126..203
e-value: 4.8E-14
score: 52.4
IPR037177Dynein light chain superfamilyGENE3DG3DSA:3.30.740.10coord: 109..203
e-value: 4.0E-13
score: 51.1
IPR037177Dynein light chain superfamilySUPERFAMILYSSF54648DLCcoord: 123..204
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 2..84