Protocadherin

Overview
NameProtocadherin
Smed IDSMED30035296
Length (bp)3415
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin (SMED30035296) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin (SMED30035296) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin (SMED30035296) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin (SMED30035296) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035296

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035296SMESG000014472.1 dd_Smed_v4_11579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035296SMESG000014472.1 dd_Smed_v4_11579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035296SMESG000014472.1 dd_Smed_v4_11579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035296SMESG000014472.1 dd_Smed_v4_11579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035296SMESG000014472.1 dd_Smed_v4_11579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 295.049 bits (754), Expect = 3.827e-83
Identity = 215/669 (32.14%), Postives = 351/669 (52.47%), Query Frame = 3
Query:  372 RDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPS--ASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            RD  C   +E++    + ++L     L+ D+NDN P F     N  I ENS  +++  LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ +TD ND+ P F ++    + PE+   G ++ Q+ ATD DI     I  S S   S+     F + A  G+I+ K  L     + ++++ ++A D G   + A + VLV+VTD+NDN P I+I    +  N+ +VL+EN   N+ IA +TV+DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   +VSI EN   G ++T++ A+D D G NA+I Y+L P+    F++D  +GM+T     DRE + +Y     A D+ +  + S++T+ V+I+D+NDN P F    ++F++ ENL   G +G +   D D G N+ +   + + +  F I     +      + DRE+ + Y+  + A D G    +SS  V I + D+NDN P FI P       L +  T  GT +F   A+DNDTG NA++ Y+I    ++ +F I+   G+I L +      +   ++++ A D G
Sbjct:  102 RDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDR-EETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV--FSNQ--FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF-DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLG 757          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 294.664 bits (753), Expect = 5.591e-82
Identity = 215/669 (32.14%), Postives = 351/669 (52.47%), Query Frame = 3
Query:  372 RDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPS--ASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            RD  C   +E++    + ++L     L+ D+NDN P F     N  I ENS  +++  LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ +TD ND+ P F ++    + PE+   G ++ Q+ ATD DI     I  S S   S+     F + A  G+I+ K  L     + ++++ ++A D G   + A + VLV+VTD+NDN P I+I    +  N+ +VL+EN   N+ IA +TV+DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   +VSI EN   G ++T++ A+D D G NA+I Y+L P+    F++D  +GM+T     DRE + +Y     A D+ +  + S++T+ V+I+D+NDN P F    ++F++ ENL   G +G +   D D G N+ +   + + +  F I     +      + DRE+ + Y+  + A D G    +SS  V I + D+NDN P FI P       L +  T  GT +F   A+DNDTG NA++ Y+I    ++ +F I+   G+I L +      +   ++++ A D G
Sbjct:  102 RDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDR-EETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV--FSNQ--FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF-DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLG 757          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 294.664 bits (753), Expect = 6.025e-82
Identity = 215/669 (32.14%), Postives = 351/669 (52.47%), Query Frame = 3
Query:  372 RDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPS--ASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            RD  C   +E++    + ++L     L+ D+NDN P F     N  I ENS  +++  LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ +TD ND+ P F ++    + PE+   G ++ Q+ ATD DI     I  S S   S+     F + A  G+I+ K  L     + ++++ ++A D G   + A + VLV+VTD+NDN P I+I    +  N+ +VL+EN   N+ IA +TV+DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   +VSI EN   G ++T++ A+D D G NA+I Y+L P+    F++D  +GM+T     DRE + +Y     A D+ +  + S++T+ V+I+D+NDN P F    ++F++ ENL   G +G +   D D G N+ +   + + +  F I     +      + DRE+ + Y+  + A D G    +SS  V I + D+NDN P FI P       L +  T  GT +F   A+DNDTG NA++ Y+I    ++ +F I+   G+I L +      +   ++++ A D G
Sbjct:  102 RDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDR-EETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV--FSNQ--FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF-DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLG 757          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 294.664 bits (753), Expect = 6.095e-82
Identity = 215/669 (32.14%), Postives = 351/669 (52.47%), Query Frame = 3
Query:  372 RDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPS--ASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            RD  C   +E++    + ++L     L+ D+NDN P F     N  I ENS  +++  LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ +TD ND+ P F ++    + PE+   G ++ Q+ ATD DI     I  S S   S+     F + A  G+I+ K  L     + ++++ ++A D G   + A + VLV+VTD+NDN P I+I    +  N+ +VL+EN   N+ IA +TV+DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   +VSI EN   G ++T++ A+D D G NA+I Y+L P+    F++D  +GM+T     DRE + +Y     A D+ +  + S++T+ V+I+D+NDN P F    ++F++ ENL   G +G +   D D G N+ +   + + +  F I     +      + DRE+ + Y+  + A D G    +SS  V I + D+NDN P FI P       L +  T  GT +F   A+DNDTG NA++ Y+I    ++ +F I+   G+I L +      +   ++++ A D G
Sbjct:  102 RDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDR-EETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV--FSNQ--FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF-DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLG 757          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 294.278 bits (752), Expect = 8.825e-82
Identity = 215/669 (32.14%), Postives = 351/669 (52.47%), Query Frame = 3
Query:  372 RDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPS--ASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            RD  C   +E++    + ++L     L+ D+NDN P F     N  I ENS  +++  LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ +TD ND+ P F ++    + PE+   G ++ Q+ ATD DI     I  S S   S+     F + A  G+I+ K  L     + ++++ ++A D G   + A + VLV+VTD+NDN P I+I    +  N+ +VL+EN   N+ IA +TV+DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   +VSI EN   G ++T++ A+D D G NA+I Y+L P+    F++D  +GM+T     DRE + +Y     A D+ +  + S++T+ V+I+D+NDN P F    ++F++ ENL   G +G +   D D G N+ +   + + +  F I     +      + DRE+ + Y+  + A D G    +SS  V I + D+NDN P FI P       L +  T  GT +F   A+DNDTG NA++ Y+I    ++ +F I+   G+I L +      +   ++++ A D G
Sbjct:  102 RDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDR-EETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV--FSNQ--FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF-DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLG 757          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 220.32 bits (560), Expect = 7.641e-58
Identity = 216/759 (28.46%), Postives = 339/759 (44.66%), Query Frame = 3
Query:  180 ENSPIFVRICNVKKT-------FPDIENPTIDNFQNFFRLN--DNNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR-IPIIAV----DSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFS--GMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLG----RVEAVDKDIGQNAQMDYFLFNPSPLFEIS-RNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT------IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNF 2375
            E++PI   I +VK +       +  +  P     QN F L+     + + +S+DRE L  +      K   Y R    I     S S      + + V DV DN P F++ ++  +I E++P    V    ARD D G NG + Y++      N   L++ +   G      ++     DRE     +L +IA D G P   S+  ++I + DVND+AP F   SY     E+I     I  V ATD+D  +   +  S ++SS I           I      V +    D +  PI AV    D   P L++T  + ++V DIND+ P +  A       + L EN      + +V   D+D G NG ++        +++E  ++F       L+   T   DRE    + L +   DMG PSL T+  I VV+KD NDN P F ++  +V+I E +P G+++  LKA+D D   + +I Y +     E F+I      G I +     +    + +V+ +A D   L+      ++V I D N  P  +     F +K      +G     ++A D D G NA++ Y + + S  F I   +GDI VS    LDRE    +S+ + A DH + PL +ST +E+I+DDINDNSP F        ++  I    GT      AID D G N  + Y +   +      +F ++ + G++ ++  L  E      + I ARD G    +  S + L  
Sbjct:  176 EDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKH----ILKVTAYERVDPTI-----SAS----TTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKN---LLAINAKSG-----VIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGL-------TIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAA----QKMITLEENVAIGEEVGRVYAIDEDSGPNGIIK--------YSMEGSEDFIIDEDSGLIKT-TKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQ--GRCVVNVFIDDVNSAP--YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-DSSQFFRIDPSSGDISVSSD--LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPV--GTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTL 882          

HSP 2 Score: 200.29 bits (508), Expect = 1.272e-51
Identity = 183/604 (30.30%), Postives = 287/604 (47.52%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQ-IMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHE-SVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSP-----LFEISR-NGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI 2216
            I V DVNDN P F   ++N  I EN      +    A D D G NG V Y++  S+       I  ST +       + + +  D + +     ++ AKD   P L+S++ + I++ D+NDHAP    +       E++  G+ +G+V+A D+D      I  S   S   I+D+ S    G+I T   L+   ++  Y + + A D G P+L  ++T+ V + DINDN P  +    N    + ++E     S I  +   D D         +  +  +F   SI +  ++     V+      D +V+    + I  +D G   L     + V + D N  P  ++  H  SV I E+ PIG  V  LKA D D G NA+I Y +     + F IDP SG I+     DRE ++ + V  TA DH    +N+S  I V + D NDN P+F  + ++  I E++       +V A+D DIG N  +DYFL   S      LF + R +G + VS K  LDRE+     + I ARD G   L++++ + + + D+NDN+PTF   +    L ++  +  G+ + T  A D D G+NA I + I
Sbjct:  363 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLT-IDYSTGE-------VTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDS----GLIKT-TKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYN----VTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVF---SILDIGDQGAILSVSGELKRQDHKVR----VEISATDQG--GLQGRCVVNVFIDDVNSAP--YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS--QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSK--LDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF--EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRI 931          

HSP 3 Score: 167.933 bits (424), Expect = 1.274e-41
Identity = 150/568 (26.41%), Postives = 256/568 (45.07%), Query Frame = 3
Query:  432 LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML----SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPS--PLFEIS----RNGDIFVSQKRYLDRE-RVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTF 2093
            L I V D+ND+ P+         + EN     EV    A D D G NG + Y+++ S     F++         DS L +K  +  DRE    + L + A+D+G P L +S TI + + D+ND+AP F++  Y     E + +G  I  + A D D   ++T  +   A  ++     +   G I   V+          R+ I A D G   L     V V + D+N + P      ++    + + E+      +  +   D D G+N ++   +D++  F ++               + +S  DRE +    + +  SD   P L T+  I V++ D NDN P F     + +I E++P+GT   ++ AID DIG N  + Y L    S   ++ F +D  SG +      DRE  +   +   A D     ++++  I +T+ D NDN P F + ++  +I EN  +   +G + A D D G NA + + +F  +   LF+I     +NG + +  +   D E + +++  E+ A    +  L+S+  V I + D+NDN P  
Sbjct:  465 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGS---EDFII-------DEDSGL-IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE-EADREVFSILDIGDQGAI-LSVSGELKRQDHKVRVEISATDQGG--LQGRCVVNVFIDDVN-SAPYF----NDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSG---------DISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA---SSGQLSSTVPVRIHVSDVNDNKPAL 1000          

HSP 4 Score: 116.701 bits (291), Expect = 6.540e-26
Identity = 145/535 (27.10%), Postives = 237/535 (44.30%), Query Frame = 3
Query:  432 LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGM-----ITTRVSFDREVQSE---YKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKE----NLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISR-NGDIFVSQ--KRYLD 1970
            + +++ D+NDN P+FD+  +N  I+E  P  +++    A D D   +  + Y I+  A    F ++        D    L +     R+ D + ++ + A D G   L     + + I DVN  AP FN   +    PE    G  +  + A D D      I+ S   SSQ            I      + VSS  D      + + + A D  +P L  ++ + V + DINDN P  +  SS+      ++E+    +   +V+  D D G NG V+  L+ +   +  SIQ F   R    +   +S  DRE      L I   D G PSL+    IT+ + D NDN P F +    + I EN P+G+ V  + A D D G NA I + +      + F+I+  +       I TR  FD E ++    ++++A++      +++S++ + + + D NDN P  L+ F   +       +   +G + A D D  QNA ++YFL   + L E  +  G I V Q  KR +D
Sbjct:  567 IAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIE-EADREVFSILDIG-----DQGAILSVSGELKRQ-DHKVRVEISATDQGG--LQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID-SSQFFR---------IDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSP--QFTSSSY--AATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESS--SSPSIQLFRLDRTSGTLRV-SSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG-----QLSSTVPVRIHVSDVNDNKPA-LKDFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEYFL-EENDLIEAEKYTGKILVKQEWKRNMD 1063          

HSP 5 Score: 68.5514 bits (166), Expect = 3.478e-11
Identity = 41/157 (26.11%), Postives = 80/157 (50.96%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKD 899
            ++ + ++DVNDN P+F++L+++  IAENSP  + V   +ARD D G+N  + + I   A +  F +   +   G      ++IL   + + + +           +  L+S++ ++I ++DVND+ P         N  +++   + IG + A D D
Sbjct:  877 EITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNG-----VVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD 1028          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 200.675 bits (509), Expect = 8.166e-52
Identity = 183/606 (30.20%), Postives = 288/606 (47.52%), Query Frame = 3
Query:  432 LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQ-IMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHE-SVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSP-----LFEISR-NGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI 2216
            + I V DVNDN P F   ++N  I EN      +    A D D G NG V Y++  S+       I  ST +       + + +  D + +     ++ AKD   P L+S++ + I++ D+NDHAP    +       E++  G+ +G+V+A D+D      I  S   S   I+D+ S    G+I T   L+   ++  Y + + A D G P+L  ++T+ V + DINDN P  +    N    + ++E     S I  +   D D         +  +  +F   SI +  ++     V+      D +V+    + I  +D G   L     + V + D N  P  ++  H  SV I E+ PIG  V  LKA D D G NA+I Y +     + F IDP SG I+     DRE ++ + V  TA DH    +N+S  I V + D NDN P+F   +++  I E++       +V A+D DIG N  +DYFL   S      LF + R +G + VS K  LDRE+     + I ARD G   L++++ + + + D+NDN+PTF   +    L ++  +  G+ + T  A D D G+NA I + I
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLT-IDYSTGE-------VTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDS----GLIKT-TKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYN----VTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVF---SILDIGDQGAILSVSGELKRQDHKVR----VEISATDQG--GLQGRCVVNVFIDDVNSAP--YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS--QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSK--LDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF--EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRI 572          

HSP 2 Score: 180.644 bits (457), Expect = 1.499e-45
Identity = 163/551 (29.58%), Postives = 254/551 (46.10%), Query Frame = 3
Query:  771 IKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR-IPIIAV----DSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFS--GMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEIS-RNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT------IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNF 2375
            ++I + DVND+AP F   SY     E+I     I  V ATD+D  +   +  S ++SS I           I      V +    D +  PI AV    D   P L++T  + ++V DIND+ P +  A       + L EN      + +V   D+D G NG ++        +++E  ++F       L+   T   DRE    + L +   DMG PSL T+  I VV+KD NDN P F ++  +V+I E +P G+++  LKA+D D   + +I Y +     E F+I      G I +     +    + +V+ +A D   L+      ++V I D N  P      FS  I E+  +   +  ++A D D G NA++ Y + + S  F I   +GDI VS    LDRE    +S+ + A DH + PL +ST +E+I+DDINDNSP F        ++  I    GT      AID D G N  + Y +   +      +F ++ + G++ ++  L  E      + I ARD G    +  S + L  
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGL-------TIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAA----QKMITLEENVAIGEEVGRVYAIDEDSGPNGIIK--------YSMEGSEDFIIDEDSGLIKT-TKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQ--GRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-DSSQFFRIDPSSGDISVSSD--LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPV--GTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTL 523          

HSP 3 Score: 168.318 bits (425), Expect = 9.320e-42
Identity = 150/568 (26.41%), Postives = 256/568 (45.07%), Query Frame = 3
Query:  432 LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML----SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNP--SPLFEI----SRNGDIFVSQKRYLDRE-RVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTF 2093
            L I V D+ND+ P+         + EN     EV    A D D G NG + Y+++ S     F++         DS L +K  +  DRE    + L + A+D+G P L +S TI + + D+ND+AP F++  Y     E + +G  I  + A D D   ++T  +   A  ++     +   G I   V+          R+ I A D G   L     V V + D+N + P      ++    + + E+      +  +   D D G+N ++   +D++  F ++               + +S  DRE +    + +  SD   P L T+  I V++ D NDN P F     + +I E++P+GT   ++ AID DIG N  + Y L    S   ++ F +D  SG +      DRE  +   +   A D     ++++  I +T+ D NDN P F + ++  +I EN  +   +G + A D D G NA + + +F    + LF+I     +NG + +  +   D E + +++  E+ A    +  L+S+  V I + D+NDN P  
Sbjct:  106 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGS---EDFII-------DEDSGL-IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE-EADREVFSILDIGDQGAI-LSVSGELKRQDHKVRVEISATDQGG--LQGRCVVNVFIDDVN-SAPYF----NDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSG---------DISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA---SSGQLSSTVPVRIHVSDVNDNKPAL 641          

HSP 4 Score: 139.043 bits (349), Expect = 8.822e-33
Identity = 121/429 (28.21%), Postives = 201/429 (46.85%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSR--VTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR------IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYK 1691
            + + DVN + P F+   F+ KI E+SP    V    A D DRG+N  +VY+I     S++F  I PS+         + +    DRE    F +I+ A D  +PPL +S  I++ + D+ND++PQF  SSY     E I  G +  QV A D DI     V   ++ S+SS  +  F       +      + VSS  D        +PI A D G P+L+A S + + ++D+NDN P  E  S +    L + EN    S +  +   D D G+N  +  ++    +  LF++E  ++ E     +++T   + FD E K +     + +  G   L++T P+ + V D NDN P        ++  +N+ +  ++  + A D D   NA ++Y L    L     + ++G I  +  + R +   +K
Sbjct:  312 VFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID----SSQFFRIDPSSGD-------ISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFR------LDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYD----LYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIE--EDAEQNGVVRILT--RAEFDYEAKANKFFFELQASSG--QLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEYFLEENDL--IEAEKYTGKILVKQEWKRNMDVSFK 708          

HSP 5 Score: 117.087 bits (292), Expect = 5.129e-26
Identity = 145/535 (27.10%), Postives = 237/535 (44.30%), Query Frame = 3
Query:  432 LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGM-----ITTRVSFDREVQSE---YKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKE----NLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISR-NGDIFVSQ--KRYLD 1970
            + +++ D+NDN P+FD+  +N  I+E  P  +++    A D D   +  + Y I+  A    F ++        D    L +     R+ D + ++ + A D G   L     + + I DVN  AP FN   +    PE    G  +  + A D D      I+ S   SSQ            I      + VSS  D      + + + A D  +P L  ++ + V + DINDN P  +  SS+      ++E+    +   +V+  D D G NG V+  L+ +   +  SIQ F   R    +   +S  DRE      L I   D G PSL+    IT+ + D NDN P F +    + I EN P+G+ V  + A D D G NA I + +      + F+I+  +       I TR  FD E ++    ++++A++      +++S++ + + + D NDN P  L+ F   +       +   +G + A D D  QNA ++YFL   + L E  +  G I V Q  KR +D
Sbjct:  208 IAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIE-EADREVFSILDIG-----DQGAILSVSGELKRQ-DHKVRVEISATDQGG--LQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID-SSQFFR---------IDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSP--QFTSSSY--AATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESS--SSPSIQLFRLDRTSGTLRV-SSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG-----QLSSTVPVRIHVSDVNDNKPA-LKDFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEYFL-EENDLIEAEKYTGKILVKQEWKRNMD 704          

HSP 6 Score: 90.5077 bits (223), Expect = 5.846e-18
Identity = 66/243 (27.16%), Postives = 114/243 (46.91%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMD-KFSVAFDGVISTKVALVYVSSSFDYRIP----IIAVDSGNPTLTATSTVLVHVTDINDNRPIIE 1136
            Q+ +++ D+NDN P F   ++   I+E+ P         A D D G NG V Y +  S+ S    L       G      L++    DRE      L + A+D G P L+++  I + ++DVND+AP F Q SY     E+   G  +G + A D D    + ++  +   A +++ D +     +GV+      +   + FDY          + + +  L++T  V +HV+D+NDN+P ++
Sbjct:  410 QIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSG-----TLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVR-----ILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALK 642          

HSP 7 Score: 68.5514 bits (166), Expect = 2.856e-11
Identity = 41/157 (26.11%), Postives = 80/157 (50.96%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKD 899
            ++ + ++DVNDN P+F++L+++  IAENSP  + V   +ARD D G+N  + + I   A +  F +   +   G      ++IL   + + + +           +  L+S++ ++I ++DVND+ P         N  +++   + IG + A D D
Sbjct:  518 EITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNG-----VVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD 669          
BLAST of Protocadherin vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 153.295 bits (386), Expect = 3.914e-37
Identity = 170/673 (25.26%), Postives = 297/673 (44.13%), Query Frame = 3
Query:  444 VADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTI-MMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQ-HLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQ-TIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNKKIEPKSS 2435
            V D NDN PSF       +I+E +       LP   D D        + I    V+N F L S   N+   + L +      DRE  ++++L++ A+D G P     L   I+I D ND+AP F++S Y  +   +I  G  +  V ATD DI   SR++  +   SA S     F+++  GVI+T  +L+  S+   + + ++A D G+P+L++++ V + V     + P ++I    ++N   L EN    S +A+V+++ +        + KL    L    ++   +  + +  +       DRE    H L  +    G   +    P  + + D NDN P ++     +S+  N   G   T L A D D+G N  I+Y +L  E +   +ID  +G I    + D  + SE K +  A D     +++ + +   +LD    PP+F +  +   I E+  +   L +V A +   G + ++ Y L N      +         QK + D E+   Y   + A +  +   TS++ + I + D+NDN P F    P + HL +         +    A D D+G   ++ Y I S+ + F IN   G ++  K L         +++SA+D G      ++++H+  I      P     K E +++
Sbjct:  112 VDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVN--GQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSN--SNFAISQSGVITTTASLLPAST---HDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYR------DTKL---RLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDG--QIIIEHPQLLTIGDINDNAPQWHSSQIHISL--NRTQGGSRT-LTAKDPDLGQNGWIRYSVLDTELV---SIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTF-DFEKQKSYQTTVIATNANSE--TSTSLISIRLKDVNDNWPIFY---PNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLARGRF---HLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTT 751          

HSP 2 Score: 147.902 bits (372), Expect = 1.842e-35
Identity = 164/660 (24.85%), Postives = 304/660 (46.06%), Query Frame = 3
Query:  408 GSGPKFYQLPILVADVNDNV---PSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTI---MMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL-----DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRP-ITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRN-GDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGI 2336
            G  P       +VAD+ D     P F++  +  +I E++P    +   +A +   GN+  + Y+++     N+   ++  T  G      + I ++FD E  + +Q  +IA +  +   TS+  I I + DVND+ P F  + Y     E     + +  V A+D D  +   +   ++S S+S      FS+     ++ +V      +   + + + A D G  +  + ++  +H+T I+ +    + + S    R   TE+      I  V       G   +V+  +     D+N+  + ++ + +  R             D +V D   LNI  +   +PS  + +  + + ++D NDNPP F      +SI E+L +      ++A DKD   N +++Y ++S     +  ID F+G ++T    D E    YK++  A D  I   +S++T+ + +LD NDN P+F ++ ++  + EN   + ++G+V A DKD  +N Q+ Y + N S  F I    G+++   KR +DRE +    I I A D G  P +S+ +  I + D+NDN P+ +   P   + +   +   T I T  A+D D G N  ++Y  Q Q+  ++  S+G +YL + L        ++ +   D G+
Sbjct:  515 GGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQ-----NQDEHLTVDTMSG-----TVCIQKTFDFEKQKSYQTTVIATNANSE--TSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS------FSI---NPVTGEVFAQKPLARGRFHLVVSAKDGGGQS--SENSANIHITVIDKDTKTPQFSRSKYEIRT--TEDILPGIAIGSV-------GAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRY-----------LDADVHDTVLLNIQAT---LPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYT--KRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITP---IVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGV 1123          

HSP 3 Score: 145.976 bits (367), Expect = 8.079e-35
Identity = 155/562 (27.58%), Postives = 247/562 (43.95%), Query Frame = 3
Query:  345 DTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIP---IIAVDSGNPTLTATST-VLVHVTDINDNRP-----IIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSI 1997
            D  KQ +Y    Q  +I   + S      + I + DVNDN P F    ++  + E       + +  A D D G  G V Y I   + S     I+P T +        K L          F L++ AKD G     +S  I I + D +   PQF++S Y   T E I+ G AIG V A  K       +  S  +  Q  + FS+  D         +YV+   D  +    ++ + +  P+  +  T V++ + D NDN P     ++EI+         + E+ + +     V  SDKD   NG+V   + +++  +   I  F      +L T   S  D E   +++L +  +D+G+P  ++   + + V D NDN P F +   ++ +LEN P  T V ++ A DKD   N QI Y ++    E F ID   G + T+ S DREV S   +   A D  +   +S+ +  +++LD NDNPP  L      +     L   +G + A+D D G N  + Y     S LF +  NGD+++ ++     ER  R S+
Sbjct:  602 DFEKQKSY----QTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFS---INPVTGE----VFAQKPLAR------GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSK-------VKYSIYSGDQDHN-FSIDED------TGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEIS---------IREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTG----QLSTG--SLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRIT-NGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSNGDVYLRRQLNASDERHQRLSV 1116          

HSP 4 Score: 109.383 bits (272), Expect = 1.030e-23
Identity = 169/694 (24.35%), Postives = 290/694 (41.79%), Query Frame = 3
Query:  255 NFQNFFRLNDNNV-EMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGP-KFYQL--PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKP-SAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFN----QSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDK---FSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISR-NGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI---FYINTSDGSIYLNKSL 2279
            N  N F+L    V E LQ+    +L+ N + D  +++   RD   +LI    G  P K  QL   I + D NDN P F R  +   ++ N    + +    A D D G N  + Y IK  SA SN    IS S      +SL    L +   ++      I++A D G+P L+SS  + I +      +P  +      S   +  E+   G  + +V    +   +++ ++ S +   Q  D+   + +   G++  + A        ++ +  +    G   +      L+ + DINDN P  +  SS  +  L  T+          +T  D D G NG +   + +  L +++        +    +  P ++ D  +    +  +   D G P+L+T   +   + D    PP F +    V I E+ PIGT + ++ A +   G + +I+Y L  +  E+  +D  SG +  + +FD E Q  Y+    A +       S I+I +   D NDN P F    +   ++E    E  L  V A D D G   ++ Y + + S  F I+   G++F   ++ L R    R+ + + A+D G +   +S  + I + D +  +P F   K        I T +   I    AI    G  +K+ Y+I S      F I+   G IY+ + L
Sbjct:  165 NVNNVFKLASRKVNEQLQA----DLVVNGQLD--REF---RDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASL----LPASTHDV------IVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETA-------SEHHLKFLLEKDGQ--IIIEHPQLLTIGDINDNAP--QWHSSQIHISLNRTQGGSRT-----LTAKDPDLGQNGWIRYSVLDTELVSID--------KETGRIFVP-NTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQD-EHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLK--DVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFA--QKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSK------YEIRTTE--DILPGIAI-GSVGAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYL 797          

HSP 5 Score: 106.686 bits (265), Expect = 7.393e-23
Identity = 145/551 (26.32%), Postives = 235/551 (42.65%), Query Frame = 3
Query:  807 PQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGN---NGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML---SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDEN-DNPP----KFLRTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLF--EISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNKKI 2420
            P F Q   +F  PES   G  IG +    ++ ++    ++ P   +    K      G IST   L Y   S  + I  + V+    T+     +LV V D NDN P    + ++Q  +L ++E  Q  +  A  TV+D D      +  V  + + N +F L S +  E  +   +V       DRE +D ++L I   D G P+       ++ + D NDN P+F R   + S+  N+ IG+ +  ++A D DIG N++I Y +   S     NF I   SG+ITT  S      S + V   A DH    ++SS  + +T+L     +PP      + + S H+ EN    LG + A      Q       L   S L   +  +     +     LDRE    + ++      G   +       + I DINDN+P +   +   H++L+  T  G++  TAK  D D G+N  I Y++    +  I+   G I++  ++        K  + A D G  P  +T    +  +   +SKPP   K +
Sbjct:   20 PTFCQCLTKFTVPESAQIGTRIGWISGKREESAAPKYFVVFPDEQTSKFLKVD-ERSGEISTIAHLDYEKRS-KFDIVAVKVEESGETID----ILVEVDDENDNAP----SFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNG---QLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQ-SGVITTTASL--LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMEN--STLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQL--LTIGDINDNAPQWHSSQ--IHISLN-RTQGGSRTLTAK--DPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGG-SPALSTDLQVVADLLDTESKPPQFEKAL 544          

HSP 6 Score: 105.531 bits (262), Expect = 1.651e-22
Identity = 106/381 (27.82%), Postives = 165/381 (43.31%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR------IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLD-NNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKA 1550
            Q+ I + D NDN P F        I E+   H    +  A D D+  NG V Y+I  S   +  + I   T Q    SL        D E    ++L + A DLG PP +S++T+ I + DVND+AP+F +S Y     E+      +G+V A DKD      I+   +  S+            I  K+  VY   S D        I I+A D G P  ++T++  + V D+NDN P     S      +V+      ++ I  +   D D G NG V  +    + LF ++S  +   RR         +S +R    H +L++I SD GVP  +    + V +   + +  I     + + I ++ P G ++T L A
Sbjct:  822 QVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSS-IEIDQFTGQLSTGSL-------LDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFG---------IDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP-----SCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSNGDVYLRRQLN------ASDER----HQRLSVIVSDQGVPRKSVVCHVPVRISKGSADIQIQEPFQKYIEIPKSCPTGCRLTTLNA 1170          

HSP 7 Score: 103.219 bits (256), Expect = 7.959e-22
Identity = 182/712 (25.56%), Postives = 284/712 (39.89%), Query Frame = 3
Query:  384 CILILELSGSGPKFYQLPILVADVNDNVPSFDRLT-FNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAP---QFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDH----------GNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQ-HESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILD-ENDNPPKFLRT-FSFHIKENLEGVLGRVEAVDKDIG-----QNAQMDYFLFNP--SPLFEISRNGDIFVSQKRYLDRER--VDRYSIEIGARDHGNRPLTSSTT---VEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQ---TIFYINTSDGSIYLNKSLQDEHI--LPD---KIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPM 2408
             I+IL   GS      + + VAD NDN P  D  T    +IAE+S   + +    A D D G NG   + +   + S    L+ P T       L L+ L S      + +++ L   D G P L     ++I   +    A    +F + +Y     E + +GQ I +       +   +  +        I   FSV  +GVI T + L        Y + +I   SG    T    V V V ++NDN P   ++   +     + EN +  SY+A V   D D+           ++GQ          FN   I  F    H   +TAP    D EV   H L I  +D    + T    +T+ V D NDN P F +  +++         G    +++A D D      + Y L       F + P SG +  +V         Y V  TA D+ +   ++S+ + V I + E  + P F +  F F + EN          +   IG     ++ +  Y + +P  S +F I + G +FV+    +DRE+     + +EI      N  +TS        +I+ D NDN P F       +L+L      G KI    A D D+GEN ++ Y I S     I  +N   GSI LN+   D  +   P+   +I++ ARD G   +     + ++   S  S   P 
Sbjct: 1697 LIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDS-SGSLDLV-PETGD-----LVLRRLSSL-----QSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAK-------LQPELAGLTYSIVEGNIDSAFSVDSEGVIRTNLELDREILE-RYSLKVIGTGSGQQIGT---RVDVRVNNLNDNVPSFPMSKPRR-----VPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTH------FN---IDQFTGTIH---LTAP---LDFEVLPEHTLTIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLD--ARGALTYSLGQGSSSIFRVAPESGALFMKVL--PPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMEN--------SKIGLQIGNLSGEESREFHYRIQDPEASKIFSIDKFGRLFVAGP--IDREQRATHEFQVEI-----DNEMMTSQKVQCKCHVIVLDENDNLPVFT--SVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNE-WNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPF 2340          

HSP 8 Score: 92.8189 bits (229), Expect = 1.243e-18
Identity = 160/699 (22.89%), Postives = 296/699 (42.35%), Query Frame = 3
Query:  270 FRLNDNNVEMLQSLDRENLI-TNQKCDTSKQYNYNRDSQCILILELSGSGPKF-YQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLA---RDPDRGNNGSVVYAIKPSAVSN----KFVLISPSTNQG------HDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFN-TPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD-GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGMITTRVSFDREVQS------EYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEIS-RNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS-QTIFYINTSDGSIYLNKSL 2279
            + + + N++   S+D E +I TN + D      Y+      L +  +GSG +   ++ + V ++NDNVPSF                     P++   R P+    GS V  +    V N    ++ L+S S+ Q          +  + +    D E+  E  L + A D G+    ++LTI +  +D+ND+AP F++  Y+   +P +   GQ   ++ A D D    +T  +   +SS     F VA + G +  KV      +   Y + + A D+G P+ + +  V V    I +  P  +        R  + EN +    I          GN    E +  +  + + E+ + F   +  +L  A     DRE +  H+  +   +  + S        V+V DENDN P+F      +S+ +++  G K+ ++ A D+D G N ++ Y +LS   L    ++P +G I      D ++        +  V+A  + H        + + + +   + + P F L  +  H+ E+  +  VL ++ A ++   +N  + Y L        I  + G++ +  K +LD E     S+ +   D   R  ++   ++I+++ +++ +P F   K    L + I T  G  +   +AID D G +  + Y+I   Q+   I    G I L K L
Sbjct: 1863 YSIVEGNIDSAFSVDSEGVIRTNLELDREILERYS------LKVIGTGSGQQIGTRVDVRVNNLNDNVPSF---------------------PMSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATD-GSFDTFTNLTIFV--SDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSS----IFRVAPESGALFMKV---LPPAGERYLVTVTATDNGVPSFSTSVPVSVI---IGEAEPTDKPGFEKAEFRFEVMENSKIGLQI----------GNLSGEESREFHYRIQDPEASKIFSIDKFGRLFVA--GPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDVKTGELTL--KTHLDWESEPIISMYLSVSDGNGR--SAVVPLKIVVEPVDEFAPVFT--KSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIEEHTGIIRLQKPL 2503          

HSP 9 Score: 78.9518 bits (193), Expect = 2.369e-14
Identity = 127/592 (21.45%), Postives = 236/592 (39.86%), Query Frame = 3
Query:  585 YAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTA----PTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDEN-DNPP---IFYRQHESVSILENLPIGTKVTRLKAID--KDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIH----VTILDENDNPPKFLRTFSFHIKEN-LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIID--DINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQ-TIFYINTSDGSIYLNKSLQDE 2288
            + + P   ++KF+ +        + S ++  +   D E   +F ++ +  +        ++ I +++ D ND+AP F     +    E    G +      TD D   +  +         + + F +A   V     A + V+   D      Y + I A D G P         + + D NDN P+     S       ++ N    S++  V  +D D G N ++   +      +  S  NF   +   + T     P S+        H + ++ SD G PSL+++  +T+ V      +PP   I+  +  S  ++EN  +G+ V R+      +D  +       L P+  +  ++     ++      DRE  SE+ +K       +L  +  I I     +TI D NDN P++  +   HI  N  +G    + A D D+GQN  + Y + +   +      G IFV     +D          + A D G+  L  ST ++++ D  D     P F   K    + +  +T  GT +    A ++  G + +I Y++Q+Q     ++T  G++ + K+   E
Sbjct:   57 FVVFPDEQTSKFLKVD-------ERSGEISTIAHLDYEKRSKFDIVAVKVEESG----ETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGD-GPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVF----SRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKT---SAPSNSNFAISQSGVITTTASLLPAST--------HDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHV----YLLLLCGILDRETASEHHLK------FLLEKDGQIIIEHPQLLTIGDINDNAPQW-HSSQIHISLNRTQGGSRTLTAKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNT--IDCNIGSEIKFRVRAEDGGSPAL--STDLQVVADLLDTESKPPQF--EKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFE 604          

HSP 10 Score: 71.2478 bits (173), Expect = 4.706e-12
Identity = 94/339 (27.73%), Postives = 160/339 (47.20%), Query Frame = 3
Query: 1350 FDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHES-VSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSG-MITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILD---ENDNPPKFLR-TFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQ-HLNLSIETIQGTKIFTAKAIDNDTGENAKIV--YTIQSQTIFYINTSDGSIYLNKSLQDEHILPDK-IIISARDS 2330
             DRE    H L II +D G  + + T  + V V D+NDN P       S + I E+  +G  + R +A D DIG N +  + L  +   + ++ P +G ++  R+S    +QS +K+K    DH +  +     + ++  +   E   P +FL+ T+   I E L     R + + K   + A + Y +   N    F +   G I  + +  LDRE ++RYS+++     G +     T V++ ++++NDN P+F   KP +   NL + +   T    AK +DN       +V   + Q+ T F I+   G+I+L   L D  +LP+  + I A D 
Sbjct: 1687 LDREASQEHLLIIILTDGGSRNDSCT--VRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDLVLRRLS---SLQS-WKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLP----RGQFIAKLQPELAGLTYSIVEGNIDSAFSVDSEGVIRTNLE--LDREILERYSLKVIGTGSGQQ---IGTRVDVRVNNLNDNVPSFPMSKPRRVPENLRVGSYVAT--VGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPL-DFEVLPEHTLTIKATDG 2007          
BLAST of Protocadherin vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 141.739 bits (356), Expect = 1.726e-33
Identity = 142/554 (25.63%), Postives = 247/554 (44.58%), Query Frame = 3
Query:  432 LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVAFDGVI---STKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLE-SIQNFENRRHY----KLVTAPTSSFDREVKDHHQLNIICSDMGV-----PSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML------SPECLENFNIDPFSGMITTR--VSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTF-SFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHG 2021
            + + + DVN++ P FD +++  +I+EN     ++    A D D GNNG + +++  +   +  + I   T         +K+L+S DRE  +     +IA D G P   S   + I + DVND+ P+      R   PE +  G  +  + A D+DI   S++  +++       +D  S    G I   + +  L Y  + F + + I   D G+P L+ +  + V + DI  N   IE    +      + EN +  + +  + +  K+ G+  +V+ +       NLE  I   +   H+    K     T   DRE K  + + +   D        P       + + + D ND+ P+  +     S+ EN P    + +++A D D   N     ++       P+    F ID  SG ITT      DRE QSE+++  +  D    ++ S++ + V +LDENDN P F +    + ++    G L R+ AVD D G+NA++ Y +      F I  NG+I  S+  + D    + Y++ + A DHG
Sbjct:  706 MKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTG-------IVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHS----GCIFIHAPEYPLDYHKTPF-FNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEF--DDVAKEASVYENSEIGTEV--IMIEAKETGDEQKVKAE-------NLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSF--FRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVRSKFAGKLCRIFAVDADEGENARLTYNITEGDARFSIDNNGNIIASEAIHGD----ESYALTVQATDHG 1230          

HSP 2 Score: 140.584 bits (353), Expect = 3.205e-33
Identity = 174/663 (26.24%), Postives = 290/663 (43.74%), Query Frame = 3
Query:  435 PILVADV-NDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQ-NFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKD--ENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY------MLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYD-----HLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLEG--VLGRVEAVDKDIGQNAQMDYFLF-----NPSPLFEIS-RNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            PI++ +  N + P F       ++ E++P    V    A D D G NG + Y I   A S+  VL     +     +  L  L     E+  + QL + A D G P  +S  T+K+ I DVN+H+PQF++ SY     E+   G+ I +V A D D  +   I  S   + +     S      I  K  +V +  S D      +   IIA D G P   + + + + V D+NDN P   +    Q++R  + E+    ++++ +   D+D G N +++      +L N E +    ++      + AP    D        L+I  +D G P L+T+  + V + D   N     F    +  S+ EN  IGT+V  ++A  K+ G   ++K       ++  +   +F+ID   G + T    DRE +S Y +   A D     +   R    + + + ILD ND+ P   +  +   + EN     V+ +VEA D D   N      +F     +P   F I   +G I  S  R LDRE+   + + +   D G   L S+  V + + D NDNSPTF +     H + S+ +    K+    A+D D GENA++ Y I      +   ++G+I  ++++  +      + + A D G
Sbjct:  594 PIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEV-LDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVIS------IDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVV----QHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLK------FLLNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEA--KETGDEQKVKAENLEYRIIGGDGWPHFSIDQ-KGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQ---AIH-HYSVRSKFAGKLCRIFAVDADEGENARLTYNITEGDARFSIDNNGNIIASEAIHGDESYA--LTVQATDHG 1230          

HSP 3 Score: 125.561 bits (314), Expect = 1.229e-28
Identity = 165/648 (25.46%), Postives = 275/648 (42.44%), Query Frame = 3
Query:  444 VADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS-SRVTIMMSPSASSQ------------------IMDKFS-----VAFDGVI--STKVALVYVSSS-FDYRIP------IIAVDSGNPTLTATSTVLV-------------HVTDINDNRPIIEIASSNQNN----------RLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFD----REVKDHHQLNIICSDMGVPSLTTTRP-------------------------ITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENF-NIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENL---EGVLGRVEAVDKDIGQNAQMDYFLF--------NPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTF 2093
            + DVNDN P+F      F I+E++     V +  A D D   +G + +++         V  +P  +   +S   L +    DRE  + ++LI  A D G     + L   I ++DVND  PQF +    FN    +     I      D D+S + V+    P  + +                  + +K        AFDGV   STKV +   SS   D R P      I+A +S   T+    + L+             +V  +N    I+++  S+Q +          RL + +N +    +  V + + +      +E  L  +   NL + ++   R++   + A  + FD    R V D   L  I    GV  +T  +P                         I V V D+NDN P F +   S+ ++E+  IG ++   +A   D   N  I+Y L P  + +F N++  +G++T     D E  S  K+   A D  +  + +   + ++++DENDN PKF +  +   +KEN    E VL  V+A+D D      + Y L          P   F I+ NGD+ +SQ   +D E++ +Y++++ A+D G  PL S   +EI ++D ND++PTF
Sbjct: 2702 IGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSL---------VEENPYFDLNENSGW-LTVASQLDREKIDHYKLIARATDEGG--FNTDLPFTIVVSDVNDSPPQFEKE--EFNIDLHLPSTSPILHFSIKDDDLSPNNVSQFFIPKGNEEGVFWIDSNNDLLLKRPEIVENKMQYQLKVTAFDGVFETSTKVKINLKSSKDSDIRCPEANKTVILAENSKKGTVVLGESSLLGPNVTFKLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSED--ARQYITRIVAEDADFDEIKFRMVDDFGGLFQIDDINGV--VTVVKPLDSEILGFFNLTVVASDGEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGD--QNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVL-TVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQS--IDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTF 3326          

HSP 4 Score: 114.775 bits (286), Expect = 2.847e-25
Identity = 145/597 (24.29%), Postives = 258/597 (43.22%), Query Frame = 3
Query:  177 EENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDNN--VEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKD------ISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR------IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQ---VECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILEN-LPIGTKVTRLKAIDKD-IGVNAQIKYMLSPECLEN-------------FNIDPFSGMITTRVSFDREVQ--------------SEYKVKATAYDHLILRMNSSITIHVTILDE--NDNPPKFLRTFSFHIKEN 1823
            E+      RI      F +I+   +D+F   F+++D N  V +++ LD E L           +N       + ++   G       + + V D NDN P+F++ T++ K+ E+     E+    A   D+  N ++ Y +KPS V++ FV ++  T         L + +  D E     +L ++AKD G PPL +   ++I + D ND+AP+F +  Y     E+   G+ +  V A D D      +S  + I+   +  + ++  F++  +G        V +S S DY       + +IA D G P L + + + +HV D ND+ P  +    + N   ++ E       + K +VSD D   NG    VE + D          ++F+     +L+TA    + +  KD + L +I  D  V   TT  P+T+ ++  + + P        ++ L+N LP G  + RLKA D+D    N  +++ L    +++             F +DP +G I +  S  + +               S  +V  T+ D+ ++    SI I    +DE    +  +F R  S H+  N
Sbjct: 3028 EDARQYITRIVAEDADFDEIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEIL---------GFFN-------LTVVASDGEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQ--NETIEYYLKPSDVTS-FVNLNAQTGI-------LTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVL-PFAINSNGD-------VLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFD----DCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDG--------AKSFKVNEKLELLTAKKLEYRK--KDKYLLTVIAKD--VKGKTTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEGI-IGRLKASDEDEEDQNGLLRFGLVEGSIQSPRAQVQESRSTHLFRVDPNTGDIWSDHSITQGLHTFNVTVTDSKFNTVSYVEVHVTSIDNDVIDHAVSIRIRSMSVDEFMRKHVKEFRRIISHHLNLN 3573          

HSP 5 Score: 105.145 bits (261), Expect = 2.201e-22
Identity = 135/540 (25.00%), Postives = 238/540 (44.07%), Query Frame = 3
Query:  702 DEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNL-------ESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIIC-SDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGV--LGRVEAVDKDIGQNAQMDYFL--FNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQ 2282
            D+ +Q+ L+ +D       S+LT+ +   D+ND  P F    Y  +  ES  +G  +  V ATD D +  +   +   + SQ    FSV    G I+    L +  +     + I A DS NP   AT+TV V++   +   P      SN +    + E+    + I +V           Q+E ++D    F +       +S   F   R    +    SS DRE K+  ++ I   +  GV ++TT   +TV + D NDN P F+  +E  +I E+  +GT VT   A+D+D   + +I++ L  E    F+++  SG +T     DRE    YK+ A A D      N+ +   + + D ND+PP+F +   F+I  +L     +      D D+  N    +F+   N   +F I  N D+ + +   ++ +   +Y +++ A D       +ST V+I +    D+      P+  + + L+  + +GT +    ++    G N     +     +F +N  +G + + +S Q
Sbjct: 2470 DKRYQIPLVVEDATGRRAFSTLTLSV--IDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIEYSLLDGSESQF---FSVHPRQGTITVAKKLEH-KAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRF----SNSHYLFSVMEDADVGNVIGRVQ----------QMETEIDE-IRFTIVPGSEESDSFLPFSVERSTGKIIV-KSSLDRERKNQWKMTIRADAAGGVHAITT---VTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEEN-PYFDLNENSGWLTVASQLDREKIDHYKLIARATDE--GGFNTDLPFTIVVSDVNDSPPQFEKE-EFNIDLHLPSTSPILHFSIKDDDLSPNNVSQFFIPKGNEEGVFWIDSNNDLLLKRPEIVENKM--QYQLKVTAFDG---VFETSTKVKINLKSSKDSDIRC--PEANKTVILAENSKKGTVVLGESSL---LGPNVTFKLSDNDGNVFVVNFRNGIVKVKESDQ 2970          

HSP 6 Score: 80.8777 bits (198), Expect = 5.871e-15
Identity = 146/661 (22.09%), Postives = 265/661 (40.09%), Query Frame = 3
Query:  423 FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDE-EFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR--IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAK-------VTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRP--ITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFD-REVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEGVLGRVEAVDKDIGQNAQMDYF-LFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI-FYINTSDGSIYLNKSLQ--DEHILPDKIIISARDSGII 2339
            F    + + D NDN P F   T    + E+    + +    A D DRG NG V Y+I      N+  L       G     ++++ +  D E+   E  L + A D     L   +++ I  ++      +F++  Y+    +S   G  +  + A        V+  + P+ +      F V     +S  V L    +   +R  +   A+          + V+  +   N + PI       Q  R  + EN  + S +         V+  D+D G+NG V  ++    +  +F+++          Y        SFD E    +   +   DMG P   +  P  I V V DEND PP F      +S++  LP    V+      +D+     ++Y +  + +  F++D  +G +  + S    ++   + ++    D    + ++S  + ++ +   ++  KF R  +   + EN     G +      IG   ++D+F + NP   F I     +  S    LDRE+     + + A+ H   P+ +   V + I++IND +P F+    G   +++I  +  GT +   K IDND G+    V TI S+ +  Y     G + L K L   +E  L     + A+D+G +
Sbjct: 1450 FATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSI---VSGNEESLFKIDAKSG-----EVRLAKPLDPELQHVESILRIRAIDSAANSLKDEMSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNALHH---GTVSYKLEPNCTF-----FEVH---TLSGAVHLATWLTKLKHRKSVECTAIVESTEGQQDIAKVIAKIIRTNQHSPIFR----RQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVD---------QYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLDISMI--LPTANGVSVGGQTAQDMDSVGSLRYFIKDQSVP-FSVDSKTGDVLVKDSNGISDMTKLFDLEVFVTDG---KQSASYVMKISTISTENSKFKFTRNEYHTSLIENTTLPPGSIILSVATIGD--KLDHFSIVNPHEAFFIHPGTGVISSSGIALDREKSAIIRLVVQAKSHEKNPVMARALVVVGIENINDETPIFM----GTPYDITIGHSDIGTVVLEPKVIDNDEGD----VVTISSENMPEYFKIVGGKVVLGKKLPSIEEEDLEFNFKLIAKDNGSV 2062          

HSP 7 Score: 80.1073 bits (196), Expect = 9.415e-15
Identity = 139/635 (21.89%), Postives = 266/635 (41.89%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHN---EVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPII------EIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECL---ENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHI---KENLEGVLGRVEAVDKDIGQNAQMDYFLF--NPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQ-TIFYINTSDGSIYLNKSL 2279
            I + D ND+ P   +  +   +AENSPA+    +VE   A D D      +++ I+     + F +       G+ ++  ++ L   DRE   E +L +   D G P L S++ + +++ D ND++P F Q+ + ++   S   G+ + ++FA D D    +R+T  ++   +     +FS+  +G I   +A   +     Y + + A D G P     +T +V   +    +P        EI+    +  + +++  Q    + K+  SD D           D + +F++            +L+ A      +  +   +LNI  +D      +T   + + V  +    P F   H    + E + +GT++  LKA  + +G    +  + S + +   +   ++P SG +      D E     +            M S  T  V I DENDN P F+   +F      + ++ VL  V A DKD G+N  + Y +   N   LF+I +++G++ +++    + + V+   + I A D     L    ++   I + N+   T    +      L   T  GT +    A+ + T     + Y ++   T F ++T  G+++L   L
Sbjct: 1034 IRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRI---DLTSGYITTSGIRRL---DREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSV-RSKFAGK-LCRIFAVDADEGENARLTYNITEGDA-----RFSIDNNGNI---IASEAIHGDESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGDELWWSISSGDPDSVFDVRQDTG-------QLLLAKKVELLK--RGELRLNISVTDGQAWDHST---VIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPLVFNLFSVDDVAMEDKIRVEPSSGNVIVMEPLDYEAARRIRAVVQVQQ---ANMKSFATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGEVRLAKPLDPELQHVESI-LRIRAIDSAANSLKDEMSLH--IRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNALHHGT-----VSYKLEPNCTFFEVHTLSGAVHLATWL 1629          

HSP 8 Score: 70.4774 bits (171), Expect = 9.628e-12
Identity = 140/609 (22.99%), Postives = 250/609 (41.05%), Query Frame = 3
Query:  657 SSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKD------------HGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSIT---IHVTILDENDNPPKFL-RTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLF----NPSPLFEISR-NGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFY-INTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            S+ K+ +  S DRE   ++++ + A   G   + +  T+ +DI DVND+AP F+    RF   E    G ++    A D+D S    I  S    +   D         ++     + V+S  D      Y++   A D G        T++V  +D+ND+ P  E    N +  L       S S I   ++ D D             GN   V     NN L  L+  +  EN+  Y+L     ++FD                GV    T+  + + +K   D+       +++V + EN   GT V    ++   +G N  + + LS      F ++  +G++  + S   + +   +++   +  L ++ NS +    I V I + NDN PK + +     I ENL       + + + + ++A  D   F    +   LF+I   NG   V+  + LD E +  +++ + A D          T+ + + D NDN+PTF +      + +  E+I G ++   +A   D  E  +        T F  +N   G + L K L  E +   K+ + A+DSG+ P  T + + ++ +    + P
Sbjct: 2662 STGKIIVKSSLDRERKNQWKMTIRADAAGG--VHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFD---------LNENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFTIVV--SDVNDSPPQFEKEEFNIDLHL------PSTSPILHFSIKDDDLSPNNVSQFFIPKGNEEGVFWIDSNNDLL-LKRPEIVENKMQYQL---KVTAFD----------------GV--FETSTKVKINLKSSKDSDIRCPEANKTVILAENSKKGTVVLGESSL---LGPN--VTFKLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLE---FHRLTIQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDDFGGLFQIDDING--VVTVVKPLDSEILGFFNLTVVASDG---EFEDKATILVTVIDQNDNAPTFEKSTYSMKV-MESESI-GYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAP 3214          

HSP 9 Score: 66.2402 bits (160), Expect = 1.662e-10
Identity = 133/575 (23.13%), Postives = 243/575 (42.26%), Query Frame = 3
Query:  729 AKDLGNPPLTSSLTIKIDI-TDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVEC-KLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQ-LNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN---------FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTF-SFHIKENL-EG-VLGRVEAVDKDIGQNAQMDYFLFN--PSPLFEIS-RNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI--ETIQGTKIFTAKAIDNDTGENAKIVYTI-----QSQTI--FYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLN 2372
            A+++  P + +   ++I + + +  HAP F +  Y  +TPES   GQ +  + AT  D +  +   +S S   +I  +      G ++    L Y  +   Y + ++A  SG   +++ +  +V + D+ND  P  E   S+ + +  ++++  +  +I  ++ +D D  N+   E  KL    +   E++ N         +  P    D   +D  + LN+  +D G+ +      + ++       PP F + H   + LEN  +        A+    G    +++ L+P    N           ID  +G I      +      Y++     D    R  S++T+  +++D ND PP F+  F S  I E+  EG  +  V A D D  +N  ++Y L +   S  F +  R G I V++K  L+ +     S+ I A D  N P  ++TTVE+ I   +   P F       H   S+  +   G  I   + ++ +  E   I +TI     +S +   F +  S G I +  SL  E     K+ I A  +G +   TT ++ + 
Sbjct: 2157 AREVTRPKMIAKAQVEIIVKSGITTHAPVFEKLKYTASTPESTSIGQRLLTIKATTSDENDTIEYSLSGSKDIEIHPE-----TGDVTITGQLDYEKTQ-KYDLKLVATSSGK-QVSSEAEFIVLIEDVNDEMP--EFIRSDVSAK--ISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTD-GMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANALENTIVNKSALLTVAVK---GGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFSTLTL--SVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDD--ENDTIEYSLLDGSESQFFSVHPRQGTITVAKK--LEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRF----SNSHYLFSVMEDADVGNVIGRVQQMETEIDE---IRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHAITTVTVDIG 2703          

HSP 10 Score: 55.4546 bits (132), Expect = 3.375e-7
Identity = 81/375 (21.60%), Postives = 154/375 (41.07%), Query Frame = 3
Query:  684 SFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTV-SDKDHGNNGQVECK-LDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDE-NDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT 1799
            + DRE     +L++ AK     P+ +   + + I ++ND  P F  + Y      S + G  + +    D D    VTI     +S  + + F +    V+  K          ++   +IA D+G+        V + V D    RP+    S N    ++  E+ + ++ + KV   S     + G +  + LD    F+++ +       + K++     +F+ E +          ++  P +     + ++VK     + P+F +   + S  E+  IG ++  +KA   D   N  I+Y LS    ++  I P +G +T     D E   +Y +K  A      +++S     V I D ND  P+F+R+
Sbjct: 1941 ALDREKSAIIRLVVQAKSHEKNPVMARALVVVGIENINDETPIFMGTPYDITIGHSDI-GTVVLEPKVIDNDEGDVVTI-----SSENMPEYFKIVGGKVVLGKKLPSIEEEDLEFNFKLIAKDNGS-VHRVEEPVKIRVVD--KARPVF---SQNVYTAVISKESTKKSTVLVKVMAKSSLQSKSKGLIGYRILDKKSPFSVDFLTGEVRLNNLKMLAETNYTFEVEAR----------EVTRPKMIAKAQVEIIVKSGITTHAPVFEKLKYTASTPESTSIGQRLLTIKATTSD--ENDTIEYSLSGS--KDIEIHPETGDVTITGQLDYEKTQKYDLKLVATSSG-KQVSSEAEFIVLIEDVNDEMPEFIRS 2288          

HSP 11 Score: 55.4546 bits (132), Expect = 3.461e-7
Identity = 62/280 (22.14%), Postives = 126/280 (45.00%), Query Frame = 3
Query: 1617 FNIDPFSG---------MITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTG---ENAKIVYTI--QSQTIFYINTSDGSIYLNKSLQDEHILPD---KIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPP 2405
            F++D  +G         +  T  +F+ E +   + K  A   + + + S IT H  + +      K   T S     ++   L  ++A   D  +N  ++Y L     +      GD+ ++ +  LD E+  +Y +++ A   G + ++S     ++I+D+ND  P FI       ++ S  T Q   I +A  +D       E+ K++Y I    +T+F I+ + G + L + ++ + ++ +   K++  +   G+   T  + L +  +RSG  +PPP
Sbjct: 2129 FSVDFLTGEVRLNNLKMLAETNYTFEVEAREVTRPKMIAKAQVEIIVKSGITTHAPVFE------KLKYTASTPESTSIGQRLLTIKATTSD--ENDTIEYSLSGSKDIEIHPETGDVTITGQ--LDYEKTQKYDLKLVATSSG-KQVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTDGMF--TAYAKLVVEILRSGSMQPPP 2395          

HSP 12 Score: 52.7582 bits (125), Expect = 1.819e-6
Identity = 150/686 (21.87%), Postives = 263/686 (38.34%), Query Frame = 3
Query:  357 QYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVE----LPL---ARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDS---SLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSL--TIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRP-IIEIAS-SNQNNRLVLTENCQSNSYIAKVTVSDKD-HGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDH-LILRMNSSITIHVTILDENDNPPKFLRTFSFHI--KENLEGVLGRVEAVDKDIGQNAQ---MDYFLFNPSPLFEIS-RNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIII-DDINDNSPTFIEPKPGQHLNLSIETIQ----GTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            +  + +  +C  I+E +       ++   +   N + P F R  +   I EN P  + V     LPL   A D D G+NG V Y            ++SP   Q       S  ++   SFD E  +E+   + A D+G PP  S +   I + + D ND  P+F  +S   +       G ++G   A D D         S  +    +   SV F   + +K   V V  S           +G   +T    + V VTD   +   +++I++ S +N++   T N    S I   T+       +   +  KLD+  + N    + F       ++++   + DRE     +L +         +     + V +++ ND  PIF      ++I  +  IGT V   K ID D G    I     PE    F I     ++  ++    E   E+  K  A D+  + R+   + I V     +   P F +     +  KE+ +     V+ + K   Q+     + Y + +    F +    G++ ++  + L       Y+ E+ AR+     + +   VEII+   I  ++P F      + L  +  T +    G ++ T KA  +D  EN  I Y++       I+   G + +   L  E      + + A  SG
Sbjct: 1631 KLKHRKSVECTAIVESTEGQQDIAKVIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYR-----------MLSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLDISMILPTANGVSVGGQTAQDMD---------SVGSLRYFIKDQSVPFS--VDSKTGDVLVKDS-----------NGISDMTKLFDLEVFVTDGKQSASYVMKISTISTENSKFKFTRNEYHTSLIENTTLPPGSIILSVATIGDKLDHFSIVNPH--EAFFIHPGTGVISSSGIALDREKSAIIRLVVQAKSHEKNPVMARALVVVGIENINDETPIFMGTPYDITIGHS-DIGTVVLEPKVIDNDEGDVVTISSENMPEY---FKIVGGKVVLGKKLPSIEEEDLEFNFKLIAKDNGSVHRVEEPVKIRVV----DKARPVFSQNVYTAVISKESTKKSTVLVKVMAKSSLQSKSKGLIGYRILDKKSPFSVDFLTGEVRLNNLKMLAET---NYTFEVEAREVTRPKMIAKAQVEIIVKSGITTHAPVF------EKLKYTASTPESTSIGQRLLTIKATTSD--ENDTIEYSLSGSKDIEIHPETGDVTITGQLDYEKTQKYDLKLVATSSG 2262          

HSP 13 Score: 52.373 bits (124), Expect = 2.548e-6
Identity = 121/484 (25.00%), Postives = 207/484 (42.77%), Query Frame = 3
Query: 1071 LTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDN-NYLFNLESIQNF-ENRRHYK--LVTAPTSSFDREVKDHH-QLNIICSDMGVPSLTTTR-----PITVVVKDENDNPPIFY-RQHESVSILENLPIGTKVTRLKAIDKD---------IGVNA--QIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGR--------VEAVDKDIGQNAQMDYF---LFNPSPLFEI-SRNGDIFVSQKRYLDR-ERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGK---SKPPPM 2408
            L  T+ + + V D ND  P+  +    Q     + ++ +  S + +V  SD D G N  +   L N ++ F +E +  +  + RH K    +    S DR  + ++   N +        L T R     P  ++V     NP I   RQ  ++  L++ P    +  LK  +K+         +G +   ++++ML  +   N +  P +  +T  +  D   +S + +        ++  N ++TI +  L E+    +FL      +K +    +GR        VE  D        ++Y    L N +  F I S+NG + VS K  ++R ERV  Y+ ++ A  HG     +   V I I D ND++P F   K  +   + I    G  +    A D D GEN KIVY   S+    IN + G I L +  +  +  P    + A D G +P +  S+L+L F ++G    +KP P+
Sbjct:  133 LETTARIHLRVIDRNDASPVFLVG--EQGYEAEIDDDLEPFSTVLRVEASDADIGINSAIYFSLVNRSHDFIVEPVTGWVRSLRHVKPGKYSLKVKSEDRASRLYYFDENEVQPSWTADVLITVRETKPKPRRILVDQRKINPNILNNRQLAAIITLKDSP-NDAIVGLKGNEKEHWFEVEPEVVGNDGTKELRWMLYAK---NGSQVPKNTNVTLTIGEDYIRRSGFSISKKP----VIPTNETVTIQIERLAEH--LIRFLDNEKLTLKTDEMAPIGRILYRMNVNVENPDDVSLIRYSLEYSKSDLPNATLPFAIGSKNGILRVSAK--INRSERV--YNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVF-SAKWMRQTPIVIGK-PGDVLVKVDATDQDEGENGKIVYKFTSELPLEINANTGEITLVEVPKKGNSWP--ATVWAIDLG-LPLSRMSALNLMFYKNGTKIPAKPKPI 595          
BLAST of Protocadherin vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 134.035 bits (336), Expect = 3.134e-31
Identity = 164/592 (27.70%), Postives = 257/592 (43.41%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQ-GQAIGQVFATDKD---ISSRVTIMMSPSASSQIMDKFSVA-FDGVISTKVAL-----VYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPII--EIASSNQNNRLVLTENCQSNS-YIAKVTVSDKDH--GNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQ--LNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQI-KYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYD--HLILRM-----NSSITIHVTILDENDNPPKFLRTFSFHIKENL-EGV-LGRVEAVDKDIGQNAQMDYFLFN----PSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPT-FIEPKP 2108
            ++ I++ DVNDN PSF+   +  ++ E+    ++V    A D D+ +N  + Y +         +     T+ G      + + +  D E  +++ L+LIA D G    T+++ I I+  DVND+APQF Q  Y     E  V   + +  V ATD D    SSR+   +    + ++   F +  + G I    AL       V S   +   + A+D     L   + V V+V DINDN PI    +    + NR    E   S+  Y   V   D D     N  +E  +  N L N ES+  F   ++   + A   S DRE+    +  + +  +D GVPS      +T+ V D NDN P F +     S+ E  PIG  V    A D D      +  Y LS E  + F +        + V   R  Q       T  D  HL +R+     ++   +HV ++D ND+ P         ++E++  G  +GR  A D+D G  A+   F  N    P   F I ++G + V+    LDRE +  Y++ I A D+ N        V + + D+NDN P  +  P+P
Sbjct: 1320 KVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN--LRYHL--IGAGGGRIPFGVRTDSG-----TIFVKEPLDFEASDQYHLVLIASD-GRHNATTNVYIHIE--DVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEV---FRIGKYSGTIELVKALDRDPPAGVPS---WNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENR----EPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESV--FRIDQNTGKIFA-MRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEES-DYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTAR---FRINRQSDPKRQFTIDQDGTLRVAHT--LDREDIAVYNLIIEAYDNSNN--IGRQMVAVYLQDVNDNGPEPYTVPRP 1878          

HSP 2 Score: 122.479 bits (306), Expect = 1.034e-27
Identity = 181/697 (25.97%), Postives = 293/697 (42.04%), Query Frame = 3
Query:  432 LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNP-PLTSSLTIKIDITDVNDHAPQF-NQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSA-SSQIMDKFSV-AFDGVISTK---VALVYVSSSFDYRIPIIAVDSGN----PTLTATS--TVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSN-SYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVT-APTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML-----SPECLENFNIDPF------SGMITTRVSFDREVQSEYKVKATAYDHLILR-MNSSITIHVTILDENDNPPKFLRT----FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSP----------LFEISRNGDIFVSQ--KRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFI----------EPKPGQHLNLSIETIQGTKIFTAKAIDNDT-GENAKIVYTIQSQT------IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGI 2336
            L I + DVNDNVP+F R  +  ++ E+ P +  +    A D D G+N  + Y++     ++ F     S N   + S K+++      E    ++  + A+D G P  L+SS  I I   + ND +  F   S Y     E    G  + Q+ A D D        M  +  S+Q M+ FS+    G++  +    A     +     + +I  D G+    P+ T TS  T+L+ + D+N+N+P     +   +   ++    +++   I KV  +D D   NG +   L   Y    ES + F   R   ++T +P   FDRE +    + +  +D G   L      +V V D NDN P F R     S+     +GT V  + A D D   NA+I Y L     + E  +N ++D F      SG IT       + Q ++     A D+ I   + SS  + + +LD+    PK+  +        + EN+E   V+ R  AV     +N+ + Y L                F    NG+ +V       LD E+V+ Y++ + A D  +R + S+ T  + + D+ND  P F           E  P +HL    E   G  I T KAID D+ G   ++ Y I  +        F I+   G I+ N+    E I    + + A D  +
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVD----NHNF-----SINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSL---YYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQN-DLDFFELVNRRSGEITLIKPIPMKTQ-KFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSR-VASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHL----EKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSV 1305          

HSP 3 Score: 115.161 bits (287), Expect = 1.748e-25
Identity = 163/697 (23.39%), Postives = 287/697 (41.18%), Query Frame = 3
Query:  423 FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLK-LKILQSFDREI---------DEEFQLILIAKDLGNP-PLTSSLTIKIDITDVNDHAPQFNQS---------SYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPS--ASSQI--MDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRP--IIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKL--VTA---PTSSFDREVKDHHQLNIICSDMGVPSLTTTR-------PITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF--LRTFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDI--FVSQKRYLDRE---RVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIF----TAKAIDNDTGENAKIVYT------IQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISAR--DSGI 2336
            F Q  + V D+NDN P F+R ++   ++        V    A D D  +N  + Y+++          I  +  + H + L   +++     EI          ++F   +IA D G P  L SS  + +++ D    AP++  S                + I++ +A+    + + D+  ++T    P   A S+    +KF    + V    +  +      +Y + + A D     + +T T +V V D+ND  P   +++ +   +  +   E+ +  +    VTV   D  ++G       N   + +    N E  +H+++  +T    P   FDRE  D + L +  SD  V +L            + +V+ D NDN P F  Q     + E+   G  V  +KA D D   N +   + +      F +   SG I  +   D E   +Y +   A D    R N++  +++ I D NDN P+F   +  +  I+E+++   VL  V A D D  + +    +        E+ R G     +   + LDR+    V  ++  + A D     L     V++ + DINDNSP F E   G ++  + E I    ++     A+  D+ T ENA I Y       I  +++F I+ + G I+  +SL  E     + II  R  D G+
Sbjct:  962 FCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLE----------IDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGP-----QNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFG-YIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGV 1638          

HSP 4 Score: 114.775 bits (286), Expect = 2.558e-25
Identity = 168/674 (24.93%), Postives = 276/674 (40.95%), Query Frame = 3
Query:  423 FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPL-----ARDPDRGNNGSVVYAIK-PSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---------GVISTKVALVYVSSSFDYRIPIIAVDSGNP-TLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL------DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPI--------GTKVTRLKAIDKDI-GVNAQIKYMLSPEC----LENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSS-------ITIHVTILDENDNPPKF-LRTFSFHIKENLEGVLGRVEAVDK-DIGQNAQMDYFLFNPS----PLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHL---NLSIETIQGTKIFTAKAIDNDTGE-NAKIVYTIQSQT---IFYINTSDGSIYLNKSL 2279
            +  L I + DVN+N P F        IA+      + + P      A D D   NG +VY++    + S K  +I   T       L       FDRE      + + A D G+ PL       +++ D+ND++PQF + SY  +       G ++  VFA D D +    I  S    +   ++     D         G I+    +   +  F +   +IA D+G P  L +++ V ++V D     P  +  S +    + + EN + N  I +          N  V  KL       N           FEN   +  V       D E  +++ L +  +DM    + +T+   V V+D ND  P F     + +I E +          G  +  +KAID D  G   ++ Y +  E      ++F ID  +G I     FDRE    Y +   A D  +  +  +       + + + I D NDN P F  + +   +KE+ EG    V  +   D+ +++ + Y L        P    + +G IFV  K  LD E  D+Y + + A D  +    ++T V I I+D+NDN+P F + K    +   ++ I  +    +F   A D D  E +++IVY ++ Q    +F I    G+I L K+L
Sbjct:  848 YATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQT-----GVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFN--VIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQ-TSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVI-MEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKES-EGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFV--KEPLDFEASDQYHLVLIASDGRH---NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKV----LFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKAL 1501          

HSP 5 Score: 87.0409 bits (214), Expect = 7.790e-17
Identity = 154/614 (25.08%), Postives = 249/614 (40.55%), Query Frame = 3
Query:  558 DRGNNGSVVYAIKPSAVSN--KFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVAL---VYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDH--------GNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMG----VPSLTTTRPITVV--VKDENDNPPIF---YRQHESVSILENLPIGT------KVTRLKAIDKDIGVNAQIKYML---SPECLENFNIDPFSGMIT--TRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGRVEAV----------DKDIGQNAQMDYFLF----------NPSPLFEI--SRNGDIFVSQKRYLDRERVDRYSIEIGARDHG-NRPLTSSTTVEIIIDDINDNSP---TFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS 2222
            D  + G + Y+++     +  K+  I PST   H     L  L  FD     +   + +     N      LTI+ID  DVND+ P F +  Y     E I   Q I +V A DKD      I  S    +     FS+  +G IS KV L         F YR  + A D G P ++ +S+ ++H+   N N        ++Q    V  E+ Q  + + ++   D D           NG+   K++   LF+++        RH   V+A   +   E ++   L +I  D G     PS T T   T++  ++D N+N P F    +  +   I+E    GT       + +++A D D   N  I Y L     E  + F ID  +G++T    V FDRE +    V   A D     +       V ++D NDN P+F R        + E  + R EAV          D D   NA++ Y L           N    FE+   R+G+I + +   +   +  ++   + A D+G    L SS  V + + D    +P   T  + KPG  ++ ++E      I   +A+ +    N+ ++Y + +
Sbjct:  562 DGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIH-----LTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRID--DVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN-----FSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEP-VSLSSSAMIHIRTENTNDESAVFLPTSQYTAFV-AEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMN---LFSIDEHTGLVKLRHG--VSAADLA---EAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIME----GTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERP-------SYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM---KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVEL--NKVILRCRAVSSGDSRNSDVIYKLTA 1137          

HSP 6 Score: 85.5001 bits (210), Expect = 2.201e-16
Identity = 141/552 (25.54%), Postives = 223/552 (40.40%), Query Frame = 3
Query:  423 FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPL---ARDPD--RGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLIL--IAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD--------GVISTKVALVY--VSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPT----SSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVT-RLKAIDKDIG---------VNAQIKYMLSPECLENFNIDPFSG--MITTRVSFDREVQSEYKVKATAYDHLIL-----RMNSSITIHVTILDENDNPPKFLRTFSFHIKENL----EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVS 1952
            +  + + V D+NDN P F    F +      P H++    +   ARD D     N ++ Y I  + + N   +     N G     K+  ++S DREI  E + I+   A D G P       + I +TD+ND+AP F ++ Y  +  E+   G A+    A D D  ++  +       S+  D F V  D        GV+  K  L Y  V+    + + I   D  +    A + V V + D ND+ P I  A+ ++     + E+    + I + T +D+D G+  +        +  N +S    + +R + +    T     + DRE  D    N+I       +    + + V ++D NDN P  Y         EN P+    T  ++A D+D           V+   KY      + N N D  +G   IT    FDRE     K+       LIL     R N + ++HV I D NDN     R  + H+   L    E V+GRV   D D        +   +  P FE+S  G I ++
Sbjct: 1529 YADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTG-----KIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTY--QLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRH---DAEAAVHVALVDRNDHAPHIHGATEHR-----VREDVPRGTSIGRYTATDRDAGDTAR--------FRINRQS----DPKRQFTIDQDGTLRVAHTLDRE--DIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIP---LILADRAGRRNEA-SVHVIIGDLNDNTMHDGR-MTIHVNSYLGRLKETVIGRVYVDDADDWDLGDKTFSWKDSRPGFELSDKGSITMA 2046          

HSP 7 Score: 65.4698 bits (158), Expect = 2.928e-10
Identity = 131/594 (22.05%), Postives = 233/594 (39.23%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPL------ARDPDRGNNGS-VVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDE---EFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRF---NTPESIVQGQAIGQVFATDKDISS------RVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQV---ECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHL--ILRMNSSITIHVTILDENDNPPK-FLRTFSFHIKENLE-GVLGRVE--AVDKDIGQNAQMDYFLFNPSPLFEISR-------------NGDIFVSQKRYLDRER-VDRYSIEIG---ARDHGNRPLTSSTTVEIIIDDINDNS 2084
            I + DVNDN P F++  +   + E      +V++P       A D D+    S +VY ++       F +           S  ++++++ DR+       +  ++ A D     L     +++++ D+ND++P F +  + +   N       G     V A D D  +         I+ +   + + + +       + + +     +SS  ++ I + A D G P+    + V + VTD+NDN P  E      +    + E     + +   +  D D      V   +   +++Y +      + ++      V  P    D   +D   L I  SD           + V + D ND+ P  +   E   + E++P GT + R  A D+D G  A+ +     +    F ID   G +    + DRE  + Y +   AYD+   I R      + V + D NDN P+ +        +EN     LG  E  A D+D  +      F    SP F+ S+             NG + ++  +  DRE  V    +EI    A   G R   +  +V +II D+NDN+
Sbjct: 1424 IHIEDVNDNAPQFEQQKYATTVIEE-----DVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRI--------GKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGS----VEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD---GRHDAEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQ-DGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQ----MVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPP--FTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADRAGRR---NEASVHVIIGDLNDNT 1986          

HSP 8 Score: 53.5286 bits (127), Expect = 1.215e-6
Identity = 68/297 (22.90%), Postives = 127/297 (42.76%), Query Frame = 3
Query:  255 NFQNFFRLNDNNVEM--LQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSG----PKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRP 1127
            N ++ FR++ N  ++  ++SLDRE  I++++             + I+ +  +  G      F  + I V D+NDN P F++  +   + E +P    V    A D D     + V+  + S  S+ F  ++   +    S   L++ Q  D E   +     +   + +    +   + + + D NDHAP  + ++      E + +G +IG+  ATD+D     T     +  S    +F++  DG +     L     +  Y + I A D+ N        V V++ D+NDN P
Sbjct: 1597 NGESVFRIDQNTGKIFAMRSLDRE--ISSER-------------EFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDN-VFTYQLSEESDYF-YVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGAT-EHRVREDVPRGTSIGRYTATDRDAGD--TARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAV-YNLIIEAYDNSNN--IGRQMVAVYLQDVNDNGP 1870          
BLAST of Protocadherin vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 242.662 bits (618), Expect = 1.011e-64
Identity = 202/672 (30.06%), Postives = 321/672 (47.77%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSV-VYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVAFD-GVISTKVAL-----VYVSSSFDYR---IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLV-LTENCQSNSYIAKVTVSDKDHGNNGQVECKL-DNNYL--FNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPS--PLFEISRNGDIFVSQ---KRYLDRERVDRYSIEIGARDHGN-RPLTSSTTVEIIIDDINDNSPTFIE-------PKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS--QTIFYINTSDGSIYL-NKSLQDEHILPD-KIIISARDSG 2333
            ++ I V DVNDN P F   +     +E++ +   + L  A D D G NG    Y I    V NKF L++ +   G  S L L+   + DRE    +QL + A+D G+PP    L + + I DVND+ P F+ S Y  +  E+ + G  +  V A+D D+   S++T  +     ++   +F+V  + GVIST   +       V SS   +     + A D G+P     + V V++ D ND+ PII         ++  + EN  + + +A V V D D G NG+   ++   N L  F LE   +         +       DRE    + L ++  D G P+ TTT  + + V D ND+ P+F +   S  + E  P G+ V  + A D+D GVNAQ+ Y +LS   L+ F++DP +G+I T    DRE++   ++  +A D       +   + V ILDEND  P+F  R  +  + E+   + ++  + A D D G N  +  F   PS   L+ +    D    Q   +R LDRE++ +Y I + ARD G   P +++ TV + + D+NDN P F               + L  E  +   +    A D D G+NA I Y ++S  + +F ++   G+I L   +    H  P  K+++SARD+G
Sbjct:  141 EVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYL-----AETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLH-------IVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVT-FALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAG 799          

HSP 2 Score: 218.394 bits (555), Expect = 3.953e-57
Identity = 211/766 (27.55%), Postives = 340/766 (44.39%), Query Frame = 3
Query:  444 VADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVIST-----KVALVYVSSSFDYR----------------IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVE---CKLDNNYLFNLESI--QNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPS-LTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSP-ECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDI-----FVSQKRYLDRERVDRYSIEIGARDHGN---RPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-----ETIQG--TKIFTAKAIDNDTGENAKIVYTIQS--QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNKKIEPKSSLSRDXXXXXXXXXXXXXFTCLLML--VTYFCASMIVQKRRQQ--RRMNIKDEIG 2585
            +ADVND+ P FD  ++   + E +  +       A D D G+NG + Y I        F +       G+     L +    DRE  + + L +  +D G P  +S + + I + D ND+APQF  S++ F+ PE+      +G++ A D+DI       +S + SSQ  D      +G I T     + ALV VS + +                  +     D+G P L     V V VTD+NDN P    A  +    + ++E     ++I  V   D D G NG V     K +    FNL+S   Q    RR            DRE ++ H L ++  D  +   L++   IT+VV DENDN P F +    VS+LE  P GT++ R +A D D GVN+Q+ + +S     + F+ID  +G +      D E  + Y +  TA D     +++++  +V ++D+NDNPP F  T     IKE   L+  +  V A D D G N ++ Y +    P     R+  I      +   R +DRE +D + + + A D      R L++   V +I++DINDN+P F+       +N +I      T +G  T +    A D D+  N  + Y I S  Q +F +  + G I      Q +  +  ++ + + D  +  +  +S +++  I  G         + E +S LS  +  +  IG  +L  T  L    + YF  ++     R Q  R  +I  ++G
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFP----DGY-----LFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAE--LSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYH----VTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRR-----------LDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVS------MNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLG 1772          

HSP 3 Score: 206.068 bits (523), Expect = 3.437e-53
Identity = 201/658 (30.55%), Postives = 310/658 (47.11%), Query Frame = 3
Query:  432 LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFN-QSSYRFNTPESIVQGQAIGQVFATD--KDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF---LRTFSFHIKENLEGVLGRVEAVDKDI-GQNAQMDYFLFNPSPLFEIS-RNGDIFVSQK-RYLDRERV----DRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLN-LSIETIQGTKIFTAKAID-NDTGENAKIVYTIQS---QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKT 2348
            L I V+DVNDN+P FD  T+N  + E       V    A D D G N  V Y I  S     +  I+  T      S KL++        D  + +++ A D G   L+S   + + I    +  P F   ++  F   E +  G+ I +V AT   K +  ++   +   A   + D   V    G++S     +    +  Y I I A D   P+L + + + ++VTD NDN P++E    N     VL E       IA V  SD+D G+NG V  +L N++    E  ++ E     +L        DRE    +   +   D GVP +T T  + + + D+NDNPP F R   S+++ EN  IG+ V R+ + D D+G NA   Y  S    E F I+P SG IT     DRE Q EY +K  A D    R  + ITI  TI D+NDN P+F     +FSF   +    ++G++ A D+D  G N+ + Y L  PSP+F I    G++F  +  R+   + V    + Y++ + A D+G  PL S   V I I D ++N P F   +  ++L  L  + ++G +I    A D  D G N ++ Y++ +    +IF +   DG I L K +Q       ++++ A D G+ P++
Sbjct: 2582 LTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI--SGRDQHYFDINTKTGV---VSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAI---AGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAE---VLEEESPPQ-LIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESGEIYTRMRL--------DREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLF-SLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDG-AWRAETPITI--TIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKF---EQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTN-EMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQS 3210          

HSP 4 Score: 194.512 bits (493), Expect = 1.180e-49
Identity = 207/696 (29.74%), Postives = 340/696 (48.85%), Query Frame = 3
Query:  369 NRDSQCILILELSGS-GPKFYQLPILVA--DVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDR-GNNGSVVYAIK-PSAVSNKFVLISPSTNQG-HDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDK-DISSRVT--IMMSPSASSQIMDKFSVA-FDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFE-NRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN--FNIDPFSGMITTRVSFDREVQSEY--KVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPS--PLFEISRN-GDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEII--IDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDT-GENAKIVYTIQSQTI---FYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNF 2375
            +R+ Q   IL++  S G    + PI +   D NDN P F+   ++F   E   +   V   +A D D+ G N  + Y+++ PS + +    I P+T +     +++ K  Q + R  +  + L ++A D G PPL S   + I+I D +++ P+F Q+ Y    P+  V+GQ I +V A DK D+ +      +M+ + SS     FSV   DG I T V  + V  +  Y + + A D G P  +  + V++ VT  N + P   + S     ++++ EN    S I  V  +D D G NG +   +           Q+F  + R   +V      +D  ++++H LNI   D+G   L++   +T+++ D NDNPP+F  +     I EN P+GT V +  A DKD   NA I Y   P   +   F ++  +G I++ VSFD E +  Y  ++KA   D     M S   ++V +L  N+  P+FL+  F F + E   +   +G V+A DKD G++ ++ Y L   S    F I  N G I+V+  R+LDRE  +R  + + A+++G+     +   ++I  I D ND  P FI  K      +S     GTK+ T KAID D   +N +  Y+I +  +   F I+   G I     L  E      ++I A D+G+ P+T ++++H+  
Sbjct: 2975 DREQQDEYILKVVASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFS----IDPATGEVFSKKAVRFKHSQ-YVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSS----IFSVGRHDGWI-TLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSY----QVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGG-----NERQDFSVDERTGGIVIQQQLDYDL-IQEYH-LNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDS---SMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVA--RHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFI--KHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIEL 3641          

HSP 5 Score: 191.045 bits (484), Expect = 1.263e-48
Identity = 191/702 (27.21%), Postives = 314/702 (44.73%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR------IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMG------------------------------------VPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN--------FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDY--FLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHG-NRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGE-NAKIVYTIQS--QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTS 2357
            + V D ND+ P F    F + ++E+    + +    A DPD    GSV + +       KF L+ PST        KL +  + DRE   +++L +   D G     +  TI++  +D ND+ P F  + Y F+ PE+  +G  +GQ+ A D D+     +      S    D FS      ++ +  ++ +++  DY       + + A D+G P+L+ T TV  +V D+NDN PI +  S +      + EN    + +  V+  D D GNNG +E  +   D +  F ++S      RR+           DRE +  + L +   D                                         L++T  +T+++KD ND  P+F   +E+ +I+EN+ I T V  +KA+D D G N  I Y++     E+        F+++P  G +    + DRE++S Y +  TA D      ++   + + ILDENDN P F  + +S  + EN  +  ++ +V A D D G N ++ Y   L + +  F IS +  + V   + L+ ER+ RYS+ + A D     P   +  + I I DINDN PTF++      +  +     G  + T  A D DT   N+++ Y ++     +F IN S G I L K L  E      + + A D+G  P T T 
Sbjct: 1811 VTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPD--TLGSVTFLLM-DGHDGKF-LLEPSTG-------KLILNDTLDRETKSKYELRIRVSD-GVQYTEAYATIQV--SDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYG-VVSDWANDVFS------LNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSE----VFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRN----------LDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANET-AIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGV-VRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTG 2475          

HSP 6 Score: 184.111 bits (466), Expect = 2.238e-46
Identity = 169/585 (28.89%), Postives = 288/585 (49.23%), Query Frame = 3
Query:  771 IKIDITDVNDHAPQF---NQSSYRFNTPESIVQGQAI--GQVFATDKDISSRVTIMMSPSASSQIMDKFSVA-FDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYK----------------------VKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL-EGV-LGRVEAVDKDIGQNAQMDYFLF--NPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHG-NRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPP 2402
            + I I D+ND+AP F    +S    + PE+   GQ I   +V   D  ++SR++  ++ + + Q    F +    GV+  +  +     S    + ++A D+G+P L++  ++ V + D+ND+ P+ +  S   +    L E  + N+    +  +D D G+NG++  ++   +   +F +     F +   Y  V AP    DRE +D++ L + C D G PS ++  P+ + V DENDN P F     + SI EN P  T V +L A+D+DIG NA++ + LS +  ++F ID  +G I T   FDRE   +                        ++AT  D+ I R+   + + V + D NDN P+FLR  +   I E   EG  +  V   D D G N  + Y L   N +  F + S  G +  S  R LDRE  + + + + A+D     PL+S+ ++ I++ D NDN+P F +      +++   +  GT++   +A D D G N+++V++I +   +  F+I++  GS+YL+K L  E I    + I+A D G  P  +T+ L+   +      PP
Sbjct:  928 VNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQ----FRIGPVTGVLYLQRPIRAEPGSL-IHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETS----LPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGV-----FPD--GYLFVRAP---LDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQT-QDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQL--SLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSS--SEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCG-TPSLSTTVLYNVLVVDDNDNPP 1487          

HSP 7 Score: 179.489 bits (454), Expect = 5.923e-45
Identity = 189/667 (28.34%), Postives = 305/667 (45.73%), Query Frame = 3
Query:  438 ILVADVNDNVPSF--DRLTF-NFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---------DNNYLFNLESIQNFENRRHYKLV-TAPTSSFDREVK-----DHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSP-ECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLI---LRMNSSITIHVTILDENDNPPKFLRTFS--FHIKENLEGV-LGRVEAVDKDIGQNAQMDYFL--FNPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI-------FYINTSDGSIYLNKSLQDEHILPDKIIISARD 2327
            I + D+NDN P F  DR +     + EN+    E+ L   RD D G N  + Y++  +   N+   I P T         L + +    E      + L+A D G+PPL+S L++ + I DVNDH P F+ +SY  + PE+         + ATD D+    R++  +    + ++   F V  DG +  +  L      + Y + +   D+G P+ ++   V++HV D NDN P      +N      + EN  +++++ K+T  D+D G N ++   L         D    F +++++ F+     K+   A  S  D  ++     ++  L    SD G+P L     + V+V D NDN P F R    V+I E    GT +T +   D D G+N  + Y L+       FN+D  +G ++     DRE Q  + +   A D  +   L  N+SITI   +LDENDN P+F ++ S    ++ +  G  L R  A D D G N+Q+ + +   N    F I S  G +++ +   LD E +  Y++ I A D G   L+++    +++ D NDN P F      + +   I     T I T  A D D+G N K+ Y I  Q         F INT  G I+  + +  E I   ++ + A D
Sbjct:  930 IAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNP--NQQFRIGPVTG-------VLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERM---FGVFPDGYLFVRAPLDREERDY-YALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQF----TNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGF-IKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITI--VVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKP--LDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPL--KTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATD 1572          

HSP 8 Score: 174.866 bits (442), Expect = 1.521e-43
Identity = 186/613 (30.34%), Postives = 280/613 (45.68%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDRLTFN-FKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD-GVISTKVALVYVSSSFDYRIPIIAVDSG--NPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGN-NGQVE--CKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILR-MNSSITIHVTILDENDNPPKF-LRTFSFHIKENL---EGVLGRVEAVDKDIGQNAQMDYFLFNPSP-LFEISRNGDIFVSQKRYLDRERVDR----YSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI 2216
            ++ IL+ DVND VP F  ++ N   I EN   +  V    A D D G NG + Y +K  A         P     + +  +L+++ + DRE+   + L + A+D G PP ++   + I I D ND++P F+   Y  +  E+   G  + QV ATD D  +   I  S     Q  D FS++ D GV+     L Y   S  Y + + A D    NP    T+ + +++ DINDNRP      S    R++      +  Y+  V   D D    N QV    K  ++ LF + +              A     DRE +  + L ++  D G P LT T  + V V+D NDN P+F  Q    ++ ENLP GT V   +A DKD G+NA++++ L  E +  F+ID  +G I+T  + DRE  S Y +   A D  I     SS+ + +++ D NDN PKF   T++  + E +   E V G   A+D D G+NA + Y +       F+I+    + VS K  L  +        Y+I I A D G + L+S   + +I+    +  PTF       H  +S +   G  I    A     G   KI Y I
Sbjct: 2152 KVTILIKDVNDEVPVF--ISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMK-EARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHD-FSISEDTGVVRVAKNLNYERLS-RYSLTVRAEDCALENPA-GDTAELTINILDINDNRPTF--LDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGD---------IALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFG-ARALDLDDGENAVVHYTISGRDQHYFDINTKTGV-VSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRP-PELFPTFAY-MANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAI 2743          

HSP 9 Score: 174.481 bits (441), Expect = 1.773e-43
Identity = 164/617 (26.58%), Postives = 286/617 (46.35%), Query Frame = 3
Query:  363 NYNRDSQCILILELS----GSGPKF--YQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISP-----STNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRF--------NTPESIVQGQAIGQVFATDKD--ISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECK-LDNNYL--FNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGV-PSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLE----NFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLI-LRMNSSITIHVTILDENDNPPKFL-RTFSFHIKENL-----------EGVLGRVEAVDKDIGQNAQMDYFLFNPSP-LFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIII 2063
            N +R+S+    L +S    GS P+F   Q+ + + DVNDN P FD   +N  + E +     V   +A D D G+N  + Y +  +   ++F  ++P     ST +  +   +  +  S  ++        + A+D G+P       + +++ D NDH P     S+RF           E+ V G  +  V   D D  ++ R ++ +    S   +  F +      +  + +V V+   D      Y + ++A+D G P  T T+ +++ V D+ND+ P+ E +  +     VL+E   + S++A +T +D+D G N QV    L  N L  F+++ +          +VT  T   DRE++D  +L+I   D G  P    T+ + V++ DEND  P F ++ ++V++ E+ P  T V  + A D D G N  + + L+P         F +D  +G +TTR   DRE  S+Y++   A D       +++ T+ + + D NDN P+F  R + + + ++            E +L  V A DKD G NA ++Y L +    LF++ +R+G I +             Y + + ARD G R       VEI++
Sbjct:  227 NLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYL--AETEHQFT-VNPETGVISTTERVNCPQQTNVKSSASQK---SCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPII---SFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRI---VSGNELGHFRLEE----AADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSA----VLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGL-------IVT--TGPLDREIRDTVELSISARDGGPNPKFAYTQ-LKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVL 813          

HSP 10 Score: 170.244 bits (430), Expect = 3.888e-42
Identity = 178/640 (27.81%), Postives = 275/640 (42.97%), Query Frame = 3
Query:  654 DSSLKLKILQS---FDREID-EEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN-FNIDPFSGMITTRVSFDREVQSEYKVKATAYD--------------HLIL----------------------RMNSSITIHVTILDENDNPPKFLRTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFL----------FNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQ-GTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGII-PKTTTSSLHLNFIRSGKSKP 2399
            D   KL IL +    DRE   EE+++ + A  LG  P TS   +++ + D ND  PQF  + + +N  E +  G  I  + A D D    VT ++      + + + S     +I          S ++ RI    V  G     A +T+   V+D NDN P+ E    +      + EN Q    + ++   D D G N Q+   + +++  ++     F       ++T  T+  D E   H+ L +   D G PSL+TT  +   V D NDN PIF     S  + EN+PI T+V  + A D D G N  I+Y ++   +++ F ID  +G I TR + DRE +S Y +  TA D               L L                      R++S++ + + I D ND  P F+      I EN  +  V+  V+AVD D G+N  +DY +           +P P      +G + V     LDRE    Y + I ARD G  P ++ + + I I D NDNSP F    P Q+     E    G  +    A D D G N +I Y+I        F I+   G + + K+L  E +    + + A D  +  P   T+ L +N +    ++P
Sbjct: 1766 DIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTG--KLILNDTLDRETKSKYELRI---RVSDGVQYTEAYATI--QVSDTNDNPPLFE----DTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDV-----FSLNPQTGMLTL-TARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDS-NGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDA--LDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVF---DPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRP 2382          

HSP 11 Score: 169.474 bits (428), Expect = 6.057e-42
Identity = 194/726 (26.72%), Postives = 319/726 (43.94%), Query Frame = 3
Query:  246 TIDNFQNFFRLNDNNVEMLQSLDRENLI-TNQKCDTSKQYNYNRDSQC--ILILELSGSG---PKF---YQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLG-NPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR------IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKL-----VTAPTSSFDREVKDHHQLNIICSDMGVPS---LTTTRPITVVVKDENDNPPIFYRQHESV---SILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVS--FDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGRVEAVDKDI------GQNAQMDYFLFNPSP---------LFEISRNGDIFVSQKRYLDRERV-DRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDE 2288
            TID    F       ++ L+  DRE L+  ++  + S +    R S     ++LE + S    P+     ++ ++V DVNDN P F R  ++  I+E +     +     +D D G NG V Y++     + +F L S        ++ +L + +  DRE  E   LI++AKD     PL+S+ +I I + D ND+AP+F QSS   +  E+   G  + +  A+D D      ++ S SA ++  D F       I +    +Y+    DY       + I A D G P+L+ T    V V D NDN PI    +  +     + E     + I  VT  D D G NG+V      +Y  + +  Q     RH+ +     V       DRE  D  +L ++ +D   PS   L+T + +TV+V+D NDN P+F   + ++       +    T V ++ A D D   N  + Y +     E F +   +G+IT      F +EV+ +  +K+T  D  +     S  +++TI+       +      F  +  L G +   E +   I        +A+++YF+ N +          LF+I     I +S    LDRE   + Y +E+ A   G +P TS T V + + D ND+ P F++  P  + N+S +   G  I T +A D DT  +   +        F +  S G + LN +L  E
Sbjct: 1200 TIDTRNGF-------IKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDS--------ATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNR-RDTFH------IDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQ----IKEGIPLKTPIVTVTADDPDSGLNGKV------SYAISKQEPQ-LPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKST--DEAVQSERRSSEVYITIITPGSGGSES-SVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGI-LSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLD-TPFVY-NVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRE 1886          

HSP 12 Score: 169.088 bits (427), Expect = 9.119e-42
Identity = 196/729 (26.89%), Postives = 309/729 (42.39%), Query Frame = 3
Query:  351 SKQYNYNRDSQCILILELSGSGPKFYQLPILV----ADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNP------------------------------------PLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVAF-----DGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPS-LTTTRPITVVVKDENDNPPIFYRQHESVSILENL--PIGTKVTRLKAIDKDI-GVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKENLEGVLGRV--EAVDKDIGQNAQMDYFLFNPS-PLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHG-NRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETI-QGTKIFTAKAIDNDTGENAKIVYTI--QSQTIFYINTSDG----SIYLNKSLQDEHILPDKIIISARDSG 2333
            + + +Y      ILI++   +G       I V     D+NDN P FD ++++ ++ EN P   EV    A+D D GNNG + Y+I    V ++F         G DS+  ++  ++ DRE    + L + A+D  +                                      L+S++ + I I DVND  P F  S+      E++     +  V A D D      +  +M  +    +     + F     DG +    AL     S  Y + I A D G P  +  S +L+ + D NDN P+ +    + +    + EN    + + +V+ +D D G NG++   +   D N+ F++              V     + + E    + L +   D  + +    T  +T+ + D NDN P F        ++EN   P G  V  + A D D   +N+Q++Y L     + F I+  SG I      DRE QSEY +   A D     +  +  + V + D NDN P F L+++   ++ENL      +   A DKD G NA++ + L       F I S  G+I  S    LDRE    Y + + A+D     P  SS  + I + D+NDN P F         N+++ E I +G  +F A+A+D D GENA + YTI  + Q  F INT  G     + L    +    L   I+ISA D G
Sbjct: 1982 TARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEF---------GIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVF-ISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRS-SYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSAS----VAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTG---------VVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEI--STATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKF----DSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQG 2680          

HSP 13 Score: 156.377 bits (394), Expect = 6.359e-38
Identity = 174/660 (26.36%), Postives = 299/660 (45.30%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAI---KPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPP---LTSSLTIKIDITDVNDHAPQFNQSSYRFNTPE-SIVQGQ--AIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDN----------NYLFNLESIQNFENRRHYKL-VTAPTSSFDREVK-DHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEG--VLGRVEAVDKDIGQNAQMDYFLFN--PSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQ-GTKIFTAKAIDNDTGENAKIVYTIQSQTI---FYINTSDGSIYLNKSLQDEHILPDKIIISARD 2327
            +LV D NDN P F       +I E  P    +    A DPD G NG V YAI   +P     +   I+  T   H        L+  DRE  + F+L ++A D   P    L++   + + + D+ND+AP F   +     P+ S  +G   A+ QV A D D SS   +     +  Q +  F +  +  I T            Y++ + + D    +   +S V  ++T I       E +      R  L+ +   N  I    ++   H  + ++E  + N          + LF++++          KL + +  +  DRE   + +++ +    +G    T+   + V V D+ND+PP F       ++ E+L IG  ++ L+A D D      + ++L       F ++P +G +    + DRE +S+Y+++    D  +    +  TI V+  D NDNPP F  T +SF I EN +    +G++ A D D+GQNAQ+ Y + +   + +F ++    +     R LD E V  Y + + A+D+G   L+++ TV   + D+NDN+P F    P  + +   E +   T++ T  A D D+G N  I Y+I +  +   F I+ S+G+I   ++L  EH     + ++ARD
Sbjct: 1477 VLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIH-------TLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQEL--FKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEV--YITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDA----------KLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPD--TLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDG-VQYTEAYATIQVS--DTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTAR-LDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIF---DPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGID-SNGTIRTRRNLDREHRSTYTLTVTARD 2105          

HSP 14 Score: 147.517 bits (371), Expect = 3.615e-35
Identity = 167/624 (26.76%), Postives = 263/624 (42.15%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSA------VSNKFV----------LISPSTN---QGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSG-NPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSF------DREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLS---PECLE--NFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLI---LRMNSSITIHVTILDENDNPPKFLRTFS------FHIKENLEGVLGRVEAVDKDIGQNAQMDY-FLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQ----GTKIFTAKA 2171
            I V D NDN P F   TF F I EN+PA   V    A D D G N  + + +            N F+          L+  S N    G D SL+  +  ++         L     D G P L   + +K+ +TDVND+AP+F ++ Y     E   +G  I  VF  D D      +  S +  ++   +F++ +  G +S    L   S    + I ++A D+     L++ +++ + V D NDN P    +SS     + + E   + + + +   SD D G N QV        +F++ +     NRR    + + T S       D E    + LNI  SD G PSL+TT    V+V D+NDNPPIF        I E +P+ T +  + A D D G+N ++ Y +S   P+  +  +F I+  +G+I T    DRE    +++   A D       ++++   + V + D NDN P F+   +      F   +     + +V A D D   N  + Y  +  P  LF++ RN  I         ++ V RY + + + D   +    S+ V I I            P+  Q   LS    +    GT I T  A
Sbjct: 1141 IHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNY-------MLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNE-AGQFNLDSATGQLSLGRRLDRESQEIHHLI-VVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSS----EVSVLETSPTGTELMRFRASDADQGVNSQV--------VFSISA----GNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEV-RYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTA 1738          

HSP 15 Score: 134.42 bits (337), Expect = 3.659e-31
Identity = 181/682 (26.54%), Postives = 297/682 (43.55%), Query Frame = 3
Query:  423 FYQLPILVADVNDNVPSFDRLTFNFKIAE---NSPAHNEVE--LPLARDPDRGNNGSVVYAIKPSAVSNK--------FVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVT------APTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLE-NFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTI-LDENDNPPKFLRTFSFHIKENLEGV---LGRVEAVDKDI-GQNAQMDYFLFNPS--PLFEIS-RNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAK-IVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHL 2369
             Y L +L  D N   P +     N  I +   N P   + E   PL +D  RG     V+A     +           F L S  +   HD  + L  ++      +  ++L++ A D G PP +    + I +T  N   P+F+ +SY+   PE+   G  I  V ATD D      +  S S  ++  D FSV    G I  +  L Y     +Y + I   D G   L++ + + + +TD+NDN P+     +++     + EN    +++ +   +DKD   N  +      +Y F L S  +    RH+ ++       +   SFD E +  + L I   +    S+ +   + V V   N+  P F +      + E   +GT+V  ++A DKD G + ++ Y+L     +  F ID  +G+I      DRE Q+   +   A ++  +R N +    V I + + ++PP+F++ +          V   +  V+A+DKD+  QN Q  Y + N +    F+I  + G+I  + +  LDRE    Y++ IGA D G  P T S TV I ++D+NDN PTF  P+ G +  +S     GT I T  A D D   N     Y +   + ++   ++ + G +    S   E     + II   DSG   K    S HL
Sbjct: 3089 MYALTVLATD-NGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITL--VKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQD-FSVDERTGGIVIQQQLDY-DLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVF----NHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAII------HYAF-LPSGPD----RHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPD-SSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASR--LDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFT-PE-GLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSG---KPKQKSQHL 3742          

HSP 16 Score: 115.161 bits (287), Expect = 2.813e-25
Identity = 150/573 (26.18%), Postives = 238/573 (41.54%), Query Frame = 3
Query:  165 ECVVEENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDNNVEMLQSLDRE--NLITNQKCDTS--KQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNP--PLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLV-------LTENCQSNSYIAKVTVSDKD-HGNNGQVECKLDNNYLFNLESIQNFE-NRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQ--IKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENL 1826
            + +V EN P+   I  V  T  D    T  N    + ++  N     S+D     ++  Q+ D    ++Y+ N   Q +    LS        L I++ DVNDN P F+   ++  I EN P    V    A D D   N  + YA  PS     F +++ S          +    SFD E    + L + AK   NP   + S   + + +  VN+  PQF Q  + F+  E+   G  +G V ATDKD     RV  ++  S++ +            I T   L+YV+   D       V     T+ A +   +   D ++ + II I   N     +       ++E     + +  V   DKD    N Q    + N    NL+  Q+F+ + +  ++ TA  S  DRE    + L I   D G+P  T +  + + ++D NDN P F  +  +  I EN P GT +  L A D D+  N       ++  +     ++D  SG++ +  SFDRE+    +      D    +  S   + +T+LD+NDNP     T S HI  +L
Sbjct: 3235 QVIVPENEPVGSTILTVGATDDD----TGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLS----SVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNG-------TISSAVSFDYEERRIYTLQIKAK---NPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFR---------IDTNTGLIYVARHLDRETQNRVV----LTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIING---NLK--QSFKIDVQTGEISTA--SRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPST---TRSLHIAVSL 3766          

HSP 17 Score: 100.138 bits (248), Expect = 9.458e-21
Identity = 114/430 (26.51%), Postives = 183/430 (42.56%), Query Frame = 3
Query:  312 DRENLITNQKCDT-SKQYNYNRDSQCILILELSGSGP-----KFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGN--PPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD-GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNL--ESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILE-NLPIGTKVTRLKAIDKDI 1565
            DR   I NQ   T S   +++ + + I  L++    P      +  L + V  VN+  P F +  F+F ++E S     V    A D D G +G V Y +  S+    F +    TN G      + + +  DRE      L ++AK+ G+     T    + I I D ND  P+F +  Y     E+   G  +  V A DKD+ ++         +  +   F +    G IST   L    +S  Y + I A+D+G P  T ++TV + + D+NDN P       N      ++EN  + + I  +  SD D   NG         + + L     +++ +      V   T+SFDRE+    +  I   D G P   +   +T+ V D+NDNP      H +VS+   +LP   K+  ++  D DI
Sbjct: 3379 DRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRI---DTNTG-----LIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETS-TYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNG----YISENEPAGTSIMTLIASDPDLPRNG-------GPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSLFNGDLPSNVKLADVRPNDIDI 3787          

HSP 18 Score: 81.2629 bits (199), Expect = 5.622e-15
Identity = 78/269 (29.00%), Postives = 118/269 (43.87%), Query Frame = 3
Query: 1503 ILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSS--ITIHVTILDENDNPPKFLR---TFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLF---NPSPLFEI----SRNGD---IFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI-QSQTIFYINTSDGSI 2261
            +LE  P GT V         I    +  Y  + E    F +DP +G + T V  DRE   ++      YD ++L    +  I + + +LD NDN P+F       SF         L    A D D+G+N   D +     N    F +    + +GD   + +     LDRE    Y + I ARD G+ P      V + I D+NDN P F       +++L+   + GT + T  A DND G+N+KI Y + +++  F +N   G I
Sbjct:   73 VLEGQPRGTTVGF-------IPTKPKFSYRFN-EPPREFTLDPVTGEVKTNVVLDREGMRDH------YDLVVLSSQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSD--YNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVI 325          
BLAST of Protocadherin vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 232.646 bits (592), Expect = 1.391e-61
Identity = 208/712 (29.21%), Postives = 331/712 (46.49%), Query Frame = 3
Query:  351 SKQYNYNRDSQCILILELSGSGPKFY---QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFS---VAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECK-LDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPP-IFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML----SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKEN--LEGVLGRVEAVDK--DIGQNAQMDYF-------LFNP------SPLFEISRN-GDIFVSQKRYLDRERVDRYSIEIGARD--HGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI------------QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARD 2327
            +K  ++   SQ +L ++ +   P  Y   Q+ I V DVNDN P F+       + E++     +    A D D G++G V Y++   +    F + + S   GH     L + Q  D E  +   LI+ A D G P L+++LTI +D+ DVND+ P F +  Y  N  ES      I QV A+D D    +R+T  +  +    + +  S   V+    I      +Y+ +  D      Y++ ++A D+G P   A + V+V V D NDN P  +           + EN +  S +  VT SD D G N  +    L  N  F +  +    + R            DRE+++ + L +   D G P  +   P+ + V D NDN P I   Q + VS+ E  P GT+V R++A+D+D G NA I Y +      +    F+IDP SG+I TRV  D E +S Y++   A D       +   + V +LD NDN P F   +  F ++E+  L  V+G +  +++  D+ +N+  + F         NP         F+I R+ G++ V+  R LDRE    + +EI A D    N P +S+ TV+I + D+NDN+P +  P+    L +S  T  GT I    A D DTG N  + Y +            Q+ ++F +++  G++ L   L  E +    +I+ A D
Sbjct:  887 AKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARS---GH-----LILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQ----KSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTRE---------PLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVA--RLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW--PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALD 1573          

HSP 2 Score: 229.565 bits (584), Expect = 1.295e-60
Identity = 214/757 (28.27%), Postives = 352/757 (46.50%), Query Frame = 3
Query:  249 IDNFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISS----RVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDY------RIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGN---NGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLS--PEC-LENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTF---SFHIKENLEGVLGRVEAVDKDIGQNAQMDYFL---FNPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIET---IQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIY------LNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNK 2414
            ID+   +  + +  VE   ++DR       K    ++    R S  ++ + LSG   +  ++ + V D NDN P+F + + + +  EN+P   +  L  ARD D     +  Y I    V++ F L S     G    L L+I    DRE    + L++ A D G PPL   +T+ I I DVND+ P FNQS Y    PE+   G ++ QV+A+D D          I    S   Q+           I  +   +Y++ + D+       + ++A D G   L  T+ V + VTD+NDN+P I +   + +    ++E+ Q   ++A+++V D D      N  V     + +     ++   +N  +  +V  P    DRE+  ++ L+++ +D G P L  ++ I + + D NDNPP F +     +++E    GT V ++ A D+D G+N+ + Y L+  PE   + F IDP +G+ITTR   D E +   ++   A D  +  ++S+ T+ VTI D NDN P F ++F   S    E +   + +V A D D G NA ++Y +   F     FE+ S +G+I ++ +  LD ER   Y   + A D G   L+++  +++ + D+NDN P F   +    L  S +       T I    A D D G   ++ Y I       IF I+ S G I+      L+   Q  H+L     ISA D G +     + + L+ I     +PP   K
Sbjct:  105 IDSGPPYIIVAEAGVETDLAIDRATGEIRTKVKLDRE---TRASYSLVAIPLSG---RNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGV-LYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFR---------IDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHF----ALTTRDNSIYLVIVHLP---LDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGE--LDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLN----ISATDGGNLRSNADAVVFLSII-DAMQRPPIFEK 829          

HSP 3 Score: 214.927 bits (546), Expect = 4.488e-56
Identity = 190/687 (27.66%), Postives = 310/687 (45.12%), Query Frame = 3
Query:  444 VADVNDNVPSFDRLTFNFKIAENSPAHNE-----VELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGV--ISTKVALVYVSSSFDYRIPI-----IAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML-------------SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISR-NGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI------QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            + DVNDN P F    +   + E+  A ++     +   +A DPD GN G V Y I      N+  +     + G    ++  +L    + +     L + A D GN    +   + + I D     P F ++ Y +   E I +G  +G V A   D++ R  +  S          +S   DG   I T    + ++   D+         I    G P +   + V + V D+NDN P  E +      R+ + E+ +  + +      DKD G++GQV   L       L +I    + R   L+   +   D E    H L +  +D GVPSL+T   I V V+D NDNPP+F +   SV++ E+  I  ++ ++ A D D G NA+I Y +             S +  ++F I P SG I  R   DRE +  Y++   A D+     ++   + V +LD NDN PKF ++ + F I+ENL    V+G V A D D+G+NA + Y L   +  F++    G+I  S +  LDRE  + Y + + ARD G    ++   V I + D+NDN+P   +P+    +++  E   GT++   +A+D D G+NA I Y+I          +F I+ + G I     L  E     ++ ++A D G  P+ T   L +  +    ++P
Sbjct:  705 LTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI---VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPM---HMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYS---------IYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMV----RISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAI----DARSGHLIL--SQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEI--STREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQE-DVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRP 1363          

HSP 4 Score: 203.756 bits (517), Expect = 1.701e-52
Identity = 211/747 (28.25%), Postives = 332/747 (44.44%), Query Frame = 3
Query:  351 SKQYNYNRDSQCILILELSGSG-PKF-YQLPILV--ADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGH----DSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMS--PSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSS-------FDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGV----------NAQIKYMLSP---ECLEN-FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILR--MNSSITIHVTILDENDNPPKFLRT-FSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDI----------FVSQKRYLDRERVDRYSIEIGARDHGN---RPLTSSTTVEIIIDDINDNSPTFIEP--KPGQHLNLSIE--TIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDK-----IIISARDSGIIPKTTTSSLHLNFIRSGKSKPPP 2405
            S+  +Y    +  LI+  +  G P     L ILV   DVNDN P F++  ++  ++E+   + ++    A D D GNN  + Y I  + V N    IS S    H     +S  + +    DRE  + +QL ++A D G P   +   + + + D ND+ P+F +S Y F   E++ +G  +G V A+D D+     I  S  P  SS     F V    G IST+  L        Y + + A D G P  +A   V +HV+D+NDN P  EIA   Q + + + E     + + +V   D+DHG N  +   +          ++  ++  H      PTS         D E +  ++L +  SD G P   T R + V V D NDN P F        + E+  +G  V  +  I++   V          + ++ Y L+P   + +E  F+ID  SG +      DREVQSE++++  A D        +S+IT+ + + D NDN P++ +      + E   +  ++    A D D G N  + Y L    P    S+   +           +S +  LD E V  Y + + A D  +     L +S TV + I D ND++P F+ P    G+  +L I   T  G  +    A+D D+G+N ++ Y I     +  F IN+  G I L KSL       +K     +II A+D G  P+   SSL+L+ I  G    PP
Sbjct:  991 SQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS-----FQVHPVTGEISTREPLDRELREL-YDLVVEARDQGTPVRSARVPVRIHVSDVNDNAP--EIADP-QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSI----------VKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQ-PEPKKSSLNLHLIVQGSHNNPP 1717          

HSP 5 Score: 180.259 bits (456), Expect = 2.971e-45
Identity = 183/669 (27.35%), Postives = 294/669 (43.95%), Query Frame = 3
Query:  384 CILILELSGSGP---KFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAI-KPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDG-----VISTK---VALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSP--ECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKENLEGV-------LGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISRN-GDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNKSLQDE 2288
             +LI  L G  P    F  + I + DVNDN P F++  +   + EN+     V    A D D   NG V YAI +  +   +   I P T         + I ++ D E  E  +L+++AKD G  PL ++  + I +TDVND+ P  N      +    I +    G+  A       R+++   P + ++  +  +V  +G      ++T+   + LV V    D      Y + ++A D G P L A+ ++ + +TD+NDN P  E    + N    + E     + + +V   D+D G N  +   L      +    Q F+      L+T   S  D E +   QL ++  D GVP L++T  + V + D NDN PIF +   +VS+ EN P+G  + ++ A D D GVNA + Y +    + L  F +   SG I      D E +S Y+    A D   L   + I + +T  D NDN P F  R +   ++E+ +         +  V A D D G   Q+ Y +   N + +F I R+ G+IFV +   L       + + I A D GN    +   V + I D     P F + +   ++   I   +GT + +  A   D    + + Y+I S      F I T+ G+I + K L  E
Sbjct:  253 SLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTG-------AIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVA-------RISVH-DPDSKTEYAN-VNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHAN----VMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETH---AQWFQIDPQTGLITT-RSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLT--DVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIP--RGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHE 893          

HSP 6 Score: 173.711 bits (439), Expect = 2.641e-43
Identity = 186/704 (26.42%), Postives = 308/704 (43.75%), Query Frame = 3
Query:  372 RDSQCILILELSGSGPKFY---QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHA-----PQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMS--PSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLV--LTENCQSNSYIAKVTVSDK--DHGNNGQVECKLDNNYLFNLESIQN------FENRRHYK-LVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVV--VKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML----------SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDH---LILRMNSSITIHVTILDENDNPPKFL-------RTFSFHIKE--NLEGVLGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISRNGDIFVSQKRY----LDRERVDRYSIEIGARDHGN-RPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETI-QGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSI----YLNKSLQDEHILP 2300
            RD   + +L      P  +   ++ + V D NDN P F +  + F+I EN    + V +  A D D G N ++ Y++ P  +++ F        Q H  + ++   +  DRE+ E + L++ A+D G P  ++ + ++I ++DVND+A     PQ +  S R   P     G  + +V A D+D     +I  S      S     FS+    GVI T+V L +   S  YR+ + A D GNP       + V V D+NDNRP    +S      LV  + E+      +  ++  ++  D   N   E   D    + L  +        F+  RH   LV A     DREV+   +L I   D    +   +  ITV   V D NDN P + +    + + E  P+GT +    A D D G N  ++Y L            + +  F +D  +G ++ +   D E   EY +   A D    +  R+ +S+T+ + ILD ND+ P F+       +T S  I +   +  V+  + AVD+D G N Q+ Y +   N    F I+    I    K       D E+  R+++ IGA+DHG   P  SS  + +I+   ++N P F++     +    +E +  G+ +    A      ENA + Y I +     +F+++   G I      ++  Q  ++LP
Sbjct: 1116 RDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP--INSSF--------QVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPP----GTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSI-YRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSS------LVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVA--RLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQ---AVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLP 1793          

HSP 7 Score: 166.007 bits (419), Expect = 7.233e-41
Identity = 190/782 (24.30%), Postives = 345/782 (44.12%), Query Frame = 3
Query:  174 VEENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDN-NVEMLQSLDRENLITNQKCDTS------KQYNYNRDSQCILILELSGSG-PKFYQ----LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSS-LTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSA-SSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDH-----------GNNGQV--------ECKLDNNYL-----FNLESIQNFENRR--HY-------------------KLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN-FNIDP-FSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKE--NLEGVLGRVEAVDKD--------IGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL--SIETIQGT-----KIFTAKAIDNDT-GENAKIVYTIQ-SQTIFYINTSDGSIYLNKS 2276
            V +NSP F        + P+   P + +      L++  N +++ S+   NL      D+S      +  +  + S+  L ++ S  G PK  Q    + I V D NDN P F    +   + E++P    V    A D D G N  +VY++  +    +F +           S  +  +   DRE+   +  +++A D G   + S+ + ++I++ D+ND+ P F +  Y    P  I  GQ + +V A D D+ +   I+ S +A +S +  KF +    G +S   +L   S      + ++A D GNP  ++   + + + +     P++     N+  R++L EN  S + + +V     D            GN   +        E +++  +L     F+  S+      R  HY                   + +T+ + +      +  ++ ++      P L +   + + ++DENDN P F ++    ++ E    GT V ++ A D D G NA+++Y +     +N F I+P FSG++ T +  DRE++  YK+K  A D  + +M  + TI V I+D NDN P F       + E   L  V+  + A D D        +G  + +D  + N S +F + R     V  KR LD E    Y +++ A D  +    + T + + ++D NDN+P F+  +P  +  +  +I  I  +      + T  A D D+ G N+K++Y I+ +Q  F ++ S+G + +N S
Sbjct: 1840 VNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA-NETQWQFAI--------DGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKL-LHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRF--QNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVD--IENMS-IFALDRYSGKLV-LKRRLDYELQQEYELDVIASDAAHE---ARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMS 2602          

HSP 8 Score: 163.696 bits (413), Expect = 3.296e-40
Identity = 180/662 (27.19%), Postives = 288/662 (43.50%), Query Frame = 3
Query:  444 VADVNDNVPSF------DRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNP-PLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIM-DKFSVAFD-GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATS-----------------------TVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVP-SLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSS-ITIHVTILDENDNPPKFLR-TFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDY------------FLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNK 2273
            + D ND+ P F         T +  I++ +     V   +A D D G+NG + Y I       +F +   ++  G    +K     + D E    F LI+ AKD G P P  SSL + + +   +++ P+F Q+ YR    E++  G  + QV  T K +       +S    + +  D F V +  G+I+T+      S +  Y +P+   D+   +  ++S                       T+ + V D+NDN P     S      L + EN +    I  V  SD D G N  +   +    L N  SI +       +L   P    DRE    + L I  SD G P S      IT+ V+D+NDN P F     + S+ E+ P+GT V ++ A+D D+GVNA++ Y L+ E    F ID  SG+ITT    DRE+Q+ Y     A D     + S+ + + + +LD NDN P F R  +   +   ++    L +V+A+D D+G NA++ Y            F  NPS        G +  SQ   L  E      +E+ ARD GN P +S   +E++I +    +P          + L   +  GT++    A+ +D G   K+ ++  +     I  +++  G I +NK
Sbjct: 1592 ILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRI---NSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQV--TAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQA-SYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYG---LSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSG----ELSARP---LDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPS-------TGALSASQS--LASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILSLDSLSGEIRVNK 2226          

HSP 9 Score: 132.88 bits (333), Expect = 1.029e-30
Identity = 174/687 (25.33%), Postives = 284/687 (41.34%), Query Frame = 3
Query:  438 ILVADVNDNVPSF-DRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDK--DISS----------RVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVD---SGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNY-LFNLESIQNFENRRHYKLVTAPT--SSFDREVKDHHQLNIICSDMG---VPSLTTTRPITVVVKDENDNPPIFYR------QHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN-FNIDPFSGMITTRVSF-----DREVQSEYKVKATAYDHLILR-MNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEGVLGRVEAVDKDI--GQNAQMDYFLFNPSP----LFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSST-----------------------TVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI---FYINTSDGSIYLNKSLQDEH 2291
            I V+DVNDN P   D       + E  P   EV    A D D G N S+ Y+I     S+   L S     G    ++ +++   D E    ++L + A D GNPP  +   +++++ D+ND+ P F  SS  F   E    G  +G +   ++  D+            RVT  ++P     I   F +           L+      ++R+ I A+D   S NP  +A  TV + V D+NDN P            L ++E     + I   T +D D G NG ++ +L   +   N    Q     R   L  A +  +  D E    + L +   D        L T+  + + + D ND+ P F        +  S+ I +   IG  V  + A+D+D G N Q+ Y ++    E  F I+  +G+I    S      D E    + +   A DH       SS+ +H+ +   ++NPP+FL+  +   I EN+      ++   K +   +NA + Y +  P+     LF +     I  ++ ++ DRE    Y + +  RD   +   SS+                       T+ I + D+NDNSP F   +PG    LS+ E  +   I T  A D D G NA ++Y+I    +   F I++S G +      +++H
Sbjct: 1244 IHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSG---VIRTRVV--LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAI-TVKIEVADVNDNAP----EWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI--PAGVANDLFHVDWQRGIITTRGQF-DRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF---RPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQH 1914          

HSP 10 Score: 113.62 bits (283), Expect = 6.964e-25
Identity = 153/585 (26.15%), Postives = 264/585 (45.13%), Query Frame = 3
Query:  660 SLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQF--NQSSYRF-------NTPESIVQGQAIGQVFATDKDI---SSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALV--YVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPT----SSFDREVKDHHQLNIICSDMGVP------SLTTTRPITVVVKDENDNPPIFYRQHE-SVSILENLPIGTKVTRLKAIDKDI--GVNAQIKYMLSPECLEN-FNIDPFSGM--ITTRVSFDREVQSEYKVKATAYD-HLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGV---LGRVEAVDKDIGQNAQMDYFLFNPSP-------LFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS-QTIFYINTSDGSIYLNKSLQ 2282
            S KL + +  D E+ +E++L +IA D  +   T  LT++++  D ND+AP F   Q    F          ES+     +  V ATD D    +S+V  ++ P+      + FSV   +GV+S  ++ +   VSSS DY + IIA D+G P L +++ + V   D    R                      N Y A+++    +    G V  +L  + L    +I        ++L+ +         DRE  D ++L ++ S    P      + ++   + + + D NDN PIF R  +    I E  P+   + +L+AID D     N+++ Y ++    E+ F ID  +G+  +  R+ +D   +S Y++   A D H    + S     + + DENDN PKF  T   H     E V   + R  A D D G   Q++Y +  P+P       +F + S +G   V+     D E+  RY +E+ A D G +   +S  V + I+  ++ +P F E      L  ++   QG  +    A D+D+G + ++VY + +  + F +N S G++ + + L+
Sbjct: 2484 SGKLVLKRRLDYELQQEYELDVIASDAAHEARTV-LTVRVN--DENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA-----QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGR-----------------SQFLQNQYRAQIS----EAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKS-YELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSI-GPAPSDESSWKMFRVDSESG--LVTSAFVFDYEQRQRYDMELLASDMGGK--KASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLK 3033          

HSP 11 Score: 109.383 bits (272), Expect = 1.538e-23
Identity = 154/639 (24.10%), Postives = 258/639 (40.38%), Query Frame = 3
Query:  306 SLDR--ENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAH-------NEVELPLARDPD-----------RGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNP------TLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLD-----NNYLFNLESIQNF---ENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSP-----ECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKENL---EG-VLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISR-NGDIFVSQKRYLDRERVDRY-------SIEIGARDHGNRPLTSSTTVEIIID 2066
            +LDR    L+  ++ D   Q  Y  D     ++    +      L + V D NDN P F        +A+  PA+       +E+   L+ D D            GNN  V+Y I+P+    +   + PS       S+ +  LQ       + F + +IAKD G P L SS  +++   D      QF Q+ YR    E+   G  + Q+     D S  +      SA   +  K  V    +   +  L        Y++ ++      P        ++  +V++ + D NDN PI + ++  +     ++E       IA++   D D  N    E   D     + ++F ++ +       NR  Y           R    HHQ   +CS          +P  + + DENDN P F        + EN P+G+ V R  A D D G   Q+ Y + P        + F +D  SG++T+   FD E +  Y ++  A D  +    +S+ + V I   ++  P+F  RT+ F +   +   +G V+G+V A D D G + ++ Y L  P   F+++R +G + + +K  LD +            S+ I A    +  L+S   VEI +D
Sbjct: 2479 ALDRYSGKLVLKRRLDYELQQEYELD-----VIASDAAHEARTVLTVRVNDENDNAPVF--------LAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA---QEGFSVHPSNGV---VSVNMSRLQPAVSSSGDYF-VRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRERNDL--------YKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAE---ISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQ-RPLCS---------LQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD--MGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVVEIALD 3074          

HSP 12 Score: 104.375 bits (259), Expect = 5.262e-22
Identity = 170/649 (26.19%), Postives = 280/649 (43.14%), Query Frame = 3
Query:  423 FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVL------TENCQSNSYIAKVTVSDKD-HGNNGQVECKLD-NNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLK--AIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVK-ATAYDH-----LILRMNSSITIHVTILDENDNPPKFLRTFSFHIK----ENLEGVLGRVEAVDKDIGQ--NAQMDYFLF--NPSPLFEISR-NGDIFVSQKRYLDRERVDRYSIEIGARD-HGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI-------QSQTIFYINTSDGSI 2261
            + +L I + D NDN P F +  F   ++E +     V    A D D G+N  + Y I      N FV I P+ +      ++  I+   DREI + ++L +IA D G P +T + TI++ I DVND+ P F  ++      E+   G  I  + A D D    +T  +   ++  I +    A D   G +  K  L Y     +Y + +IA D+ +    A + + V V D NDN P+  +A        +L      +E+   +  +  V  +D D  GNN +V   ++     F++       +    +L  A +SS D  V+      II  D G P+L ++  + V   D       F +      I E  P+G+ V +L   A+D+ + + A  +   + E L+       S  I      DRE    YK++   ++ H       L  +S I++ +TILD NDN P F R+  +  +      L   + +++A+D D     N+++ Y +   N   +F I    G +FV+ +   D      Y + I A D H  RPL S     + + D NDN P F  P       L+     G+ +F A A D D G   ++ Y+I        S  +F +++  G +
Sbjct: 2305 YAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFV-IEPAFS----GIVRTNIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQ-EYELDVIASDAAH---EARTVLTVRVNDENDNAPVF-LAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVR------IIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEES-AFELLQ-------SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYD-SGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKF--PLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLV 2923          
BLAST of Protocadherin vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 232.646 bits (592), Expect = 1.391e-61
Identity = 208/712 (29.21%), Postives = 331/712 (46.49%), Query Frame = 3
Query:  351 SKQYNYNRDSQCILILELSGSGPKFY---QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFS---VAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECK-LDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPP-IFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML----SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKEN--LEGVLGRVEAVDK--DIGQNAQMDYF-------LFNP------SPLFEISRN-GDIFVSQKRYLDRERVDRYSIEIGARD--HGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI------------QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARD 2327
            +K  ++   SQ +L ++ +   P  Y   Q+ I V DVNDN P F+       + E++     +    A D D G++G V Y++   +    F + + S   GH     L + Q  D E  +   LI+ A D G P L+++LTI +D+ DVND+ P F +  Y  N  ES      I QV A+D D    +R+T  +  +    + +  S   V+    I      +Y+ +  D      Y++ ++A D+G P   A + V+V V D NDN P  +           + EN +  S +  VT SD D G N  +    L  N  F +  +    + R            DRE+++ + L +   D G P  +   P+ + V D NDN P I   Q + VS+ E  P GT+V R++A+D+D G NA I Y +      +    F+IDP SG+I TRV  D E +S Y++   A D       +   + V +LD NDN P F   +  F ++E+  L  V+G +  +++  D+ +N+  + F         NP         F+I R+ G++ V+  R LDRE    + +EI A D    N P +S+ TV+I + D+NDN+P +  P+    L +S  T  GT I    A D DTG N  + Y +            Q+ ++F +++  G++ L   L  E +    +I+ A D
Sbjct:  887 AKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARS---GH-----LILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQ----KSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTRE---------PLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVA--RLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW--PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALD 1573          

HSP 2 Score: 229.565 bits (584), Expect = 1.295e-60
Identity = 214/757 (28.27%), Postives = 352/757 (46.50%), Query Frame = 3
Query:  249 IDNFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISS----RVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDY------RIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGN---NGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLS--PEC-LENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTF---SFHIKENLEGVLGRVEAVDKDIGQNAQMDYFL---FNPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIET---IQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIY------LNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNK 2414
            ID+   +  + +  VE   ++DR       K    ++    R S  ++ + LSG   +  ++ + V D NDN P+F + + + +  EN+P   +  L  ARD D     +  Y I    V++ F L S     G    L L+I    DRE    + L++ A D G PPL   +T+ I I DVND+ P FNQS Y    PE+   G ++ QV+A+D D          I    S   Q+           I  +   +Y++ + D+       + ++A D G   L  T+ V + VTD+NDN+P I +   + +    ++E+ Q   ++A+++V D D      N  V     + +     ++   +N  +  +V  P    DRE+  ++ L+++ +D G P L  ++ I + + D NDNPP F +     +++E    GT V ++ A D+D G+N+ + Y L+  PE   + F IDP +G+ITTR   D E +   ++   A D  +  ++S+ T+ VTI D NDN P F ++F   S    E +   + +V A D D G NA ++Y +   F     FE+ S +G+I ++ +  LD ER   Y   + A D G   L+++  +++ + D+NDN P F   +    L  S +       T I    A D D G   ++ Y I       IF I+ S G I+      L+   Q  H+L     ISA D G +     + + L+ I     +PP   K
Sbjct:  105 IDSGPPYIIVAEAGVETDLAIDRATGEIRTKVKLDRE---TRASYSLVAIPLSG---RNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGV-LYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFR---------IDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHF----ALTTRDNSIYLVIVHLP---LDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGE--LDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLN----ISATDGGNLRSNADAVVFLSII-DAMQRPPIFEK 829          

HSP 3 Score: 214.927 bits (546), Expect = 4.488e-56
Identity = 190/687 (27.66%), Postives = 310/687 (45.12%), Query Frame = 3
Query:  444 VADVNDNVPSFDRLTFNFKIAENSPAHNE-----VELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGV--ISTKVALVYVSSSFDYRIPI-----IAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML-------------SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISR-NGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI------QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            + DVNDN P F    +   + E+  A ++     +   +A DPD GN G V Y I      N+  +     + G    ++  +L    + +     L + A D GN    +   + + I D     P F ++ Y +   E I +G  +G V A   D++ R  +  S          +S   DG   I T    + ++   D+         I    G P +   + V + V D+NDN P  E +      R+ + E+ +  + +      DKD G++GQV   L       L +I    + R   L+   +   D E    H L +  +D GVPSL+T   I V V+D NDNPP+F +   SV++ E+  I  ++ ++ A D D G NA+I Y +             S +  ++F I P SG I  R   DRE +  Y++   A D+     ++   + V +LD NDN PKF ++ + F I+ENL    V+G V A D D+G+NA + Y L   +  F++    G+I  S +  LDRE  + Y + + ARD G    ++   V I + D+NDN+P   +P+    +++  E   GT++   +A+D D G+NA I Y+I          +F I+ + G I     L  E     ++ ++A D G  P+ T   L +  +    ++P
Sbjct:  705 LTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI---VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPM---HMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYS---------IYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMV----RISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAI----DARSGHLIL--SQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEI--STREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQE-DVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRP 1363          

HSP 4 Score: 203.756 bits (517), Expect = 1.701e-52
Identity = 211/747 (28.25%), Postives = 332/747 (44.44%), Query Frame = 3
Query:  351 SKQYNYNRDSQCILILELSGSG-PKF-YQLPILV--ADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGH----DSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMS--PSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSS-------FDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGV----------NAQIKYMLSP---ECLEN-FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILR--MNSSITIHVTILDENDNPPKFLRT-FSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDI----------FVSQKRYLDRERVDRYSIEIGARDHGN---RPLTSSTTVEIIIDDINDNSPTFIEP--KPGQHLNLSIE--TIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDK-----IIISARDSGIIPKTTTSSLHLNFIRSGKSKPPP 2405
            S+  +Y    +  LI+  +  G P     L ILV   DVNDN P F++  ++  ++E+   + ++    A D D GNN  + Y I  + V N    IS S    H     +S  + +    DRE  + +QL ++A D G P   +   + + + D ND+ P+F +S Y F   E++ +G  +G V A+D D+     I  S  P  SS     F V    G IST+  L        Y + + A D G P  +A   V +HV+D+NDN P  EIA   Q + + + E     + + +V   D+DHG N  +   +          ++  ++  H      PTS         D E +  ++L +  SD G P   T R + V V D NDN P F        + E+  +G  V  +  I++   V          + ++ Y L+P   + +E  F+ID  SG +      DREVQSE++++  A D        +S+IT+ + + D NDN P++ +      + E   +  ++    A D D G N  + Y L    P    S+   +           +S +  LD E V  Y + + A D  +     L +S TV + I D ND++P F+ P    G+  +L I   T  G  +    A+D D+G+N ++ Y I     +  F IN+  G I L KSL       +K     +II A+D G  P+   SSL+L+ I  G    PP
Sbjct:  991 SQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS-----FQVHPVTGEISTREPLDRELREL-YDLVVEARDQGTPVRSARVPVRIHVSDVNDNAP--EIADP-QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSI----------VKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQ-PEPKKSSLNLHLIVQGSHNNPP 1717          

HSP 5 Score: 180.259 bits (456), Expect = 2.971e-45
Identity = 183/669 (27.35%), Postives = 294/669 (43.95%), Query Frame = 3
Query:  384 CILILELSGSGP---KFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAI-KPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDG-----VISTK---VALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSP--ECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKENLEGV-------LGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISRN-GDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNKSLQDE 2288
             +LI  L G  P    F  + I + DVNDN P F++  +   + EN+     V    A D D   NG V YAI +  +   +   I P T         + I ++ D E  E  +L+++AKD G  PL ++  + I +TDVND+ P  N      +    I +    G+  A       R+++   P + ++  +  +V  +G      ++T+   + LV V    D      Y + ++A D G P L A+ ++ + +TD+NDN P  E    + N    + E     + + +V   D+D G N  +   L      +    Q F+      L+T   S  D E +   QL ++  D GVP L++T  + V + D NDN PIF +   +VS+ EN P+G  + ++ A D D GVNA + Y +    + L  F +   SG I      D E +S Y+    A D   L   + I + +T  D NDN P F  R +   ++E+ +         +  V A D D G   Q+ Y +   N + +F I R+ G+IFV +   L       + + I A D GN    +   V + I D     P F + +   ++   I   +GT + +  A   D    + + Y+I S      F I T+ G+I + K L  E
Sbjct:  253 SLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTG-------AIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVA-------RISVH-DPDSKTEYAN-VNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHAN----VMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETH---AQWFQIDPQTGLITT-RSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLT--DVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIP--RGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHE 893          

HSP 6 Score: 173.711 bits (439), Expect = 2.641e-43
Identity = 186/704 (26.42%), Postives = 308/704 (43.75%), Query Frame = 3
Query:  372 RDSQCILILELSGSGPKFY---QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHA-----PQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMS--PSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLV--LTENCQSNSYIAKVTVSDK--DHGNNGQVECKLDNNYLFNLESIQN------FENRRHYK-LVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVV--VKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML----------SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDH---LILRMNSSITIHVTILDENDNPPKFL-------RTFSFHIKE--NLEGVLGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISRNGDIFVSQKRY----LDRERVDRYSIEIGARDHGN-RPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETI-QGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSI----YLNKSLQDEHILP 2300
            RD   + +L      P  +   ++ + V D NDN P F +  + F+I EN    + V +  A D D G N ++ Y++ P  +++ F        Q H  + ++   +  DRE+ E + L++ A+D G P  ++ + ++I ++DVND+A     PQ +  S R   P     G  + +V A D+D     +I  S      S     FS+    GVI T+V L +   S  YR+ + A D GNP       + V V D+NDNRP    +S      LV  + E+      +  ++  ++  D   N   E   D    + L  +        F+  RH   LV A     DREV+   +L I   D    +   +  ITV   V D NDN P + +    + + E  P+GT +    A D D G N  ++Y L            + +  F +D  +G ++ +   D E   EY +   A D    +  R+ +S+T+ + ILD ND+ P F+       +T S  I +   +  V+  + AVD+D G N Q+ Y +   N    F I+    I    K       D E+  R+++ IGA+DHG   P  SS  + +I+   ++N P F++     +    +E +  G+ +    A      ENA + Y I +     +F+++   G I      ++  Q  ++LP
Sbjct: 1116 RDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP--INSSF--------QVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPP----GTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSI-YRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSS------LVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVA--RLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQ---AVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLP 1793          

HSP 7 Score: 166.007 bits (419), Expect = 7.233e-41
Identity = 190/782 (24.30%), Postives = 345/782 (44.12%), Query Frame = 3
Query:  174 VEENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDN-NVEMLQSLDRENLITNQKCDTS------KQYNYNRDSQCILILELSGSG-PKFYQ----LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSS-LTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSA-SSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDH-----------GNNGQV--------ECKLDNNYL-----FNLESIQNFENRR--HY-------------------KLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN-FNIDP-FSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKE--NLEGVLGRVEAVDKD--------IGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL--SIETIQGT-----KIFTAKAIDNDT-GENAKIVYTIQ-SQTIFYINTSDGSIYLNKS 2276
            V +NSP F        + P+   P + +      L++  N +++ S+   NL      D+S      +  +  + S+  L ++ S  G PK  Q    + I V D NDN P F    +   + E++P    V    A D D G N  +VY++  +    +F +           S  +  +   DRE+   +  +++A D G   + S+ + ++I++ D+ND+ P F +  Y    P  I  GQ + +V A D D+ +   I+ S +A +S +  KF +    G +S   +L   S      + ++A D GNP  ++   + + + +     P++     N+  R++L EN  S + + +V     D            GN   +        E +++  +L     F+  S+      R  HY                   + +T+ + +      +  ++ ++      P L +   + + ++DENDN P F ++    ++ E    GT V ++ A D D G NA+++Y +     +N F I+P FSG++ T +  DRE++  YK+K  A D  + +M  + TI V I+D NDN P F       + E   L  V+  + A D D        +G  + +D  + N S +F + R     V  KR LD E    Y +++ A D  +    + T + + ++D NDN+P F+  +P  +  +  +I  I  +      + T  A D D+ G N+K++Y I+ +Q  F ++ S+G + +N S
Sbjct: 1840 VNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA-NETQWQFAI--------DGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKL-LHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRF--QNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVD--IENMS-IFALDRYSGKLV-LKRRLDYELQQEYELDVIASDAAHE---ARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMS 2602          

HSP 8 Score: 163.696 bits (413), Expect = 3.296e-40
Identity = 180/662 (27.19%), Postives = 288/662 (43.50%), Query Frame = 3
Query:  444 VADVNDNVPSF------DRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNP-PLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIM-DKFSVAFD-GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATS-----------------------TVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVP-SLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSS-ITIHVTILDENDNPPKFLR-TFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDY------------FLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNK 2273
            + D ND+ P F         T +  I++ +     V   +A D D G+NG + Y I       +F +   ++  G    +K     + D E    F LI+ AKD G P P  SSL + + +   +++ P+F Q+ YR    E++  G  + QV  T K +       +S    + +  D F V +  G+I+T+      S +  Y +P+   D+   +  ++S                       T+ + V D+NDN P     S      L + EN +    I  V  SD D G N  +   +    L N  SI +       +L   P    DRE    + L I  SD G P S      IT+ V+D+NDN P F     + S+ E+ P+GT V ++ A+D D+GVNA++ Y L+ E    F ID  SG+ITT    DRE+Q+ Y     A D     + S+ + + + +LD NDN P F R  +   +   ++    L +V+A+D D+G NA++ Y            F  NPS        G +  SQ   L  E      +E+ ARD GN P +S   +E++I +    +P          + L   +  GT++    A+ +D G   K+ ++  +     I  +++  G I +NK
Sbjct: 1592 ILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRI---NSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQV--TAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQA-SYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYG---LSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSG----ELSARP---LDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPS-------TGALSASQS--LASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILSLDSLSGEIRVNK 2226          

HSP 9 Score: 132.88 bits (333), Expect = 1.029e-30
Identity = 174/687 (25.33%), Postives = 284/687 (41.34%), Query Frame = 3
Query:  438 ILVADVNDNVPSF-DRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDK--DISS----------RVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVD---SGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNY-LFNLESIQNFENRRHYKLVTAPT--SSFDREVKDHHQLNIICSDMG---VPSLTTTRPITVVVKDENDNPPIFYR------QHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN-FNIDPFSGMITTRVSF-----DREVQSEYKVKATAYDHLILR-MNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEGVLGRVEAVDKDI--GQNAQMDYFLFNPSP----LFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSST-----------------------TVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI---FYINTSDGSIYLNKSLQDEH 2291
            I V+DVNDN P   D       + E  P   EV    A D D G N S+ Y+I     S+   L S     G    ++ +++   D E    ++L + A D GNPP  +   +++++ D+ND+ P F  SS  F   E    G  +G +   ++  D+            RVT  ++P     I   F +           L+      ++R+ I A+D   S NP  +A  TV + V D+NDN P            L ++E     + I   T +D D G NG ++ +L   +   N    Q     R   L  A +  +  D E    + L +   D        L T+  + + + D ND+ P F        +  S+ I +   IG  V  + A+D+D G N Q+ Y ++    E  F I+  +G+I    S      D E    + +   A DH       SS+ +H+ +   ++NPP+FL+  +   I EN+      ++   K +   +NA + Y +  P+     LF +     I  ++ ++ DRE    Y + +  RD   +   SS+                       T+ I + D+NDNSP F   +PG    LS+ E  +   I T  A D D G NA ++Y+I    +   F I++S G +      +++H
Sbjct: 1244 IHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSG---VIRTRVV--LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAI-TVKIEVADVNDNAP----EWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI--PAGVANDLFHVDWQRGIITTRGQF-DRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF---RPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQH 1914          

HSP 10 Score: 113.62 bits (283), Expect = 6.964e-25
Identity = 153/585 (26.15%), Postives = 264/585 (45.13%), Query Frame = 3
Query:  660 SLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQF--NQSSYRF-------NTPESIVQGQAIGQVFATDKDI---SSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALV--YVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPT----SSFDREVKDHHQLNIICSDMGVP------SLTTTRPITVVVKDENDNPPIFYRQHE-SVSILENLPIGTKVTRLKAIDKDI--GVNAQIKYMLSPECLEN-FNIDPFSGM--ITTRVSFDREVQSEYKVKATAYD-HLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGV---LGRVEAVDKDIGQNAQMDYFLFNPSP-------LFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS-QTIFYINTSDGSIYLNKSLQ 2282
            S KL + +  D E+ +E++L +IA D  +   T  LT++++  D ND+AP F   Q    F          ES+     +  V ATD D    +S+V  ++ P+      + FSV   +GV+S  ++ +   VSSS DY + IIA D+G P L +++ + V   D    R                      N Y A+++    +    G V  +L  + L    +I        ++L+ +         DRE  D ++L ++ S    P      + ++   + + + D NDN PIF R  +    I E  P+   + +L+AID D     N+++ Y ++    E+ F ID  +G+  +  R+ +D   +S Y++   A D H    + S     + + DENDN PKF  T   H     E V   + R  A D D G   Q++Y +  P+P       +F + S +G   V+     D E+  RY +E+ A D G +   +S  V + I+  ++ +P F E      L  ++   QG  +    A D+D+G + ++VY + +  + F +N S G++ + + L+
Sbjct: 2484 SGKLVLKRRLDYELQQEYELDVIASDAAHEARTV-LTVRVN--DENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA-----QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGR-----------------SQFLQNQYRAQIS----EAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKS-YELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSI-GPAPSDESSWKMFRVDSESG--LVTSAFVFDYEQRQRYDMELLASDMGGK--KASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLK 3033          

HSP 11 Score: 109.383 bits (272), Expect = 1.538e-23
Identity = 154/639 (24.10%), Postives = 258/639 (40.38%), Query Frame = 3
Query:  306 SLDR--ENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAH-------NEVELPLARDPD-----------RGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNP------TLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLD-----NNYLFNLESIQNF---ENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSP-----ECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKENL---EG-VLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISR-NGDIFVSQKRYLDRERVDRY-------SIEIGARDHGNRPLTSSTTVEIIID 2066
            +LDR    L+  ++ D   Q  Y  D     ++    +      L + V D NDN P F        +A+  PA+       +E+   L+ D D            GNN  V+Y I+P+    +   + PS       S+ +  LQ       + F + +IAKD G P L SS  +++   D      QF Q+ YR    E+   G  + Q+     D S  +      SA   +  K  V    +   +  L        Y++ ++      P        ++  +V++ + D NDN PI + ++  +     ++E       IA++   D D  N    E   D     + ++F ++ +       NR  Y           R    HHQ   +CS          +P  + + DENDN P F        + EN P+G+ V R  A D D G   Q+ Y + P        + F +D  SG++T+   FD E +  Y ++  A D  +    +S+ + V I   ++  P+F  RT+ F +   +   +G V+G+V A D D G + ++ Y L  P   F+++R +G + + +K  LD +            S+ I A    +  L+S   VEI +D
Sbjct: 2479 ALDRYSGKLVLKRRLDYELQQEYELD-----VIASDAAHEARTVLTVRVNDENDNAPVF--------LAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA---QEGFSVHPSNGV---VSVNMSRLQPAVSSSGDYF-VRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRERNDL--------YKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAE---ISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQ-RPLCS---------LQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD--MGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVVEIALD 3074          

HSP 12 Score: 104.375 bits (259), Expect = 5.262e-22
Identity = 170/649 (26.19%), Postives = 280/649 (43.14%), Query Frame = 3
Query:  423 FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVL------TENCQSNSYIAKVTVSDKD-HGNNGQVECKLD-NNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLK--AIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVK-ATAYDH-----LILRMNSSITIHVTILDENDNPPKFLRTFSFHIK----ENLEGVLGRVEAVDKDIGQ--NAQMDYFLF--NPSPLFEISR-NGDIFVSQKRYLDRERVDRYSIEIGARD-HGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI-------QSQTIFYINTSDGSI 2261
            + +L I + D NDN P F +  F   ++E +     V    A D D G+N  + Y I      N FV I P+ +      ++  I+   DREI + ++L +IA D G P +T + TI++ I DVND+ P F  ++      E+   G  I  + A D D    +T  +   ++  I +    A D   G +  K  L Y     +Y + +IA D+ +    A + + V V D NDN P+  +A        +L      +E+   +  +  V  +D D  GNN +V   ++     F++       +    +L  A +SS D  V+      II  D G P+L ++  + V   D       F +      I E  P+G+ V +L   A+D+ + + A  +   + E L+       S  I      DRE    YK++   ++ H       L  +S I++ +TILD NDN P F R+  +  +      L   + +++A+D D     N+++ Y +   N   +F I    G +FV+ +   D      Y + I A D H  RPL S     + + D NDN P F  P       L+     G+ +F A A D D G   ++ Y+I        S  +F +++  G +
Sbjct: 2305 YAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFV-IEPAFS----GIVRTNIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQ-EYELDVIASDAAH---EARTVLTVRVNDENDNAPVF-LAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVR------IIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEES-AFELLQ-------SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYD-SGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKF--PLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLV 2923          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 209.149 bits (531), Expect = 2.983e-54
Identity = 172/575 (29.91%), Postives = 273/575 (47.48%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVL-ISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR------IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFE-NRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN--FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLF---NPSPLFEISRNGDIFVSQKRYLDRERVD----RYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTF 2093
            QL + V D NDN P F    F   + EN P    +    A D D G N  + Y+I  S   + F L + P T         ++ ++  DRE    F   ++AKD G PP ++S ++ I + DVND+ P FN   Y  N  E    G  +  V ATD D  SR+   ++   +     +F++           L+ ++ S DY+      + + A DSG  + TAT  V +++TD N+  PI E A  + +    + E+    + +  V+ +D D G N Q+   L+   +  L S   F  N +   +VT   +  DRE    + L +   D G PSL+ T  + + V D NDN P F       SILE+  +GT V ++ A D D+G+N +IKY+LS   +E+  F IDP SG I T    DRE  + + + A A D     ++S++ + + + D ND+PP F     + ++ EN  +  V+G + A D D G NA + Y +    + +    ++R G     + + L    +D    R   E+  R   + PL +   +EI++ D+NDN+P  
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI--SERDDNFPLAVDPRTGW-------VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT---TGNTRGRFAI----TSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTAT--VHINITDANNFAPIFENAPYSAS----VFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVT--NAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGS---ERAQLLTMTELDYESTRKRFELVVR-AASPPLRNDAHIEILVTDVNDNAPVL 1220          

HSP 2 Score: 194.512 bits (493), Expect = 1.148e-49
Identity = 185/694 (26.66%), Postives = 307/694 (44.24%), Query Frame = 3
Query:  432 LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTN---QGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPP---LTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQG---QAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDP--FSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDY--------FLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI----FYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNKKI 2420
            L + V D ND+ P+F+   F   I E +   + V    A D D G N  + Y I+  AV++   L         +    S  +    S DRE  + + L++ A DL +      T++ ++++ + D ND+ PQF++ +Y    PE    G     +  + ATD D  +   I  +         +FS+ +  G +S    L Y  S   YR+ I A D G+P+ + T+ +LV+V D NDN P    +   ++    + EN      I +V   D D G N ++   +   D+N+   ++       R  +     P    DRE +      ++  D GVP  + +  + + V+D NDN P F  ++   ++ E+ P GT VT + A D D   ++++ Y + +      F I      G+IT   S D + +  + +   A D      + + T+H+ I D N+  P F    +S  + E+  +   +  V A D D+G NAQ+ Y         L +P P     + G I  +    LDRE    Y + + A+D GN  L+ +T VEI + D+NDN+P F  P      ++  + + GT +    A D D G N +I Y +  + I    F I+ + G+I  NK L  E +    +   A D G  P ++T  + +       S P   + KI
Sbjct:  450 LQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIE--AVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYA-IIGGNTQSQFSIDSMSGDVSLVKPLDY-ESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES----VLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDP------RTGWVQTIKP---LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS--GGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAP--LDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL--YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKI 1118          

HSP 3 Score: 191.43 bits (485), Expect = 1.019e-48
Identity = 182/669 (27.20%), Postives = 301/669 (44.99%), Query Frame = 3
Query:  450 DVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMM--------SPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVD---SGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNS---YIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQ---------NFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENF--NIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKENL-EGV-LGRVEAVDKDIGQNAQMDYFLFNPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI--------FYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            ++ +  P F++  +   + E  PA   V    ARDP+   +  VVY++     S    L    +  G      +    S DRE+ +     ++A D   PP + + T+++++ D NDH+P F    +  +  E    G  +  + ATD+DI     I          +  A  Q M  F + +  GVIST+ +L   +S   Y + + A D   + +   TAT++V V V D NDN P      S +   + + E+    +    +A +  +D D GNN  +   +   +    F+++S+          ++E+ R Y+LV                  I   D G PS + T  + V V D NDN P FY      S+LEN+P+G  + R++A D D G NA+I Y +S E  +NF   +DP +G + T    DRE Q  +  +  A D  +   ++S ++ +T+ D NDN P F  + +  ++ E+   G  +  V A D D       +    N    F I S+NG   ++  + LD ++  R+ + + A D G R  + + TV I I D N+ +P F E  P    ++  +   GT +    A D+D G NA+I Y++  ++I        F IN   G+I  N  L  E      + ++A+D G
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPE---DSPVVYSMVSLLDSRSQSLFKVDSRTG-----VVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSD-SYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF----SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLV------------------IRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS-ERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIF-ENAP-YSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGG 983          

HSP 4 Score: 114.005 bits (284), Expect = 5.455e-25
Identity = 97/344 (28.20%), Postives = 165/344 (47.97%), Query Frame = 3
Query: 1443 VVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAID-KDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPS-----------PLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHG---NRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTK---IFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            V ++  +  P F +     S+LE  P G  VT ++A D +D  V   +  +L       F +D  +G++TT  S DRE+   +  +  A D      + + T+ V +LD ND+ P F    F   I+E   +   +  + A D+DIG+NA+++Y +   +           P+F I SR+G   +S +  LDRE  D Y + + A D     +   T++ +V++ + D NDN P F E      + +  +   GT+   +   +A D D G NA I Y I    +Q+ F I++  G + L K L  E +   +++I A+D G   ++ T+ L +N I +  + P
Sbjct:  348 VRRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSG--VISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERT--YTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP 687          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 209.149 bits (531), Expect = 3.168e-54
Identity = 172/575 (29.91%), Postives = 273/575 (47.48%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVL-ISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR------IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFE-NRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN--FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLF---NPSPLFEISRNGDIFVSQKRYLDRERVD----RYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTF 2093
            QL + V D NDN P F    F   + EN P    +    A D D G N  + Y+I  S   + F L + P T         ++ ++  DRE    F   ++AKD G PP ++S ++ I + DVND+ P FN   Y  N  E    G  +  V ATD D  SR+   ++   +     +F++           L+ ++ S DY+      + + A DSG  + TAT  V +++TD N+  PI E A  + +    + E+    + +  V+ +D D G N Q+   L+   +  L S   F  N +   +VT   +  DRE    + L +   D G PSL+ T  + + V D NDN P F       SILE+  +GT V ++ A D D+G+N +IKY+LS   +E+  F IDP SG I T    DRE  + + + A A D     ++S++ + + + D ND+PP F     + ++ EN  +  V+G + A D D G NA + Y +    + +    ++R G     + + L    +D    R   E+  R   + PL +   +EI++ D+NDN+P  
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI--SERDDNFPLAVDPRTGW-------VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT---TGNTRGRFAI----TSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTAT--VHINITDANNFAPIFENAPYSAS----VFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVT--NAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGS---ERAQLLTMTELDYESTRKRFELVVR-AASPPLRNDAHIEILVTDVNDNAPVL 1220          

HSP 2 Score: 194.126 bits (492), Expect = 1.295e-49
Identity = 185/694 (26.66%), Postives = 307/694 (44.24%), Query Frame = 3
Query:  432 LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTN---QGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPP---LTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQG---QAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDP--FSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDY--------FLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI----FYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNKKI 2420
            L + V D ND+ P+F+   F   I E +   + V    A D D G N  + Y I+  AV++   L         +    S  +    S DRE  + + L++ A DL +      T++ ++++ + D ND+ PQF++ +Y    PE    G     +  + ATD D  +   I  +         +FS+ +  G +S    L Y  S   YR+ I A D G+P+ + T+ +LV+V D NDN P    +   ++    + EN      I +V   D D G N ++   +   D+N+   ++       R  +     P    DRE +      ++  D GVP  + +  + + V+D NDN P F  ++   ++ E+ P GT VT + A D D   ++++ Y + +      F I      G+IT   S D + +  + +   A D      + + T+H+ I D N+  P F    +S  + E+  +   +  V A D D+G NAQ+ Y         L +P P     + G I  +    LDRE    Y + + A+D GN  L+ +T VEI + D+NDN+P F  P      ++  + + GT +    A D D G N +I Y +  + I    F I+ + G+I  NK L  E +    +   A D G  P ++T  + +       S P   + KI
Sbjct:  450 LQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIE--AVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYA-IIGGNTQSQFSIDSMSGDVSLVKPLDY-ESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES----VLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDP------RTGWVQTIKP---LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS--GGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAP--LDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL--YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKI 1118          

HSP 3 Score: 191.045 bits (484), Expect = 1.209e-48
Identity = 182/669 (27.20%), Postives = 301/669 (44.99%), Query Frame = 3
Query:  450 DVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMM--------SPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVD---SGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNS---YIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQ---------NFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENF--NIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKENL-EGV-LGRVEAVDKDIGQNAQMDYFLFNPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI--------FYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            ++ +  P F++  +   + E  PA   V    ARDP+   +  VVY++     S    L    +  G      +    S DRE+ +     ++A D   PP + + T+++++ D NDH+P F    +  +  E    G  +  + ATD+DI     I          +  A  Q M  F + +  GVIST+ +L   +S   Y + + A D   + +   TAT++V V V D NDN P      S +   + + E+    +    +A +  +D D GNN  +   +   +    F+++S+          ++E+ R Y+LV                  I   D G PS + T  + V V D NDN P FY      S+LEN+P+G  + R++A D D G NA+I Y +S E  +NF   +DP +G + T    DRE Q  +  +  A D  +   ++S ++ +T+ D NDN P F  + +  ++ E+   G  +  V A D D       +    N    F I S+NG   ++  + LD ++  R+ + + A D G R  + + TV I I D N+ +P F E  P    ++  +   GT +    A D+D G NA+I Y++  ++I        F IN   G+I  N  L  E      + ++A+D G
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPE---DSPVVYSMVSLLDSRSQSLFKVDSRTG-----VVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSD-SYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF----SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLV------------------IRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS-ERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIF-ENAP-YSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGG 983          

HSP 4 Score: 114.005 bits (284), Expect = 5.408e-25
Identity = 97/344 (28.20%), Postives = 165/344 (47.97%), Query Frame = 3
Query: 1443 VVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAID-KDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPS-----------PLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHG---NRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTK---IFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            V ++  +  P F +     S+LE  P G  VT ++A D +D  V   +  +L       F +D  +G++TT  S DRE+   +  +  A D      + + T+ V +LD ND+ P F    F   I+E   +   +  + A D+DIG+NA+++Y +   +           P+F I SR+G   +S +  LDRE  D Y + + A D     +   T++ +V++ + D NDN P F E      + +  +   GT+   +   +A D D G NA I Y I    +Q+ F I++  G + L K L  E +   +++I A+D G   ++ T+ L +N I +  + P
Sbjct:  348 VRRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSG--VISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERT--YTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP 687          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 299.286 bits (765), Expect = 3.781e-85
Identity = 234/762 (30.71%), Postives = 375/762 (49.21%), Query Frame = 3
Query:  117 LVSLFIYINILWYSN-GECVVEENSPIFVRICNVKKTF-----PDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQ----YNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRI----PIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            LV LF  + ++  +   +  V+E  P  VRI N++K       PDI+  +   F+  ++  D  +  +++   E L T  + D  K     +N  R    I +  L     +  ++  L+ D+NDN P F     N  I EN+  ++   +P A DPD G NG   Y +  S   ++F L    T +G D   +L + QS DRE  + F + +  +D GNPP +S+  +++ ++DVND+ P F  S    N PE+   G ++  + ATD D+ S   I  S   S+QI       F   I +   L+ V    D  +     +I + S   +  + +TV+V+VTDINDN P I+     +  N  ++L+EN   N+ IA +TV+D+D   NG+V C  D++  F L+ + N      + L TA  +  D E    + + I+ SD G P L T+  + + +KDENDN P+F +    +SI EN   GT++ ++ A D D G NA I Y L P+  + FNID  SG+++     DRE Q +Y     A D+    + S++T+ + + D+NDN P F    ++F++ ENL   G +G +   D D G NA +   + N    F I     + +      DRE+   Y+  + A D G    TS   V I + D+NDN P F+ P      +L    T  G+ +    AIDNDTG NA++ Y+I   +   +F I+ + G+I L + +        ++++  +D G
Sbjct:   10 LVVLFTCLFLMCRAQEKDYTVKEEQPENVRIGNLRKDLNLNLDPDIKLSSALQFKPVYKTGDVPLVKVEASTGEILTTANRIDREKLCSGVFNEKRCYYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSV--SEFGLDIIETPEG-DKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFS--FSNQISPSTKRHF--AIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFRLKPVFN----DQFLLETA--APLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGKDNFIIDPKTGV-IKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNTSPGSVVTRVFAIDNDTGMNAELQYSIIGGSLRGLFTIDKTTGNITLQEKIVAADQGLHRLVVKVKDLG 757          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 300.056 bits (767), Expect = 7.208e-85
Identity = 234/762 (30.71%), Postives = 375/762 (49.21%), Query Frame = 3
Query:  117 LVSLFIYINILWYSN-GECVVEENSPIFVRICNVKKTF-----PDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQ----YNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRI----PIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            LV LF  + ++  +   +  V+E  P  VRI N++K       PDI+  +   F+  ++  D  +  +++   E L T  + D  K     +N  R    I +  L     +  ++  L+ D+NDN P F     N  I EN+  ++   +P A DPD G NG   Y +  S   ++F L    T +G D   +L + QS DRE  + F + +  +D GNPP +S+  +++ ++DVND+ P F  S    N PE+   G ++  + ATD D+ S   I  S   S+QI       F   I +   L+ V    D  +     +I + S   +  + +TV+V+VTDINDN P I+     +  N  ++L+EN   N+ IA +TV+D+D   NG+V C  D++  F L+ + N      + L TA  +  D E    + + I+ SD G P L T+  + + +KDENDN P+F +    +SI EN   GT++ ++ A D D G NA I Y L P+  + FNID  SG+++     DRE Q +Y     A D+    + S++T+ + + D+NDN P F    ++F++ ENL   G +G +   D D G NA +   + N    F I     + +      DRE+   Y+  + A D G    TS   V I + D+NDN P F+ P      +L    T  G+ +    AIDNDTG NA++ Y+I   +   +F I+ + G+I L + +        ++++  +D G
Sbjct:   10 LVVLFTCLFLMCRAQEKDYTVKEEQPENVRIGNLRKDLNLNLDPDIKLSSALQFKPVYKTGDVPLVKVEASTGEILTTANRIDREKLCSGVFNEKRCYYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSV--SEFGLDIIETPEG-DKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFS--FSNQISPSTKRHF--AIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFRLKPVFN----DQFLLETA--APLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGKDNFIIDPKTGV-IKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNTSPGSVVTRVFAIDNDTGMNAELQYSIIGGSLRGLFTIDKTTGNITLQEKIVAADQGLHRLVVKVKDLG 757          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 276.559 bits (706), Expect = 8.041e-77
Identity = 227/789 (28.77%), Postives = 365/789 (46.26%), Query Frame = 3
Query:  108 WMTLVSLFIYINILWYSNGECVVEENSP-IFVRICNVKKTFPDIENP-TIDNFQNFFRLNDNNVEML---QSLDRENLITNQKCDTSKQYNYNRDSQCILILELS------GSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAI--KPSAVSNKFVLISPSTNQGHDSSL-KLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMS-PSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIAS----SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLS----PECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKENLEGV--LGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHL 2369
            W    ++ ++I +L   +   V EE  P   +      +  PD  +   ++    + R++    ++     S+DRE+L   + C      N      C L  E+S      G+GP+  +  I + D NDN P F        I EN+       +P+A D D G+NG   YA+   P A +    L S    Q  D  L +L +L + DRE+ + + L +   D G+PP  SS  ++I ITD ND+ P+F +S Y    PE+   G ++ QV A D D+     +  S    SS +M   S      I     +++V  S D       +  + A D+G  + ++ + V + V D NDN P I I      ++++    ++E+    + +A V VSD+D G N  V C +  +  F L S     N R  K     T+  D E    +++ I+  D G P+L++T  + V V D NDN P+F      V   E    G KV  + A D D G NA++ Y ++    PE L  F I+P +G +      DRE    Y+    A D  +  +  + T+ V +LD NDN PKF L  +SF ++EN+  +  +G V   D D G+NA++   +   +  F I +NG   +      DRE+   YS  + A D G+ P +S   + I + D NDN+P   +P    +  L   T   T + + +A D D G N+++ + I       +F I +S+G I L K    +HI   ++++  +D G  P+ TT+ +H+
Sbjct:   39 WSRWSAMLVWILLLLCCSANVVTEEQPPNTLIGSLASDQGLPDTGHLYKLEVGAPYLRVDGKTGDIYTTENSIDRESL---KDC-----RNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATN----LFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLS------IDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGL--FEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMI-QNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRI-SSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHI 805          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 275.789 bits (704), Expect = 1.222e-76
Identity = 217/686 (31.63%), Postives = 351/686 (51.17%), Query Frame = 3
Query:  372 RDSQC---ILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTI--MMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVD-SGNPTLTATSTVLVHVTDINDNRPIIEIAS--SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLH 2366
             DS+C   I ++ L     +  ++ I+V D NDN P F     N  I EN+  ++   +P A DPD G N    Y +      + F L    T +G     +L + Q+ DRE  + + + +  +D GNP  +S+  +++ +TDVND+ P F +S    + PE+   G ++ Q+ ATD D+ +   I  M     S      F+      ++T   L+ V    D      +++ ++A D S +P   A +T+ ++VTD+NDN P I++    S  N  ++L+E    N+ IA +TVSDKD   NG+V C ++ +  F+L+++  ++N+  Y L T+  +  D E    +   I+ SD G PSL  T  + V ++DENDNPPIF +    ++++EN      +T + A D+D G NA+I Y L P     F++D  +G++T    FDRE Q  +    TA D+    + S   + VTILDENDN PKF    F F + ENL     +G +   D D G+NA +   + N +  F +  +  +  S   + DRE+   Y+ ++ A D+G+ P +S+  V I + D+NDN+P  I P       L  +  I G+ +    A+D DTG NA++ YTI S   +++F I+   G+I L +      I   +++++  D G  PK    SLH
Sbjct:  104 EDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNG--QSAFGLDIVETPEGEKWP-QLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFA------LNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP---ARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAV--YDNQ--YLLETS--ALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNA-SFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSF-DREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLG-YPK----SLH 764          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 275.018 bits (702), Expect = 1.306e-76
Identity = 217/686 (31.63%), Postives = 351/686 (51.17%), Query Frame = 3
Query:  372 RDSQC---ILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTI--MMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVD-SGNPTLTATSTVLVHVTDINDNRPIIEIAS--SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLH 2366
             DS+C   I ++ L     +  ++ I+V D NDN P F     N  I EN+  ++   +P A DPD G N    Y +      + F L    T +G     +L + Q+ DRE  + + + +  +D GNP  +S+  +++ +TDVND+ P F +S    + PE+   G ++ Q+ ATD D+ +   I  M     S      F+      ++T   L+ V    D      +++ ++A D S +P   A +T+ ++VTD+NDN P I++    S  N  ++L+E    N+ IA +TVSDKD   NG+V C ++ +  F+L+++  ++N+  Y L T+  +  D E    +   I+ SD G PSL  T  + V ++DENDNPPIF +    ++++EN      +T + A D+D G NA+I Y L P     F++D  +G++T    FDRE Q  +    TA D+    + S   + VTILDENDN PKF    F F + ENL     +G +   D D G+NA +   + N +  F +  +  +  S   + DRE+   Y+ ++ A D+G+ P +S+  V I + D+NDN+P  I P       L  +  I G+ +    A+D DTG NA++ YTI S   +++F I+   G+I L +      I   +++++  D G  PK    SLH
Sbjct:  104 EDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNG--QSAFGLDIVETPEGEKWP-QLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFA------LNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP---ARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAV--YDNQ--YLLETS--ALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNA-SFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSF-DREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLG-YPK----SLH 764          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 293.893 bits (751), Expect = 6.105e-83
Identity = 232/749 (30.97%), Postives = 371/749 (49.53%), Query Frame = 3
Query:  171 VVEENSPIFVRICNVKKTF-----PDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQ-YNYNRDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIAS--SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNP------SPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLN-KSLQDEHILPDKIIISARDSG 2333
            +V E  P  V I N+ K       PD+  P    F+  ++  D  +  ++    E   T+ + D  K       +++C   +E++    + ++L     L+ D+NDN P F     N  I EN+  ++   +P A DPD G NG   Y +      N F L    T +G D   +L + QS DRE  + + + +  +D GNP  +S+  +++ +TDVND+ P F +     N PE    G ++ Q+ ATD D+ S   I          + K   A D   G+I+ K  L    S + +++ ++A D    +  + +TV +++TDINDN P I+     +  N  + L+E    N+ IA +TV+DKD   NG+V C  D++  F L+ +  F+N+  + L TA  +  D E    + + I+ SD G P L  +  + + +KDENDN P+F      +S +EN P GT++T++ A D D G NA++ YML P     FN+D  +G++T     DRE Q  Y     A D+    + ++ T+ +++LD+NDN P F    ++F++ ENL   G +G +   D D G+NA +   L N        PL  + R    F       DRE+   Y+ ++ A D G+   +S+  V I ++D+NDN P F+ P      +L    T  G+ +    AIDNDTG NA + Y+I    S+ +F I    G+I L  K L  +H +  K++I   DSG
Sbjct:   29 IVREELPENVLIGNLLKDLNLTLDPDLSTPL--QFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKG--QNVFGLDVIETPEG-DKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPY-HKLTVLASDGS--STPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPV--FDNQ--FLLETA--APLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITF-------DREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSG 756          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 293.508 bits (750), Expect = 9.581e-83
Identity = 232/749 (30.97%), Postives = 371/749 (49.53%), Query Frame = 3
Query:  171 VVEENSPIFVRICNVKKTF-----PDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQ-YNYNRDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIAS--SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNP------SPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLN-KSLQDEHILPDKIIISARDSG 2333
            +V E  P  V I N+ K       PD+  P    F+  ++  D  +  ++    E   T+ + D  K       +++C   +E++    + ++L     L+ D+NDN P F     N  I EN+  ++   +P A DPD G NG   Y +      N F L    T +G D   +L + QS DRE  + + + +  +D GNP  +S+  +++ +TDVND+ P F +     N PE    G ++ Q+ ATD D+ S   I          + K   A D   G+I+ K  L    S + +++ ++A D    +  + +TV +++TDINDN P I+     +  N  + L+E    N+ IA +TV+DKD   NG+V C  D++  F L+ +  F+N+  + L TA  +  D E    + + I+ SD G P L  +  + + +KDENDN P+F      +S +EN P GT++T++ A D D G NA++ YML P     FN+D  +G++T     DRE Q  Y     A D+    + ++ T+ +++LD+NDN P F    ++F++ ENL   G +G +   D D G+NA +   L N        PL  + R    F       DRE+   Y+ ++ A D G+   +S+  V I ++D+NDN P F+ P      +L    T  G+ +    AIDNDTG NA + Y+I    S+ +F I    G+I L  K L  +H +  K++I   DSG
Sbjct:   49 IVREELPENVLIGNLLKDLNLTLDPDLSTPL--QFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKG--QNVFGLDVIETPEG-DKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPY-HKLTVLASDGS--STPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPV--FDNQ--FLLETA--APLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITF-------DREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSG 776          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 293.123 bits (749), Expect = 1.091e-82
Identity = 232/749 (30.97%), Postives = 371/749 (49.53%), Query Frame = 3
Query:  171 VVEENSPIFVRICNVKKTF-----PDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQ-YNYNRDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIAS--SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNP------SPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLN-KSLQDEHILPDKIIISARDSG 2333
            +V E  P  V I N+ K       PD+  P    F+  ++  D  +  ++    E   T+ + D  K       +++C   +E++    + ++L     L+ D+NDN P F     N  I EN+  ++   +P A DPD G NG   Y +      N F L    T +G D   +L + QS DRE  + + + +  +D GNP  +S+  +++ +TDVND+ P F +     N PE    G ++ Q+ ATD D+ S   I          + K   A D   G+I+ K  L    S + +++ ++A D    +  + +TV +++TDINDN P I+     +  N  + L+E    N+ IA +TV+DKD   NG+V C  D++  F L+ +  F+N+  + L TA  +  D E    + + I+ SD G P L  +  + + +KDENDN P+F      +S +EN P GT++T++ A D D G NA++ YML P     FN+D  +G++T     DRE Q  Y     A D+    + ++ T+ +++LD+NDN P F    ++F++ ENL   G +G +   D D G+NA +   L N        PL  + R    F       DRE+   Y+ ++ A D G+   +S+  V I ++D+NDN P F+ P      +L    T  G+ +    AIDNDTG NA + Y+I    S+ +F I    G+I L  K L  +H +  K++I   DSG
Sbjct:   49 IVREELPENVLIGNLLKDLNLTLDPDLSTPL--QFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKG--QNVFGLDVIETPEG-DKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPY-HKLTVLASDGS--STPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPV--FDNQ--FLLETA--APLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITF-------DREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSG 776          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: emc7 (ER membrane protein complex subunit 7 [Source:Xenbase;Acc:XB-GENE-945123])

HSP 1 Score: 274.633 bits (701), Expect = 2.968e-76
Identity = 227/797 (28.48%), Postives = 380/797 (47.68%), Query Frame = 3
Query:  174 VEENSPIFVRICNVKKTFPDIENP-----TIDNFQNFFRLNDNNVEMLQS---LDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGP-----KFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAI----------------------------KPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGV-----ISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSN----QNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFE---NRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHL 2369
            + E  P  VRI NV K    ++       ++++  ++F++++   E+  +   +DRE L    +C    Q  ++ +++C +  E+S  GP     + ++  +++ D+NDN P+F        + EN P      LP A D D G NG   Y +                            +  + S+ F L    T+ G +   +L +    DRE  + ++L L  +D G PP +S   +++ ITDVND+ P+F +S Y  +  E+   G  I Q+ ATD D+            + QI   F  A + V     +      + V    D       R  ++A D G P  T  +TV++++ D NDN P+I+I        ++    + E+   ++ IA V VSD+D G NG V C +  +  F L+   + E   N++ Y L T  ++  D E    + + I+  D G PSL++   + V V D NDNPP+F +    V+  EN  +G +V  + A D D G NA+I Y L P     F+I P +G IT  +  DRE    Y+ K  A D  I  +  + ++ V + D NDN P+F++  F+F++KENL+    +G V  +D D G+NA+M  F+   S +F I  +     S   + DRE    Y+ ++ A D G+ P +++ TV + + D NDN+PT   P    +  LS  +   T + +  A D+D G NA + Y+I       +F I+++ G + L   L  +H    ++++   DSG  P++T + +H+
Sbjct:   34 IAEEGPADVRIGNVAKEIGIVKGSGDVTFSLESGSDYFKIDNVTGELSTTERRIDREKL---PQC----QMIFD-ENECFIDFEVSVIGPAQSWVELFEGRVVILDINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELIQDAGESLYVSGRRGAAESSLYPGKRRMESDSRSSVFELQVADTSDG-EKQPQLIVKGPLDREQRDSYELTLRVRDGGEPPRSSQSILRVLITDVNDNNPRFEKSVYEADLAENSAPGTPILQLRATDYDVG----------VNGQIEYVFGAATESVRRLLRLDENSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVPLIDIRKIGRIPVKDGMANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPANDGEGEQNKKKYFLHT--SAPLDYENVKEYNVIIVAVDSGSPSLSSNNSLIVKVGDTNDNPPVFSQAVVEVAFPENNVLGERVATVLATDADSGKNAEIAYSLEPSMEGIFSIHPDTGDITVNIILDREQTDRYEFKVIAKDKGIPVLQGTTSVVVQVADRNDNEPRFMQDVFTFYVKENLQPNSPVGMVTVMDADKGRNAEMSLFIEEDSDIFSIENDTGTIYSTVSF-DREHQTSYTFKVKAVDGGDPPRSATATVSLFVMDENDNAPTISFPINSSYAVLSPSSNVRTVVASVVATDSDNGVNADLNYSIVGGNPYKLFEIDSTSGVVSLVGKLTSKHYGLHRLVVQVNDSGQPPQSTIALVHV 808          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: emc7 (ER membrane protein complex subunit 7 [Source:Xenbase;Acc:XB-GENE-945123])

HSP 1 Score: 274.248 bits (700), Expect = 3.539e-76
Identity = 227/797 (28.48%), Postives = 379/797 (47.55%), Query Frame = 3
Query:  174 VEENSPIFVRICNVKKTFPDIENP-----TIDNFQNFFRLNDNNVEMLQS---LDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGP-----KFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAI----------------------------KPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGV-----ISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSN----QNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFE---NRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHL 2369
            + E  P  VRI NV K    ++       ++++  ++F++++   E+  +   +DRE L    +C    Q  ++ +++C +  E+S  GP     + ++  +++ D+NDN P+F        + EN P      LP A D D G NG   Y +                            +  + S+ F L    T+ G     +L +    DRE  + ++L L  +D G PP +S   +++ ITDVND+ P+F +S Y  +  E+   G  I Q+ ATD D+            + QI   F  A + V     +      + V    D       R  ++A D G P  T  +TV++++ D NDN P+I+I        ++    + E+   ++ IA V VSD+D G NG V C +  +  F L+   + E   N++ Y L T  ++  D E    + + I+  D G PSL++   + V V D NDNPP+F +    V+  EN  +G +V  + A D D G NA+I Y L P     F+I P +G IT  +  DRE    Y+ K  A D  I  +  + ++ V + D NDN P+F++  F+F++KENL+    +G V  +D D G+NA+M  F+   S +F I  +     S   + DRE    Y+ ++ A D G+ P +++ TV + + D NDN+PT   P    +  LS  +   T + +  A D+D G NA + Y+I       +F I+++ G + L   L  +H    ++++   DSG  P++T + +H+
Sbjct:   34 IAEEGPADVRIGNVAKEIGIVKGSGDVTFSLESGSDYFKIDNVTGELSTTERRIDREKL---PQC----QMIFD-ENECFIDFEVSVIGPAQSWVELFEGRVVILDINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELIQDAGESLYVSGRRGAAESSLYPGKRRMESDSRSSVFELQVADTSDGEKQP-QLIVKGPLDREQRDSYELTLRVRDGGEPPRSSQSILRVLITDVNDNNPRFEKSVYEADLAENSAPGTPILQLRATDYDVG----------VNGQIEYVFGAATESVRRLLRLDENSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVPLIDIRKIGRIPVKDGMANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPANDGEGEQNKKKYFLHT--SAPLDYENVKEYNVIIVAVDSGSPSLSSNNSLIVKVGDTNDNPPVFSQAVVEVAFPENNVLGERVATVLATDADSGKNAEIAYSLEPSMEGIFSIHPDTGDITVNIILDREQTDRYEFKVIAKDKGIPVLQGTTSVVVQVADRNDNEPRFMQDVFTFYVKENLQPNSPVGMVTVMDADKGRNAEMSLFIEEDSDIFSIENDTGTIYSTVSF-DREHQTSYTFKVKAVDGGDPPRSATATVSLFVMDENDNAPTISFPINSSYAVLSPSSNVRTVVASVVATDSDNGVNADLNYSIVGGNPYKLFEIDSTSGVVSLVGKLTSKHYGLHRLVVQVNDSGQPPQSTIALVHV 808          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 289.271 bits (739), Expect = 1.550e-81
Identity = 215/687 (31.30%), Postives = 352/687 (51.24%), Query Frame = 3
Query:  375 DSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNF 2375
            D++C   +E++    + ++L     L+ D+NDN P F     N  I ENS  ++   LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ + D ND+ P F +     + PE+   G ++ Q+ ATD DI   +R+    S   S+     F       ++T   L+ V    D      +++ ++A D G  +  A +TVLV+VTDINDN P I+I    +  N  ++L+EN   N+ IA +TV DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   S+S+ EN   G ++T++ A D D G NA+I YML  +    FN+D  +G++T     DRE Q +Y     A D+ I  + S+ T+ VT+LD+NDN P F    ++F++ E+L   G +G +   D D G+N+ +   + + +  F I     +      + DRER + Y+  + A D G    +S+  V I + D+NDN P FI+P         +  T  GT +F   AID+D G NA+++Y+I    ++ +F I  + G+I L +      +   ++I+ A D G  P +  + +++NF
Sbjct:  103 DARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFH------LNTTTGLITVKEPLDREESPSHKLLVLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPV--FSNQ--FLLETA--AFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISF-DRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLG-QPDSLFNVVNVNF 770          

HSP 2 Score: 152.525 bits (384), Expect = 5.602e-37
Identity = 165/588 (28.06%), Postives = 259/588 (44.05%), Query Frame = 3
Query:  771 IKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVIST----KVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPII---EIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHY-----KLVTAPTSSFDREVKDHHQLNIICSDMG-VPSLTTTRPITVVVKDENDNPP------IFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDP-FSG--MITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTF-SFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFL-FNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI-QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP----PPMNKKIE 2423
            I+  I D+ND+AP F  +    + PE+           A D DI       ++   + Q++   ++    VI T    K+  + V    D      Y + +   D G P  ++T+ + V V D NDN PI    EI  S       + EN    S + ++  +D D G N ++       Y  NL  + N   R  +      L+T      DRE    H+L ++ +D G  P+  T   + V V D NDN P      I    + +V + EN P+ TK+  +  +DKD   N ++      E    F + P FS   ++ T    D E   EY +K  A D     +N S  + + + DENDN P F ++F S  + EN      L ++ A D D GQNA++ Y L F+  P F + +   I  + K+ LDRE+ ++Y   + A+D+G  PL S+ TV + + D NDNSP F   +   ++  S+       + T    D D GEN+ +  +I      F I+   G I  N S   E        + A D G + +++T+ + +N +    +KP    PP N   E
Sbjct:  125 IRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG------INGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVS-------IPENAPIGSSVTQLHATDADIGENARIHF-----YFSNL--VSNIAKRLFHLNTTTGLITV-KEPLDREESPSHKLLVLATDGGSTPARAT---VLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEV--PFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKK-LDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVT--DPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFE 683          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 289.656 bits (740), Expect = 4.984e-81
Identity = 215/687 (31.30%), Postives = 352/687 (51.24%), Query Frame = 3
Query:  375 DSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNF 2375
            D++C   +E++    + ++L     L+ D+NDN P F     N  I ENS  ++   LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ + D ND+ P F +     + PE+   G ++ Q+ ATD DI   +R+    S   S+     F       ++T   L+ V    D      +++ ++A D G  +  A +TVLV+VTDINDN P I+I    +  N  ++L+EN   N+ IA +TV DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   S+S+ EN   G ++T++ A D D G NA+I YML  +    FN+D  +G++T     DRE Q +Y     A D+ I  + S+ T+ VT+LD+NDN P F    ++F++ E+L   G +G +   D D G+N+ +   + + +  F I     +      + DRER + Y+  + A D G    +S+  V I + D+NDN P FI+P         +  T  GT +F   AID+D G NA+++Y+I    ++ +F I  + G+I L +      +   ++I+ A D G  P +  + +++NF
Sbjct:  103 DARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFH------LNTTTGLITVKEPLDREESPSHKLLVLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPV--FSNQ--FLLETA--AFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISF-DRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLG-QPDSLFNVVNVNF 770          

HSP 2 Score: 152.525 bits (384), Expect = 7.315e-37
Identity = 165/588 (28.06%), Postives = 259/588 (44.05%), Query Frame = 3
Query:  771 IKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVIST----KVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPII---EIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHY-----KLVTAPTSSFDREVKDHHQLNIICSDMG-VPSLTTTRPITVVVKDENDNPP------IFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDP-FSG--MITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTF-SFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFL-FNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI-QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP----PPMNKKIE 2423
            I+  I D+ND+AP F  +    + PE+           A D DI       ++   + Q++   ++    VI T    K+  + V    D      Y + +   D G P  ++T+ + V V D NDN PI    EI  S       + EN    S + ++  +D D G N ++       Y  NL  + N   R  +      L+T      DRE    H+L ++ +D G  P+  T   + V V D NDN P      I    + +V + EN P+ TK+  +  +DKD   N ++      E    F + P FS   ++ T    D E   EY +K  A D     +N S  + + + DENDN P F ++F S  + EN      L ++ A D D GQNA++ Y L F+  P F + +   I  + K+ LDRE+ ++Y   + A+D+G  PL S+ TV + + D NDNSP F   +   ++  S+       + T    D D GEN+ +  +I      F I+   G I  N S   E        + A D G + +++T+ + +N +    +KP    PP N   E
Sbjct:  125 IRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG------INGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVS-------IPENAPIGSSVTQLHATDADIGENARIHF-----YFSNL--VSNIAKRLFHLNTTTGLITV-KEPLDREESPSHKLLVLATDGGSTPARAT---VLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEV--PFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKK-LDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVT--DPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFE 683          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 289.271 bits (739), Expect = 3.090e-80
Identity = 215/687 (31.30%), Postives = 352/687 (51.24%), Query Frame = 3
Query:  375 DSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNF 2375
            D++C   +E++    + ++L     L+ D+NDN P F     N  I ENS  ++   LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ + D ND+ P F +     + PE+   G ++ Q+ ATD DI   +R+    S   S+     F       ++T   L+ V    D      +++ ++A D G  +  A +TVLV+VTDINDN P I+I    +  N  ++L+EN   N+ IA +TV DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   S+S+ EN   G ++T++ A D D G NA+I YML  +    FN+D  +G++T     DRE Q +Y     A D+ I  + S+ T+ VT+LD+NDN P F    ++F++ E+L   G +G +   D D G+N+ +   + + +  F I     +      + DRER + Y+  + A D G    +S+  V I + D+NDN P FI+P         +  T  GT +F   AID+D G NA+++Y+I    ++ +F I  + G+I L +      +   ++I+ A D G  P +  + +++NF
Sbjct:  103 DARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFH------LNTTTGLITVKEPLDREESPSHKLLVLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPV--FSNQ--FLLETA--AFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISF-DRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLG-QPDSLFNVVNVNF 770          

HSP 2 Score: 152.91 bits (385), Expect = 6.630e-37
Identity = 165/590 (27.97%), Postives = 260/590 (44.07%), Query Frame = 3
Query:  765 LTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVIST----KVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPII---EIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHY-----KLVTAPTSSFDREVKDHHQLNIICSDMG-VPSLTTTRPITVVVKDENDNPP------IFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDP-FSG--MITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTF-SFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFL-FNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI-QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP----PPMNKKIE 2423
            + I+  I D+ND+AP F  +    + PE+           A D DI       ++   + Q++   ++    VI T    K+  + V    D      Y + +   D G P  ++T+ + V V D NDN PI    EI  S       + EN    S + ++  +D D G N ++       Y  NL  + N   R  +      L+T      DRE    H+L ++ +D G  P+  T   + V V D NDN P      I    + +V + EN P+ TK+  +  +DKD   N ++      E    F + P FS   ++ T    D E   EY +K  A D     +N S  + + + DENDN P F ++F S  + EN      L ++ A D D GQNA++ Y L F+  P F + +   I  + K+ LDRE+ ++Y   + A+D+G  PL S+ TV + + D NDNSP F   +   ++  S+       + T    D D GEN+ +  +I      F I+   G I  N S   E        + A D G + +++T+ + +N +    +KP    PP N   E
Sbjct:  123 VKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG------INGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVS-------IPENAPIGSSVTQLHATDADIGENARIHF-----YFSNL--VSNIAKRLFHLNTTTGLITV-KEPLDREESPSHKLLVLATDGGSTPARAT---VLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEV--PFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKK-LDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVT--DPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFE 683          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 288.886 bits (738), Expect = 3.527e-80
Identity = 212/673 (31.50%), Postives = 344/673 (51.11%), Query Frame = 3
Query:  375 DSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            D++C   +E++    + ++L     L+ D+NDN P F     N  I ENS  ++   LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ + D ND+ P F +     + PE+   G ++ Q+ ATD DI   +R+    S   S+     F       ++T   L+ V    D      +++ ++A D G  +  A +TVLV+VTDINDN P I+I    +  N  ++L+EN   N+ IA +TV DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   S+S+ EN   G ++T++ A D D G NA+I YML  +    FN+D  +G++T     DRE Q +Y     A D+ I  + S+ T+ VT+LD+NDN P F    ++F++ E+L   G +G +   D D G+N+ +   + + +  F I     +      + DRER + Y+  + A D G    +S+  V I + D+NDN P FI+P         +  T  GT +F   AID+D G NA+++Y+I    ++ +F I  + G+I L +      +   ++I+ A D G
Sbjct:  103 DARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFH------LNTTTGLITVKEPLDREESPSHKLLVLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPV--FSNQ--FLLETA--AFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISF-DRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLG 757          

HSP 2 Score: 152.525 bits (384), Expect = 9.127e-37
Identity = 165/590 (27.97%), Postives = 260/590 (44.07%), Query Frame = 3
Query:  765 LTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVIST----KVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPII---EIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHY-----KLVTAPTSSFDREVKDHHQLNIICSDMG-VPSLTTTRPITVVVKDENDNPP------IFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDP-FSG--MITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTF-SFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFL-FNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI-QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP----PPMNKKIE 2423
            + I+  I D+ND+AP F  +    + PE+           A D DI       ++   + Q++   ++    VI T    K+  + V    D      Y + +   D G P  ++T+ + V V D NDN PI    EI  S       + EN    S + ++  +D D G N ++       Y  NL  + N   R  +      L+T      DRE    H+L ++ +D G  P+  T   + V V D NDN P      I    + +V + EN P+ TK+  +  +DKD   N ++      E    F + P FS   ++ T    D E   EY +K  A D     +N S  + + + DENDN P F ++F S  + EN      L ++ A D D GQNA++ Y L F+  P F + +   I  + K+ LDRE+ ++Y   + A+D+G  PL S+ TV + + D NDNSP F   +   ++  S+       + T    D D GEN+ +  +I      F I+   G I  N S   E        + A D G + +++T+ + +N +    +KP    PP N   E
Sbjct:  123 VKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG------INGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVS-------IPENAPIGSSVTQLHATDADIGENARIHF-----YFSNL--VSNIAKRLFHLNTTTGLITV-KEPLDREESPSHKLLVLATDGGSTPARAT---VLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEV--PFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKK-LDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVT--DPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFE 683          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 288.886 bits (738), Expect = 3.527e-80
Identity = 212/673 (31.50%), Postives = 344/673 (51.11%), Query Frame = 3
Query:  375 DSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            D++C   +E++    + ++L     L+ D+NDN P F     N  I ENS  ++   LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ + D ND+ P F +     + PE+   G ++ Q+ ATD DI   +R+    S   S+     F       ++T   L+ V    D      +++ ++A D G  +  A +TVLV+VTDINDN P I+I    +  N  ++L+EN   N+ IA +TV DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   S+S+ EN   G ++T++ A D D G NA+I YML  +    FN+D  +G++T     DRE Q +Y     A D+ I  + S+ T+ VT+LD+NDN P F    ++F++ E+L   G +G +   D D G+N+ +   + + +  F I     +      + DRER + Y+  + A D G    +S+  V I + D+NDN P FI+P         +  T  GT +F   AID+D G NA+++Y+I    ++ +F I  + G+I L +      +   ++I+ A D G
Sbjct:  103 DARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFH------LNTTTGLITVKEPLDREESPSHKLLVLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPV--FSNQ--FLLETA--AFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISF-DRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLG 757          

HSP 2 Score: 152.525 bits (384), Expect = 9.127e-37
Identity = 165/590 (27.97%), Postives = 260/590 (44.07%), Query Frame = 3
Query:  765 LTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVIST----KVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPII---EIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHY-----KLVTAPTSSFDREVKDHHQLNIICSDMG-VPSLTTTRPITVVVKDENDNPP------IFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDP-FSG--MITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTF-SFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFL-FNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI-QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP----PPMNKKIE 2423
            + I+  I D+ND+AP F  +    + PE+           A D DI       ++   + Q++   ++    VI T    K+  + V    D      Y + +   D G P  ++T+ + V V D NDN PI    EI  S       + EN    S + ++  +D D G N ++       Y  NL  + N   R  +      L+T      DRE    H+L ++ +D G  P+  T   + V V D NDN P      I    + +V + EN P+ TK+  +  +DKD   N ++      E    F + P FS   ++ T    D E   EY +K  A D     +N S  + + + DENDN P F ++F S  + EN      L ++ A D D GQNA++ Y L F+  P F + +   I  + K+ LDRE+ ++Y   + A+D+G  PL S+ TV + + D NDNSP F   +   ++  S+       + T    D D GEN+ +  +I      F I+   G I  N S   E        + A D G + +++T+ + +N +    +KP    PP N   E
Sbjct:  123 VKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG------INGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVS-------IPENAPIGSSVTQLHATDADIGENARIHF-----YFSNL--VSNIAKRLFHLNTTTGLITV-KEPLDREESPSHKLLVLATDGGSTPARAT---VLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEV--PFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKK-LDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVT--DPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFE 683          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 7.389e-82
Identity = 215/669 (32.14%), Postives = 350/669 (52.32%), Query Frame = 3
Query:  372 RDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPS--ASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            RD  C   +E++    + ++L     L+ D+NDN P F     N  I ENS  +++  LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ +TD ND+ P F ++    + PE+   G ++ Q+ ATD DI     I  S S   S+     F + A  G+I+ K  L     + ++++ ++A D G   + A + VLV+VTD+NDN P I+I    +  N+ +VL+EN   N+ IA +TV+DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   +VSI EN   G ++T++ A D D G NA+I Y+L P+    F++D  +GM+T     DRE + +Y     A D+ +  + S++T+ V+I+D+NDN P F    ++F++ ENL   G +G +   D D G N+ +   + + +  F I     +      + DRE+ + Y+  + A D G    +SS  V I + D+NDN P FI P       L +  T  GT +F   A+DNDTG NA++ Y+I    ++ +F I+   G+I L +      +   ++++ A D G
Sbjct:  102 RDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDR-EETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV--FSNQ--FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF-DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLG 757          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 7.813e-82
Identity = 215/669 (32.14%), Postives = 350/669 (52.32%), Query Frame = 3
Query:  372 RDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPS--ASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            RD  C   +E++    + ++L     L+ D+NDN P F     N  I ENS  +++  LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ +TD ND+ P F ++    + PE+   G ++ Q+ ATD DI     I  S S   S+     F + A  G+I+ K  L     + ++++ ++A D G   + A + VLV+VTD+NDN P I+I    +  N+ +VL+EN   N+ IA +TV+DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   +VSI EN   G ++T++ A D D G NA+I Y+L P+    F++D  +GM+T     DRE + +Y     A D+ +  + S++T+ V+I+D+NDN P F    ++F++ ENL   G +G +   D D G N+ +   + + +  F I     +      + DRE+ + Y+  + A D G    +SS  V I + D+NDN P FI P       L +  T  GT +F   A+DNDTG NA++ Y+I    ++ +F I+   G+I L +      +   ++++ A D G
Sbjct:  102 RDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDR-EETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV--FSNQ--FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF-DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLG 757          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6WXV7|PC11X_PONPY (Protocadherin-11 X-linked OS=Pongo pygmaeus OX=9600 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.497e-81
Identity = 221/708 (31.21%), Postives = 363/708 (51.27%), Query Frame = 3
Query:  258 FQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQ-YNYNRDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPS--ASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            F+  ++  D  +  ++    E   T  + D  K      RD  C   +E++    + ++L     L+ D+NDN P F     N  I ENS  +++  LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ +TD ND+ P F ++    + PE+   G ++ Q+ ATD DI     I  S S   S+     F + A  G+I+ K  L    +  ++++ ++A D G   + A + VLV+VTD+NDN P I+I    +  N+ +VL+EN   N+ IA +TV+DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   +VSI EN   G ++T++ A D D G NA+I Y+L P+    F++D  +GM+T     DRE + +Y     A D+ +  + S++T+ V+I+D+NDN P F    ++F++ ENL   G +G +   D D G N+ +   + + +  F I     +      + DRE+ + Y+  + A D G    +SS  V I + D+NDN P FI P       L +  T  GT +F   A+DNDTG NA++ Y+I    ++ +F I+   G+I L +      +   ++++ A D G
Sbjct:   63 FKLVYKTGDVPLTRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETP-NHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV--FSNQ--FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF-DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLG 757          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.664e-81
Identity = 215/669 (32.14%), Postives = 350/669 (52.32%), Query Frame = 3
Query:  372 RDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPS--ASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            RD  C   +E++    + ++L     L+ D+NDN P F     N  I ENS  +++  LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ +TD ND+ P F ++    + PE+   G ++ Q+ ATD DI     I  S S   S+     F + A  G+I+ K  L     + ++++ ++A D G   + A + VLV+VTD+NDN P I+I    +  N+ +VL+EN   N+ IA +TV+DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   +VSI EN   G ++T++ A D D G NA+I Y+L P+    F++D  +GM+T     DRE + +Y     A D+ +  + S++T+ V+I+D+NDN P F    ++F++ ENL   G +G +   D D G N+ +   + + +  F I     +      + DRE+ + Y+  + A D G    +SS  V I + D+NDN P FI P       L +  T  GT +F   A+DNDTG NA++ Y+I    ++ +F I+   G+I L +      +   ++++ A D G
Sbjct:  102 RDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNMFGLDVIETPEG-DKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDR-EETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV--FSNQ--FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF-DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLG 757          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 4.238e-81
Identity = 215/669 (32.14%), Postives = 351/669 (52.47%), Query Frame = 3
Query:  372 RDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPS--ASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            RD  C   +E++    + ++L     L+ D+NDN P F     N  I ENS  +++  LP A DPD G NG   Y +  S   N F L    T +G D   +L + +  DRE  + + + +  +D G P  +S+  +++ +TD ND+ P F ++    + PE+   G ++ Q+ ATD DI     I  S S   S+     F + A  G+I+ K  L     + ++++ ++A D G   + A + VLV+VTD+NDN P I+I    +  N+ +VL+EN   N+ IA +TV+DKD  +NG+V C  D+   F L  +  F N+  + L TA  +  D E    + + ++ +D G P L  +  + + VKDENDN P+F +   +VSI EN   G ++T++ A+D D G NA+I Y+L P+    F++D  +GM+T     DRE + +Y     A D+ +  + S++T+ V+I+D+NDN P F    ++F++ ENL   G +G +   D D G N+ +   + + +  F I     +      + DRE+ + Y+  + A D G    +SS  V I + D+NDN P FI P       L +  T  GT +F   A+DNDTG NA++ Y+I    ++ +F I+   G+I L +      +   ++++ A D G
Sbjct:  102 RDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS--QNIFGLDVIETPEG-DKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDR-EETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV--FSNQ--FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF-DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLG 757          
BLAST of Protocadherin vs. TrEMBL
Match: A0A0S1VVS0 (Protocadherin-h OS=Lethenteron camtschaticum OX=980415 GN=Pcdh-h PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.841e-89
Identity = 232/745 (31.14%), Postives = 379/745 (50.87%), Query Frame = 3
Query:  195 FVRICNVKKTFPDIENPTIDNFQN--FFRLNDNNVEMLQS---LDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVA-FDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIAS--SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLE-SIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQ---TIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNF 2375
              R  N++   P +    +  ++     R+ ++  E+  +   +DRE L  +   + +  Y+       + ++ L     +  ++ ILV D+NDN PSF     N  IAEN P      L  A DPD G NG   YA+  +   N F L       G + S +L I  S DRE  E +++ L A+D G+PP +S+  +++ +TDVND+ P F QS      PE+   G  + Q+ ATD D+   + VT   S   SS     F +    GVI+ +  L    ++  YR+ ++A D G   + AT+TV V V D+NDN P + +    S  +  + LTE    N+ IA + VSD D   NG+V C+++ +  F L+ + QN EN    + +   ++  D E K+ + + ++ +D+G P +++T  + V ++DENDNPP+F       +  EN   G ++  L A D+D G NAQ+ Y L P+    F ++P +G+++     DRE ++ Y+    A D+    M+ + T+ + +LD+NDNPPKF  + F+F + ENL   G +G +   D D G+NA + + L   S +F I+    +  S   + DRE+   Y+ ++ A D G  P TS   V I I DINDN+PT + P       L +  T  GT +    A D D+GENA++ Y++       +F I+ + G+I L + L   H    ++++   D+G  P++  S + +N 
Sbjct:   48 LARDLNLRSLGPGLTYKIVSKYEGSPLVRVRNDTGELFTTATRIDREQLCPDVADEEAGCYHE------VQVVVLPNQYFRLIKVKILVEDINDNAPSFPSPVINLTIAENMPVGTRFSLQAAGDPDAGLNGIQRYAL--TDTGNAFTLEVIEGADG-EKSPQLLIRGSLDRERKEVYEMKLKAEDGGDPPRSSTAILRVTVTDVNDNHPVFEQSQIEVKIPENTPIGTPVIQLRATDADLGLNAEVTYSYSGRVSSPARRLFQLDNLTGVITVRGPLDREDTAL-YRLIVLATDRGPNPVPATATVTVSVADVNDNAPSVAVHDIISPVDGVIHLTEAAPPNTPIALIEVSDPDLEQNGRVTCRIEGDVPFQLKPAYQNHEN----QFLLETSALLDFETKNEYSVRLVATDLGSPRMSSTATVVVRLRDENDNPPVFNPGVVEATAYENNAPGAQIVTLAAGDRDSGKNAQMHYYLGPDAPPAFRLNPSTGVLSVAEPLDREERNLYRFSVIARDNGAPSMHGNATVVIRVLDQNDNPPKFNNKEFNFFLSENLPRFGTVGVISVTDADEGKNALVTFSLVGNSDIFTINPVTGMIQSNISF-DREQKPSYTFQVQAVDAGEPPKTSFAKVTIHIMDINDNAPTVLLPPSNASYRLVTPSTSPGTSVAEVMATDIDSGENAELSYSVVGGNPFNLFAIDQATGNITLTQKLLPAHQGLHRLVVRVNDAG-FPESLYSIVLVNL 776          

HSP 2 Score: 142.895 bits (359), Expect = 1.849e-30
Identity = 147/577 (25.48%), Postives = 247/577 (42.81%), Query Frame = 3
Query:  765 LTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPP------IFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPF------SGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTF--SFHIKENLEGV-LGRVEAVDKDIGQNAQMDYFLF-NPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT-IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP----PPMN 2411
            + +KI + D+ND+AP F          E++  G       A D D        +   A +   + F++   +G    K   + +  S D      Y + + A D G+P  ++T+ + V VTD+NDN P+ E         + + EN    + + ++  +D D G N +V              +   +N      V  P    DRE    ++L ++ +D G   +  T  +TV V D NDN P      I       + + E  P  T +  ++  D D+  N ++   +  +    F + P         ++ T    D E ++EY V+  A D    RM+S+ T+ V + DENDNPP F      +   + N  G  +  + A D+D G+NAQM Y+L  +  P F ++ +  +  S    LDRE  + Y   + ARD+G   +  + TV I + D NDN P F   +    L+ ++       + +    D D G+NA + +++   + IF IN   G I  N S   E        + A D+G  PKT+ + + ++ +    + P    PP N
Sbjct:  124 IKVKILVEDINDNAPSFPSPVINLTIAENMPVGTRFSLQAAGDPDAGLN---GIQRYALTDTGNAFTLEVIEGADGEKSPQLLIRGSLDRERKEVYEMKLKAEDGGDPPRSSTAILRVTVTDVNDNHPVFE----QSQIEVKIPENTPIGTPVIQLRATDADLGLNAEVTYSYSGRVSSPARRLFQLDNLTGVITVRGP---LDREDTALYRLIVLATDRGPNPVPATATVTVSVADVNDNAPSVAVHDIISPVDGVIHLTEAAPPNTPIALIEVSDPDLEQNGRVTCRIEGDV--PFQLKPAYQNHENQFLLETSALLDFETKNEYSVRLVATDLGSPRMSSTATVVVRLRDENDNPPVFNPGVVEATAYENNAPGAQIVTLAAGDRDSGKNAQMHYYLGPDAPPAFRLNPSTGVL-SVAEPLDREERNLYRFSVIARDNGAPSMHGNATVVIRVLDQNDNPPKFNNKEFNFFLSENLPRFGTVGVISV--TDADEGKNALVTFSLVGNSDIFTINPVTGMIQSNISFDREQKPSYTFQVQAVDAGEPPKTSFAKVTIHIMDINDNAPTVLLPPSN 685          
BLAST of Protocadherin vs. TrEMBL
Match: A0A210PLG8 (Protocadherin-1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12663 PE=4 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 8.767e-84
Identity = 251/870 (28.85%), Postives = 409/870 (47.01%), Query Frame = 3
Query:  270 FRLNDNNVEML--QSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKF-YQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAV-SNKFVLISPSTNQGHDSSLKLKILQ-SFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKD--ISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECK-LDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFN----PSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEP-KPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI---FYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNKKIEPKSSLSRDXXXXXXXXXXXXXFTCLLMLVTYFCASMIVQKRRQQRRMNIKDEIGNGRRNDGWFYVYCCCEPAAAASADLTTNRQCH-------KAINIPPGSTVDRKCSLPVCLNRWDKSKEIGLEEDPLYS 2798
            F +++N  ++L  +SLDR+ +       +    N       + ++  + +G  F  ++ ILV D+NDN P+FD    +  + E +      +L  A+DPD G     VY I+  ++ SN    ++ +    +  S+ L I+  + DRE  E + L ++A D G PP T S+ + + +TDVN+  P F QS Y     E      +I  V A D D  ++  V   +SP  S+ ++++F + +  GVI+ + +L+   S+  YR+ + A D     + + + V + V D ++N P I +   +  N   ++E+    + +A V V+DKD G NG V C  L++N+      IQ +E+   YK+V    +S +REV + + + + C D G P    T    V+V DENDN P F +Q     I EN  IG K   + A D D G NA + Y L+P     F + P +G I+  +  +REVQ +Y  +  A D     +  +  ++V + DENDN P F    F F+++ENL     +G V A D D+G N  ++Y L +    P+P F +  NG I  S    LDRE V+RY + + A D G+ P   S  + + + D NDN P  + P +    +++  ET Q   I T  A D D+G N+K+ +  +   I   F +N+  G IYL K L    I      +  +D G+ P   T ++ +    S  S+  P    I    S+                 T  L ++ +F   ++       RR +++      ++ D  F      + A A   DLT +R C+         I IP    +DR  SL V +   D    I   +DP+++
Sbjct:   77 FYVDENTGDLLTSESLDRDVICAFVTTGSDCYLN-------MFVIARTSTGSFFKIEIQILVIDINDNTPTFDEDVVSLSVPEGTELGTSFDLDGAQDPDSG-----VYTIQSYSINSNDSPFVAKADQFPNGQSMLLLIVNGTLDREKTESYMLHILAYDGGQPPNTGSIMVNVTVTDVNEFRPNFTQSVYNVTIMEDHDVDGSITTVQAIDPDGGVNGEVLYSLSPLQSAAVLERFRIDSTKGVITLRTSLME-DSNEGYRVIVEAYDRAKQPMMSQAQVFIKVIDNHNNVPTIRVDLLSNTNFAEISEHASQGAAVAHVAVTDKDTGANGLVVCNVLNDNF-----RIQKYEDM-EYKIVVY--TSLNREVAEEYNVTVKCDDAGTPPKHVTSTFRVLVLDENDNAPRFTQQKYFAHIRENNVIGQKAVTVTATDIDKGTNALVTYALAPTNNGRFQVQPETGQISVNIQLNREVQGQYSFQIMAVDKGTPALTGTAVVYVIVEDENDNSPTFGENHFHFYVQENLAVNTSIGIVSAYDIDLGDNGVIEYALSSLTEVPTP-FWLMENGSIMTSA--VLDREVVERYDLTMTALDRGDPPREGSAIITVHVIDDNDNGPIIMFPSETNSSVSIPYETPQNRVISTIDAYDKDSGLNSKLSFFTRDLNISEYFLLNSFSGEIYLIKRLSPSDIGMYSFEVLVQDGGMFPLYATRTMTITITDSLTSESFPRYVTIAICISV----------------ITLFLAVLLFFAIYLV-------RRNDMRKPGSFDKQVDDSFSDKTRQDEAEAGFGDLTLDRNCNVYTQQTFSVIGIPRRPPIDRSISLQVPIEH-DTPNSIHPSDDPVWT 898          
BLAST of Protocadherin vs. TrEMBL
Match: W5KV42 (Protocadherin 11 OS=Astyanax mexicanus OX=7994 PE=4 SV=2)

HSP 1 Score: 306.22 bits (783), Expect = 8.963e-84
Identity = 232/757 (30.65%), Postives = 373/757 (49.27%), Query Frame = 3
Query:  126 LFIYINILWYSNGECVVEENSPIFVRICNVKKTF-----PDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCD----TSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            L   +++ W    +  V+E  P  VRI N++        P+I+  +   F+  ++  D  +  +++   E   T  + D     S  +N  R    I +  L     +  ++  L+ D+NDN P F     N  I EN+  +N   +P A DPD G NG   Y +  S   ++F L    T +G D   +L + Q+ DRE  + F + +  +D GNPP +S+  +++ ++DVND+ P F  S    N PE+   G ++ Q+ ATD D+ S   I  S S       K   A D   G+I+ K  L   S+     I + +  S  P   + +TV+V+VTD+NDN P I+     +  N  ++L+EN   N+ IA +TV+D+D   NG+V C  D++  F L+ + N      + L TA  +  D E    + + I+ SD G P L T+  + + +KDENDN P+F +    +SI EN   GT++ ++ A D D G NA I Y L P+  + FNIDP SG+++     DRE Q +Y     A D+    + S++T+ + + D+NDN P F    ++F++ ENL   G +G +   D D G NA +   + N    F I     + +      DRE+   Y+  + A D G    TS   V I + D+NDN P F+ P      +L    T  G+ +    AIDNDTG NA++ Y+I     + +F I+ + G+I L + + +      ++++  +D G
Sbjct:   54 LTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSV--SEFGLDIIETPEG-DKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATP---SRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFN----DQFLLETA--APLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGV-IKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLG 797          
BLAST of Protocadherin vs. TrEMBL
Match: K1R9J3 (Protocadherin-11 X-linked OS=Crassostrea gigas OX=29159 GN=CGI_10016336 PE=4 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 1.166e-83
Identity = 240/789 (30.42%), Postives = 395/789 (50.06%), Query Frame = 3
Query:   96 RMKTWMTLVSLFIYINILWYSNGECVVEENSPIFVRICNVKK--TFPDIENPTIDNFQ------NFFRLNDNNVEML--QSLDRENLITNQKCDTSKQYNYNRDSQCIL--ILELSGSGPKFYQLPILV--ADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKD--ISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFS-FHIKENLEG--VLGRVEAVDKDIGQNAQMDYFLFNPS----PLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEP-KPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI---FYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFI 2378
            R++ W  L+SL + ++ L  +     +EE +   V + NV +     ++ NPT   FQ       +F + ++  E+    ++DR+ +   Q              QC+L  +   S     F+++ I V   D+NDN P+F +   + +I+E++  +    L  A D D GNN    Y I PS  S  F   +   + G  S LKL + Q+ DRE    + + ++A D G PP T S+T+ I + D+ND+ P F++ SY     + +     + + FA+DKD  I+  V   + P  +  I   F + +  G I  K +L+   S  +Y I I A D GN  L + S V V V D ++N P+I +   + ++   ++E+    + +A V V D D G NG V C + ++Y      IQ FE    YK+V    +S +RE++D++++ + C D G P   T     V+V DENDNPP F RQ  + +ILEN  I   +  + A D DIGVNA ++Y +S E     +ID  SG +  +++ DRE  S+      A D   + +  + T+++ + D NDN P +    S F + EN+    V+G V A DKD G N+++ ++L   +    P FE+  NG + V+  R LDRE V  Y ++I A D G+   T  + ++I+++D NDN P FI P +  + + + + T Q T + T  A D DT  NA++ Y    Q +   F IN++ G + + ++L  + +      +  +D    P +   +L +N I
Sbjct:    5 RVQCW-CLMSLVLQVHALEVTYN---LEEETKRGVLVGNVAEDAGLSNVNNPTFSLFQAGYPAAKWFSITEDLGELHTNATIDRDTICEFQD-------------QCVLNLVAVASTEDGDFHKIKIYVNIIDINDNSPTFSKSVVSLQISEDTAINFSYSLEGAVDLDTGNNSVERYEI-PSHDS-PFHTAADKFSDGR-SMLKLILKQTLDRETHPSYLIQVVAYDGGTPPKTGSMTVNITVGDINDNYPIFSKPSYNVTIMDDLPVESVVVKTFASDKDEGINGEVQYRLDPRQTEDIFQIFHMNSTTGEIYLKESLIS-GSRENYNILIEATDLGNQPLISKSQVFVRVQDNHNNFPVINVNVLSGSDTAEVSEHASQGTVVAHVAVKDPDTGANGLVTCDVISDYF----KIQKFE-ENEYKVVVF--ASLNREMRDNYEVTVNCRDAGSPPRETNFTFPVIVVDENDNPPRFERQTYNANILENNDIDISLLTVSATDDDIGVNADLRYSVSGEAQNLASIDALSGSLRLKIALDREQHSQISFYVYATDSGDVPLTGTATVNIIVKDANDNAPTYPDKISTFVVTENIAAPRVIGTVSAFDKDDGINSEVRHYLMTSNTGELPPFEVKENGTVLVT--RSLDRETVALYELQIMAMDRGSPAKTGYSFIKILVEDTNDNKPIFIFPSEANRSITVPLSTAQNTVVATLTASDGDTDVNAQLRYYTDDQNMTETFVINSATGEVIVARALDSDDLGLYVFKVKVQDWSSNPLSAEETLLINVI 763          
BLAST of Protocadherin vs. TrEMBL
Match: A0A3B1ISQ5 (Protocadherin 11 OS=Astyanax mexicanus OX=7994 PE=4 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 8.335e-83
Identity = 232/757 (30.65%), Postives = 373/757 (49.27%), Query Frame = 3
Query:  126 LFIYINILWYSNGECVVEENSPIFVRICNVKKTF-----PDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCD----TSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIA--SSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            L   +++ W    +  V+E  P  VRI N++        P+I+  +   F+  ++  D  +  +++   E   T  + D     S  +N  R    I +  L     +  ++  L+ D+NDN P F     N  I EN+  +N   +P A DPD G NG   Y +  S   ++F L    T +G D   +L + Q+ DRE  + F + +  +D GNPP +S+  +++ ++DVND+ P F  S    N PE+   G ++ Q+ ATD D+ S   I  S S       K   A D   G+I+ K  L   S+     I + +  S  P   + +TV+V+VTD+NDN P I+     +  N  ++L+EN   N+ IA +TV+D+D   NG+V C  D++  F L+ + N      + L TA  +  D E    + + I+ SD G P L T+  + + +KDENDN P+F +    +SI EN   GT++ ++ A D D G NA I Y L P+  + FNIDP SG+++     DRE Q +Y     A D+    + S++T+ + + D+NDN P F    ++F++ ENL   G +G +   D D G NA +   + N    F I     + +      DRE+   Y+  + A D G    TS   V I + D+NDN P F+ P      +L    T  G+ +    AIDNDTG NA++ Y+I     + +F I+ + G+I L + + +      ++++  +D G
Sbjct:   54 LTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSV--SEFGLDIIETPEG-DKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATP---SRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFN----DQFLLETA--APLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGV-IKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLG 797          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 306.22 bits (783), Expect = 3.395e-87
Identity = 232/757 (30.65%), Postives = 373/757 (49.27%), Query Frame = 3
Query:  126 LFIYINILWYSNGECVVEENSPIFVRICNVKKTF-----PDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCD----TSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEI--ASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            L   +++ W    +  V+E  P  VRI N++        P+I+  +   F+  ++  D  +  +++   E   T  + D     S  +N  R    I +  L     +  ++  L+ D+NDN P F     N  I EN+  +N   +P A DPD G NG   Y +  S   ++F L    T +G D   +L + Q+ DRE  + F + +  +D GNPP +S+  +++ ++DVND+ P F  S    N PE+   G ++ Q+ ATD D+ S   I  S S       K   A D   G+I+ K  L   S+     I + +  S  P   + +TV+V+VTD+NDN P I+     +  N  ++L+EN   N+ IA +TV+D+D   NG+V C  D++  F L+ + N      + L TA  +  D E    + + I+ SD G P L T+  + + +KDENDN P+F +    +SI EN   GT++ ++ A D D G NA I Y L P+  + FNIDP SG+++     DRE Q +Y     A D+    + S++T+ + + D+NDN P F    ++F++ ENL   G +G +   D D G NA +   + N    F I     + +      DRE+   Y+  + A D G    TS   V I + D+NDN P F+ P      +L    T  G+ +    AIDNDTG NA++ Y+I     + +F I+ + G+I L + + +      ++++  +D G
Sbjct:   54 LTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSV--SEFGLDIIETPEG-DKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATP---SRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFN----DQFLLETA--APLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGV-IKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLG 797          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 306.22 bits (783), Expect = 3.157e-86
Identity = 232/757 (30.65%), Postives = 373/757 (49.27%), Query Frame = 3
Query:  126 LFIYINILWYSNGECVVEENSPIFVRICNVKKTF-----PDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCD----TSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIA--SSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            L   +++ W    +  V+E  P  VRI N++        P+I+  +   F+  ++  D  +  +++   E   T  + D     S  +N  R    I +  L     +  ++  L+ D+NDN P F     N  I EN+  +N   +P A DPD G NG   Y +  S   ++F L    T +G D   +L + Q+ DRE  + F + +  +D GNPP +S+  +++ ++DVND+ P F  S    N PE+   G ++ Q+ ATD D+ S   I  S S       K   A D   G+I+ K  L   S+     I + +  S  P   + +TV+V+VTD+NDN P I+     +  N  ++L+EN   N+ IA +TV+D+D   NG+V C  D++  F L+ + N      + L TA  +  D E    + + I+ SD G P L T+  + + +KDENDN P+F +    +SI EN   GT++ ++ A D D G NA I Y L P+  + FNIDP SG+++     DRE Q +Y     A D+    + S++T+ + + D+NDN P F    ++F++ ENL   G +G +   D D G NA +   + N    F I     + +      DRE+   Y+  + A D G    TS   V I + D+NDN P F+ P      +L    T  G+ +    AIDNDTG NA++ Y+I     + +F I+ + G+I L + + +      ++++  +D G
Sbjct:   54 LTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSV--SEFGLDIIETPEG-DKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATP---SRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFN----DQFLLETA--APLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGV-IKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLG 797          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 305.449 bits (781), Expect = 3.553e-86
Identity = 233/758 (30.74%), Postives = 374/758 (49.34%), Query Frame = 3
Query:  126 LFIYINILWYSNGECVVEENSPIFVRICNVKKTF-----PDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCD----TSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYA-IKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIA--SSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            L   +++ W    +  V+E  P  VRI N++        P+I+  +   F+  ++  D  +  +++   E   T  + D     S  +N  R    I +  L     +  ++  L+ D+NDN P F     N  I EN+  +N   +P A DPD G NG   Y  +K  A+  +F L    T +G D   +L + Q+ DRE  + F + +  +D GNPP +S+  +++ ++DVND+ P F  S    N PE+   G ++ Q+ ATD D+ S   I  S S       K   A D   G+I+ K  L   S+     I + +  S  P   + +TV+V+VTD+NDN P I+     +  N  ++L+EN   N+ IA +TV+D+D   NG+V C  D++  F L+ + N      + L TA  +  D E    + + I+ SD G P L T+  + + +KDENDN P+F +    +SI EN   GT++ ++ A D D G NA I Y L P+  + FNIDP SG+++     DRE Q +Y     A D+    + S++T+ + + D+NDN P F    ++F++ ENL   G +G +   D D G NA +   + N    F I     + +      DRE+   Y+  + A D G    TS   V I + D+NDN P F+ P      +L    T  G+ +    AIDNDTG NA++ Y+I     + +F I+ + G+I L + + +      ++++  +D G
Sbjct:   14 LTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKVGAL--EFGLDIIETPEG-DKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATP---SRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFN----DQFLLETA--APLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGV-IKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLG 758          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 269.24 bits (687), Expect = 1.126e-74
Identity = 220/715 (30.77%), Postives = 363/715 (50.77%), Query Frame = 3
Query:  267 FFRLNDNNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQC---ILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTI--MMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIAS--SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLH 2366
              R+  N  E+  + +R   I  +K      Y    DS+C   I ++ L     +  ++ I+V D NDN P F     N  I EN+  ++   +P A DPD G N   VY  +     + F L    T +G +   +L + Q+ DRE  + + + +  +D G+P  +S+  +++ +TDVND+ P F +S    + PES   G ++ Q+ ATD D+ +   I  M     S      F++ +  G+I+ +  L    ++ ++++ ++A D  +   +A +TV ++VTD+NDN P I++    S  N  ++L+E    N+ IA +TVSDKD   NG+V C ++ +  F+L+++  ++N+  Y L T+  +  D E    +   I+ SD G PSL  T  + V ++DENDNPPIF +    +++ EN      +T + A D+D G NA+I Y L P     F++D  +G++T    FDRE Q  +    TA D+    + S   + VTILD+NDN PKF    F F + ENL     +G +   D D G+NA +   + N +  F +     +  S   + DRE+   Y+ ++ A D G+ P +S+  V I + D+NDN P  I P       L  +  I G+ +    A+D DTG NA++ YTI    ++ +F I+   G+I L +   +      +++++  D G  PK    SLH
Sbjct:   75 LLRVMSNTGEIFTTSNR---IDREKLCPGPSY---EDSECSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNS--VYKYELVNGQSAFGLDIVETPEG-EKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETA-NHKLSVLASDGSSS--SARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAV--YDNQ--YLLETS--ALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNA-SFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNENFILDPYTGVIKSNVSF-DREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLG-YPK----SLH 764          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:103034658])

HSP 1 Score: 271.552 bits (693), Expect = 1.187e-74
Identity = 237/796 (29.77%), Postives = 377/796 (47.36%), Query Frame = 3
Query:  174 VEENSPIFVRICNVKKTFPDIENP-----TIDNFQNFFRLNDNNVEML---QSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPK-----FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYA-IKPSAVSNKFVLISPSTN-----------QGHDSSLKLKILQ--------------SFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGV-----ISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQ----NNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFE---NRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRN-GDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHL 2369
            + E  P  VR+ NV      +        T+++  ++F++++   ++    + +DRE L   Q+C    Q  ++ +++C +  E+S  GP       ++  +++ D+NDN PSF        + EN P      LP A D D G NG   Y  I+  A S+   L S ST+           Q   S  +L++                + DRE  + ++L L  +D G+P  +S   +++ ITDVND++P+F +S Y  + PE+   G  I Q+ A D D+            + QI   F  A + V     +      + V    D       R  ++A D G P  T  +T+++++ D NDN P I+I    +    +    + E+   ++ IA V VSD+D G NG V C +  +  F L+     E   N++ Y L T  ++  D E    + + I+  D G PSL++   + V V D NDNPPIF +    VS  EN   G +V  + A+D D G NA+I Y L       F+ID  SG I      DRE    Y+ K  A D  +  M  S T+ V + D+NDN PKF++  F+F++KENL+    +G V  +D D GQNA+M  ++     +F I  N G IF +     DRE+   YS  + A D G+ P +++ TV + + D NDN P+   P    +  L   +   T + T  A D DTG NA + Y+I       +F I+   G I L   L+ +H    ++++   DSG+  ++TT+ +H+
Sbjct:   34 LAEEGPADVRVGNVAADLGIVAGSGEVTFTLESGSDYFKIDNITGDLSTNERRIDREKL---QQC----QMIFD-ENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDGAESSVRRLGSASTDAHSGKRRFDDAQSRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPARSSQAILRVMITDVNDNSPRFEKSVYEADLPENSSPGAPILQLKAMDADVG----------VNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKTDKATMIINIKDENDNVPNIDIRKIGRIYLRDGVANVAEDVVVDTPIALVQVSDRDKGPNGVVTCTVVGDVPFQLKPASEIEGDMNKKKYFLHT--SAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDINDNPPIFTKSTVEVSFPENNAPGERVATVVALDADSGKNAEIFYSLDSSVNGIFSIDADSGDIRVNTILDREQTERYEFKVIAKDKGVPVMQGSATVVVLVADKNDNEPKFMQDVFTFYVKENLQPNSPVGMVTVMDSDKGQNAEMSLYIEEEEEIFSIENNTGTIFSTVA--FDREQKTTYSFRVKAVDGGDPPRSATATVSLFVMDENDNPPSVTFPINSSYTLLPPSSNIRTVVRTVIATDTDTGVNADLSYSIIGGNPFKLFEIDPDTGVISLVSKLEQKHFGLHRLVVQVNDSGVPSQSTTTLVHV 807          

HSP 2 Score: 95.9005 bits (237), Expect = 1.602e-19
Identity = 90/340 (26.47%), Postives = 152/340 (44.71%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVAL-VYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKD 1454
            + V D+NDN P F + T      EN+     V   +A D D G N  + Y++  S+V+  F + + S +        +++    DRE  E ++  +IAKD G P +  S T+ + + D ND+ P+F Q  + F   E++     +G V   D D        MS     +          G I + VA      +++ +R+   AVD G+P  +AT+TV + V D NDN P +    ++    L  + N ++   +  V  +D D G N  +   +     F L     FE      +++   S  +++    H+L +  +D GVPS +TT  + V V +
Sbjct:  493 VKVGDINDNPPIFTKSTVEVSFPENNAPGERVATVVALDADSGKNAEIFYSLD-SSVNGIFSIDADSGD--------IRVNTILDREQTERYEFKVIAKDKGVPVMQGSATVVVLVADKNDNEPKFMQDVFTFYVKENLQPNSPVGMVTVMDSDKGQNAE--MSLYIEEEEEIFSIENNTGTIFSTVAFDREQKTTYSFRVK--AVDGGDPPRSATATVSLFVMDENDNPPSVTFPINSSYTLLPPSSNIRT--VVRTVIATDTDTGVNADLSYSIIGGNPFKL-----FEIDPDTGVISL-VSKLEQKHFGLHRLVVQVNDSGVPSQSTTTLVHVYVNE 811          

HSP 3 Score: 70.8626 bits (172), Expect = 7.523e-12
Identity = 66/251 (26.29%), Postives = 103/251 (41.04%), Query Frame = 3
Query: 1752 VTILDENDNPPKFLR-TFSFHIKENLE-GVLGRV-EAVDKDIGQNAQMDYFLFNPSPLFEISRNG----DIFVSQKRY-------------------------------LDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT-----IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNF 2375
            V ILD NDN P F     +  ++EN   G L  +  A D+D G+N    Y L        + R G    D    ++R+                               LDRE+ D Y + +  RD G+   +S   + ++I D+NDNSP F   K     +L   +  G  I   KA+D D G N +I Y   + T     +  ++ S G + +   +  E +   +  + ARD G  PKT  +++ +N 
Sbjct:  127 VIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDGAESSVRRLGSASTDAHSGKRRFDDAQSRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPARSSQAILRVMITDVNDNSPRF--EKSVYEADLPENSSPGAPILQLKAMDADVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKTDKATMIINI 375          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 253.832 bits (647), Expect = 2.324e-70
Identity = 224/735 (30.48%), Postives = 350/735 (47.62%), Query Frame = 3
Query:  210 NVKKTFPDIENPTIDNFQNFFRLNDNNVEMLQS---LDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPS--AVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDK-------FSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIAS--SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLE---SIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLFNPS--PLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGI 2336
            N++ T+  + +   D      R+N    E+  +   +DRE L   Q  D   + +   D Q  ++    G   K  ++ I V D+NDN P+F        + EN+PA     +  A DPD   NG   Y + PS  A  + F L    T  G      L + +S DRE  + +++ L A D G+PP + S  ++I++TD ND++P F+Q+      PE+   G  + Q+ A+D+D  S   ++     S+            F +  +  + T   L+    S  YRI I+A D G   + AT+TV V VTD+NDN P IEI    +  N  + ++E    N  +A +TVSD D G NG V C     Y++N E    ++       Y L T  T   D E K+ + + I  +D G  SL+ T  +T+ + D NDN P+F      VS+ EN  IG  +  + A D+D+  NA++ Y L P+    F++DP +G+I+     DRE ++ Y     A D  I  +  + T+ V +LD NDN P+F L  F F++ EN+     +G V   D D G+N ++   +       LF I     +  S   + DRE+   Y +E+ A D G    +S+  V I + DINDNSP  + P         +  T+ GT +    A+DND   NA++ Y I       +F+I+   G+I L + L + H    ++++   D GI
Sbjct:   66 NLELTYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALCGGQ--DPGDECHV--DVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPY-LVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTC-----YIYNPEVPFQLKKLTYPNQYLLETRET--LDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGF-DREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGI 787          

HSP 2 Score: 119.013 bits (297), Expect = 2.037e-27
Identity = 121/470 (25.74%), Postives = 203/470 (43.19%), Query Frame = 3
Query: 1089 VLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL-----DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN---------FNIDPFSGMITTRVSFDREVQSEYKVKATAYDH--------------LILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISR---NGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI--QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            V ++V DINDN P    A +     + + EN  +         +D D   NG    +L          F L   +     +   LV     S DRE +  +++N+   D G P  + +  + + V D NDN P+F +   +V I EN P+GT V +L A D+D G NA++ Y L                F +D  SG++T     +RE    Y++   A D               +    ++S TI +  +    N   ++   S H+  NL   L  +   D DIG N  +  +++NP   F++ +        +  +  LD E  + Y ++I A D G   L+ + +V I + D NDN+P F EP     +++    + G  + T  A D D  +NA++VY +   + T+F+++   G I L + L  E        I A+D GI      +++ +N +    ++P
Sbjct:  139 VRINVEDINDNAP----AFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVV--RKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEAS-HV--NLPVAL--ITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPT--YKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRP 595          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.935 bits (559), Expect = 2.417e-59
Identity = 200/740 (27.03%), Postives = 325/740 (43.92%), Query Frame = 3
Query:  309 LDRENLITNQKCDTSKQYNYNRDSQCILILELSGSG-PKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISP-------------------STNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYR-FNTPESIVQGQAIGQVFATDKDISSRVTIMMS-PSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQ----NNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHE--------SVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLS-----PECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-------FSFHIKE--NLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDI---FVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAI---DNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQ--DEHILPDKIIISARDSG 2333
            LDRE L   +  D  +   +    Q   + +  GS   +   + +LV D+ND+ P+F     N  I+E+      V LP A DPD G N    Y I  SA S   + + P                       GH + L+L+  +  DRE    ++L+L  +D GNP L+ S+ + I + D ND+AP F     R     E    G ++ Q+ A D D      I  S  +  + +  + ++  DG  +T +  V  +   D      +R+ ++A D G  + +A+ TV V + D NDN P+ E+ +       +  + + EN  S + +  ++VSD D G++G V+ +L+      L S     N+  + L T  T   D E    + ++++ +D G P L+    + + V D NDN P+F              VS+ EN P GT V  L A D D G N  I + LS         E F+++  +G +T     DRE +  Y++   A D    +  +   + VT+LDENDN P F+         + F ++E  ++   +G V   D D G NA++   L   +    I   GD     V     LDRE   +Y + + A D G   L++S  V I + D NDN+P    P         + T     +    ++   D D G+N + +Y I     + IF +N   G++ L +++   DE +   ++++  RD G
Sbjct:   89 LDREALCMEEP-DACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRI--SAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELR--EQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDG--TTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELAS----PNKVQFLLKT--TRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWK-HVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGL--HRLVVRVRDRG 812          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.55 bits (558), Expect = 2.979e-58
Identity = 202/700 (28.86%), Postives = 327/700 (46.71%), Query Frame = 3
Query:  369 NRDSQCILILELS----GSGPK--FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKD-HGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSP-ECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEI-SRNGDIFVSQKRYLDRERVDR------YSIEIGARDHGN-RPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            +R+    ++L +S    G+ PK  +  L + + DVND  P F +  +     ENS     V    A D D G NG+V Y   P   +    +    +  G     K+  L+S DRE  EE+ L++ A+D G+PPL S+  + + + D+ND+ P F    Y  +  E+   G A+  V ATD D  +  T+    +A      +F V A  G +ST+V+L     +  Y++ + A+D G+    + + V + V D  D  P      +  +   V+ EN    + +  V+ S  D + N   +    D    F++E           ++ TA  ++ DRE +  +QL ++ +  GV    +   ++V+V D N++ P+F R    VSI E+ P+ ++   ++A DKD G N ++KY +      E F I P  G +  R   DRE + EY +  +A D  +  ++SS+T++VT+LD NDN P F   ++ FH  E  E   ++G V+A D D G N  + Y    P   FE+ S  G I  +  R  DRE + R      +S  + A D G  +PL    TV++ + D+NDN P F   K     ++S      T++    A D D G N  + Y I        F ++ S G I L  SL  E      +++SA DSG  P   + ++ +  +    + P
Sbjct:  405 DREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTG-----KVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAA--RFQVNAVTGAVSTRVSLDREERAV-YQLQVTALDGGHLRARSPAIVTITVADAQDTPPTF----ARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGG-------RIFTA--NAIDREEQAFYQLRVVANSGGVAGEAS---VSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFP-DGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRI--ASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFA--KSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPP 1075          

HSP 2 Score: 216.083 bits (549), Expect = 3.815e-57
Identity = 210/742 (28.30%), Postives = 339/742 (45.69%), Query Frame = 3
Query:  258 FQNFFRLND--NNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGP--KFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGV-ISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLS-PECLENFNIDPFSGMITTRVSFDREV------QSEYKVKATAYDHLILR-MNSSITIHVTILDENDNPPKFLRT-FSFHIKE---NLEGVLGRVEAVDKDIGQNAQMDYFL--FNPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKI----FTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPP 2402
            ++  FRL+     V  L+SLDRE L         ++Y        ++  +  GS P     ++ ++V D+NDN P F  + +   I EN P    V    A DPDRG NG+V Y +  +  + +F        Q +  +  +    S DRE    +QL + A D G+    S   + I + D  D  P F +  Y F   E++  G  +G V A+  D+++ VT ++    S      FS+ + G  I T  A+     +F Y++ ++A +SG     A+ +VLVH  D+N++ P+ + AS      + + E+   NS    V  +DKD G NG+V+ ++        E    F + + Y          DRE ++ + L +   D GV  L+++  + V V D NDN P+F          E   +G+ V  ++A D D G N  + Y    P+   NF +D  +G I +   FDRE        + +     A D    + +    T+ V + D NDNPP+F ++ +   + E   NL  +L RV A D D G N  + Y +   N    F + +  G I +     LDRE    Y++ + A D G  PL +S TV + + D NDN P F E        LS++ ++ T++     T  A D DTG +  + Y I    +   F I+ S GS++L + L  E     ++ +SA D G  P+++ + L ++ +R     PP
Sbjct:  493 YREMFRLDSLTGKVTTLKSLDREEL---------EEY------PLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLT-AGDAARF--------QVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLI---VSGDQRGSFSIEWSGGRIFTANAIDREEQAF-YQLRVVA-NSGGVAGEASVSVLVH--DVNNHAPVFDRASYE----VSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGN--GGEKFGIFPDGQLYVRY-----ELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQV--NFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLL-RVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGS--LDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESL------LSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVH-VRDFNDNPP 1180          

HSP 3 Score: 204.912 bits (520), Expect = 1.058e-53
Identity = 198/679 (29.16%), Postives = 302/679 (44.48%), Query Frame = 3
Query:  369 NRDSQCILILEL---SGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD-----GVIST-----KVALVYVSSSFDYRIPIIAVDSGNPT-LTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPT------SSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSF-HIKENLEGVLG----RVEAVDKDIGQNAQMDYFL---FNPSPLFEIS-RNGDIFVSQKRYLDRERVDR-YSIEIGARD-----HGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDE 2288
            +R+ Q    L +   SG       + +LV DVN++ P FDR ++   IAE+ P ++      A D D G NG V Y I       KF +             +L +    DRE  EE+ L + A D G  PL+SS+T+ + + DVND+ P FN SSY F+  E    G  +G V ATD D  S   +  S        +K  V F+     G I++     + AL+    +  +   ++A D G P  L   +TV V V D+NDN P  + A S    +  ++E+  + + + +VT SD D G NG +   +            N  N      V A T       S DRE    + L +  +D G   L  +  + V V DENDNPP F     SV  LE+  +G  +  L A D+D G +  ++Y +++      F ID  +G +      D E Q  Y++  +A D      +S+  + V + D NDNPP FL    F  I EN+   +G     V A D D   N ++ Y +   F P   F I   +G+I  + +  +DRE     + + + A D     H  R  ++   V +++ D NDN+P F+ P     L   +    G+ + T +A D D  ENA + Y +    +  +F ++   G I  +  L  E
Sbjct:  720 DREEQAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDG---------QLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYS-------FEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPP--QFAKSVY--QASVSESASNLTQLLRVTASDVDEGVNGALRYAI------------NEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIP--IGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAE--IDREVTGGLFEVTVRATDKAIPVHTRR--SALKNVTVLVTDENDNAPRFVTPT--AILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDRE 1358          

HSP 4 Score: 203.371 bits (516), Expect = 3.092e-53
Identity = 193/669 (28.85%), Postives = 305/669 (45.59%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDR---LTFNFKIAENSPAHNEVELPLARDPDRGNNG--SVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLV-LTENCQSNSYIAKVTVSDKDHGN-NGQVECKLDNNYLFNLESIQNFENRRHYKL---------VTAPTSSFDREVKDHHQLNIICSDMGVP-SLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT--FSFHIKENLEGV-LGRVEAVDKDIGQNAQMDYFLFNPS------PLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIET-IQGTKIFTAKAIDNDTGENAKIVY--TIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            ++ ++V DVNDN PSF     +   FK  E++    +V L  A D D G NG     Y I       + V   P T +     L L      DRE +  + L + A+D G+P     L + + + D ND+ P F + +YR +  E    G A+       +D+  R                 +V FD   G++ST+  L +  +   Y + + A D GNP L+  +T ++ + D+NDN P I         R   + E+    +  A VTV+D D    NG++             SI     R H+ L         V    S  DRE    + L I+ SD G P + + T  + V V D ND+ P F     + ++ E  P G+ V  + A+D D G+NA+++Y ++S   L  F++D  +G++TT    DREV S   +  +A D       +  ++ VT+LD ND PP F +T   +  ++ +L G+ +  V A D D+G+N  + Y  F+P        +F + S  G   V+  + LDRE ++ Y + + A+D G+ PL S+  V +++ D+NDN P F    P Q+    +E    GT + T  A D D G N  + Y  T      F +N   G++    SL  E     ++ ++A D G
Sbjct:    8 EVRVVVGDVNDNAPSFPEPGVMEVAFK--EDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAF---LHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-------RDLLHRG------------RGPLAVPFDPKTGMVSTRQPLDF-EARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSV-----------SIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYN-FDPDMPAQYREMFRLDSLTGK--VTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFY---PVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGG 634          

HSP 5 Score: 200.675 bits (509), Expect = 2.590e-52
Identity = 199/701 (28.39%), Postives = 316/701 (45.08%), Query Frame = 3
Query:  402 LSGSGPKFYQLPILVADVNDNVPSFDRLTF------NFKIAENSPAHNEVELPLARDPDRGN-NGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNP-PLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-------AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLT--ENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNY------LFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLE-GVL-GRVEAVDKDIGQNAQMDYFLFNPSPLFEIS---RNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI------QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            LSG      QL     DVNDN P+  R  +      +  + E++       L    D D    NG +  +I        FVL +P    G      LK+    DRE    + L ++A D G P   +++ ++ + + DVNDHAP+F  S+Y     E    G  +  V A D D      +  S   S   +  FSV         DG +  +VA   V       + I A D G    TA +++ V + D+ND  P+          + V T  EN     ++  V+ +D D G NG V    D +       +F L+S+         K+ T    S DRE  + + L +   D G P L +T  +TVVV D NDN P+FY      SILEN P GT VT + A D D G N  ++Y L+      F ++  +G ++TRVS DRE ++ Y+++ TA D   LR  S   + +T+ D  D PP F R  +SF + EN+  G L G V A   D+  NA + Y + +       S     G IF +    +DRE    Y + + A   G   +    +V +++ D+N+++P F   +    ++++ +    ++ F+ +A D D+G+N ++ Y I      +   IF     DG +Y+   L  E      + +SA D+G+ P +++ ++++  +    +KP
Sbjct:  205 LSGRATAVIQL----LDVNDNDPAI-RFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAP----GVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYS-IVSGNDLGWFSVDESTGLVTTDGKVDREVASSVV-------LNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLF------TQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTG-------KVTT--LKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLIVSGDQRGSFSIEWSGGRIFTANA--IDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVF--DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIF----PDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKP 860          

HSP 6 Score: 173.326 bits (438), Expect = 8.195e-44
Identity = 194/736 (26.36%), Postives = 327/736 (44.43%), Query Frame = 3
Query:  297 MLQSLDRENLITNQKCDTSKQYNYNRDSQCILI--------LELSGSGP-------KFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPL-ARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFN-----TPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLV--LTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGV---PSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN----------FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKEN---LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRN---GDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAI--DNDTGENAKIVY--TIQSQTIFYINTSDGSIYLNKSL----QDEHILPDKIIISARD 2327
            +L  + R + + N   D   + +++  ++C+ I        L  +G+G         F Q+ I V DVNDN P F       ++ EN+    EV   L A D D+G N  V Y++  S     FV+ +        +S  L+  +  DRE    + L + A D G     + L++ +   D ND++P+F++ +Y F+      P+       IG V A D D      VT  ++PS  S   D    AF G+     AL  V+   D      Y +   A D G   L AT+ + V+V D NDN P +      QN+ L   + E+    + + +++ +D D G N ++E  + +      +    F      +L  A   + DRE +  + L +  SD        L++   +++++ D NDN P F     +++  E+ P+G  V  ++A+D D G N+ ++Y L+ +  E           F ++  +G +      DRE +  Y +   A D     + S+ T+ VT+ D NDN P+F  R +   I E+      VL R+ A D D G N ++ Y + +  P  +   +   G + V+  R LDRER   Y + + ARD G    + + +V + + D+ND SP F       H     E  QG  +   + +  D+D G + ++ Y     +    +  + DG ++L +SL    Q +H+L    II+A D
Sbjct: 1443 LLLGVTRGHGVIN-PLDAPWRVSFDLTARCMFIVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENT-GEGEVIFTLSATDADQGQNALVTYSVL-SGSEGAFVVDA--------ASGVLRASRRLDREERASYLLTVRASD-GTHATDARLSVAV--RDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADG---AF-GLHPVTGAL-NVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSV------QNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSG-----DPEGRFAVGNDGQLSVA--RALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAP-EDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVL-RLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVA--RPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHAR---ENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVL----IITATD 2133          

HSP 7 Score: 152.525 bits (384), Expect = 2.025e-37
Identity = 152/577 (26.34%), Postives = 249/577 (43.15%), Query Frame = 3
Query:  747 PPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRP-IIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL----DNNYL---FNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYD---HLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFN-----------PSPLFEISR-NGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNF 2375
            PP++S   ++I + DVND+ P F          E+  +G+ I  + ATD D      +  S      ++     AF  V+     ++  S   D      Y + + A D  + T    + + V V D NDN P     A S         +   + + I  V   D D G  G+V   L    D+++    F L  +    N      VT P    DRE +  + L    +D G   L  T  + V V D NDN P       +  + E+ P GT + R+ A D D GVNA++++ +S    E        G ++   + DRE QS Y +     D   H   R++S++ + + + D NDN P F    S    E+  +  V+  V+AVD D G+N+ ++Y L                 F ++   G++ +   R LDRE    Y++ + A D G  PLTS+ T+ + + D NDN+P F  P+      ++ +   GT++    A D D G N ++ Y I S      F ++   G++ + + L  E     ++ + ARD G   ++ T+S+ +  
Sbjct: 1494 PPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYS------VLSGSEGAF--VVDAASGVLRASRRLDREERASYLLTVRASDGTHAT---DARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALN------VTRP---LDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRL--VRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRF--PRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTL 2044          

HSP 8 Score: 109.383 bits (272), Expect = 2.846e-24
Identity = 123/470 (26.17%), Postives = 194/470 (41.28%), Query Frame = 3
Query: 1089 VLVHVTDINDNRP------IIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENR--------RHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPP--KFL------RTFSFHIKENLEGVLGRVEAVDKD------------IGQNAQMDYFLFNPS-PLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEII--IDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQ---TIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFI 2378
            V V V D+NDN P      ++E+A           E+      +   T  D+D G NG       N++ + + S  N E R        +   L  A T   DRE    + L +   D G P       + V V+D NDNPP F +     S+ E+ P+G  +  L            +     P  +     DP +GM++TR   D E + +Y +   A D     ++   T  + +LD NDN P  +F+      R+ S         V   V   D D            +G N +  + L  P  P   + +      SQ   LDRER+  Y++ I A D+G +P+  S T  ++  ++D+ND++P F        L+       G+ +    A+D D+G NAK+ Y+I S      F ++ S G +  +  +  E      + ISA+D G  PKT  +SL +  +
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVA---------FKEDAAVGRQVLLDTAVDRDVGPNGV------NHHAYKIVS-GNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDL------------LHRGRGPLAVP---FDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLK----VASQ---LDRERIPMYNLTILASDNG-KPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPA--GSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLL 437          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 208.379 bits (529), Expect = 1.024e-54
Identity = 196/692 (28.32%), Postives = 305/692 (44.08%), Query Frame = 3
Query:  402 LSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLG-NPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDIND------NRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN-FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLG----RVEAVDKDIGQNAQMDYFLFNPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSP---------TFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI-FYINTSDGSIYLNKSLQ---------DEHILPDKIIISARDSGIIPKTTTSSLHLNFI 2378
            L+G+G     + +LV D NDN+P F        + E++P  ++V L  A D D G N  + Y ++     +    ++PST Q       +    S DRE  E + L + A D G  P L+SS T+ + +TDVNDH P+F  + Y    P S   G A+  V A D D      +  S S S+     FSV    GVI    AL       D  + +   D G P  +A +TV V   D  +                      +     +S+     V+      GN G V         F ++  Q+ E   H  L        D E + H++L +   D G P  +    + V V D NDN P F        + EN P  T V  L A+DKD G+N Q+ Y +    + N F ++P SG I +  + DRE  + Y++   A D      + ++ + +++ DENDN P+F + FS H++E  +  +G    RV  +D D G NA + + L +PS  F I    G+I VS  R L+RE    Y++++ A D      T ST V I++DD+NDN+P          F EP  G+ L           +    A D D G N ++ + ++SQT  F +    G I+  + L+           ++     +++A D G  P ++ +++ +N +
Sbjct:    6 LTGTG----TVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLR---GGDGHFSVNPSTGQ-------IITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASA--GFSVDPRRGVIHAARAL--QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDV---------FAVDP-QSGEVSVHRAL--------DHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVRE--DAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVS--RRLNREDRSGYAVKVRASDPA---WTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEAL-----------VARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIV 642          

HSP 2 Score: 170.244 bits (430), Expect = 6.730e-43
Identity = 179/684 (26.17%), Postives = 303/684 (44.30%), Query Frame = 3
Query:  369 NRDSQCILILELSGSGPKFY---QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREID-EEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATD--KDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRN---GDIFVSQKRYLDRERVDRYSIEIGARDHGN-RPL-TSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIV-YTIQSQT---IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTS 2357
            NR+ +    +++  S P +     + I+V DVNDN P F +  +  +  E S     V    A D D G NG V + ++  + +  F +   S        L+ +         +  ++  ++ A D G PPL+S  T+ I+I   N +AP+F +  Y      ++  G  I  + A D  +D++ ++   +    +S+   +F V   G +  + +L   + S  + + + A D G P L++ +T ++ VT+ N   P      ++    L L EN  + S +A+VT +D D G NG +   +   D + LF++             LV       D E +  + L++  +D G  + T    +++ V D NDNPP+         I EN P GT V  + A+D D   NA   Y L     + F ++  +G++TT+   D E +  Y++   A+++      S+  +HV I   N+  P+F+ R ++F + E+  +   +G V A D+D G +  + Y LF  S     S N   G+I VS +  LDRER    ++ + A++ G+ R        V + I D ND  P F       H  +S     GT +    A D D+    +   + IQS      F IN   G I +   L  E +    + + A D G  P T T+
Sbjct:  501 NREDRSGYAVKVRASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMR--SQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASR---RFDVDAGGFLHLRASLAGDAGSI-FSVTVEARDRGRPPLSSRATAIISVTEENQYAPRF----AHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASG-----DVLLV----GELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQ--LDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSAL--YHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTT 1160          

HSP 3 Score: 158.688 bits (400), Expect = 2.816e-39
Identity = 168/655 (25.65%), Postives = 281/655 (42.90%), Query Frame = 3
Query:  468 PSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKD--ISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRP-IIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMI-TTRVSFDREVQS--------EYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEGV--LGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLN 2372
            P F     +F   E+ P    + +  AR   R   G V Y +           + P + +       + + ++ D E    ++L++ A+D G PP ++ L +++D+ D+ND+AP+F+ S +    PE+    + I  + A DKD  I+ +V   +       I + F V  +      V+ +   +   Y + + A D G+PT   T  VL+ VTD NDN P   +I S++      + E+      + +V+  D D G N  +   L       L+    F        +T  +   +RE +  + + +  SD   P+ T +  +T+VV D NDN P F +    +   E       V R+ A D D G N Q+ + +  +  ENF +   SG I + R    R+           +Y    TA D     ++S  T+ + I+  N N P+FLR  +S  +   +     +  + AVD D   N Q+ Y +   N S  F++   G  F+  +  L  +    +S+ + ARD G  PL+S  T  I + + N  +P F  P     L+L      G+ +    A D D G N  IVY+I S     +F I+ + G + L   L  E      + + A D G   KT  S + ++
Sbjct:  230 PRFAPGPRSFSFREDQPPGTTITVVAARSSRRA--GPVSYHLASGGNLGDVFAVDPQSGE-------VSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPP-RTIVVLTAVDKDSGINGQVDYSI---IDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAH------VREDAAVGFPVLRVSTLDADEGPNAAITFSL-------LDPSLPFSIHPSTGEITV-SRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQ-TENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGG--FLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPP--LELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSIS 849          

HSP 4 Score: 157.532 bits (397), Expect = 5.612e-39
Identity = 170/666 (25.53%), Postives = 283/666 (42.49%), Query Frame = 3
Query:  456 NDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR------IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNY--LFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECL-ENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRM--NSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGR----VEAVDKDIGQNAQMDYFLF---NPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQ------SQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFI 2378
            N N P F R  ++  +A    A   +    A DPDR  NG + Y++     S +F +         D+   L +  S   +    F + + A+D G PPL+S  T  I +T+ N +AP+F       + PE+   G ++ +V ATD D      I+ S ++        S  FD  IS     V +    DY       + + A D G    T  S V + VTD+NDN P++  +    +   V+ EN  S + +  +   D D  +N      LD+    LF L       N++   L T      D E K  ++L +   +       +T  + V +   N+  P F ++  +  + E+ P+G  V  + A D+D G++  + YML  E   + F+++  +G I      DRE ++   ++  A +   +R      + ++V I D ND PP F     +H + +    +G     V A D D     +   FL    N    F I +  G I V+    LDRE V  Y++ + A D G  P T +T V + ++D+NDN P  +         ++     G  +   +A D D   N K  YT Q      +   ++  +S G +   + +  E      + ++  D+G  P T+T +LHL+ +
Sbjct:  645 NANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDV---------DAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDG-----SGLFD--ISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNAS----DYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVL-------NQKTGVLTT--QGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSAL-YHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASP--LDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLT----SSAKVTENQPAGMTVLNLEAGDPDLPPN-KGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVL 1272          

HSP 5 Score: 139.043 bits (349), Expect = 2.496e-33
Identity = 143/540 (26.48%), Postives = 229/540 (42.41%), Query Frame = 3
Query:  741 GNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKD------ISSRVT-----IMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSG-NPTLTATSTVLVHVTDIND------NRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEG-VLGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISRN-GDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI-FYINTSDGSIYLNKSLQDE 2288
            G P LT + T+ + + D ND+ P+F  +  R   PE    G  +  V ATD D      IS R+        ++PS + QI+   S+  +G  S             Y + + A+D G  P L++++T++V VTD+ND      N P +  A S+            + + +  VT  D D G NG +   L  +                 + +  P        +D   L +  SD G P  +    +TV  +D  +  P F     S S  E+ P GT +T + A                    + F +DP SG ++   + D E Q  Y++   A D      ++ + + V +LD NDN P+F  + F   + EN     +  + AVDKD G N Q+DY +   N   +F ++ N G+I       LDRE V  Y + + A D G+     +  V I + D NDNSP F +       ++  +   G  +     +D D G NA I +++   ++ F I+ S G I +++ L  E
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPS-TGQIITTASLDREGRES-------------YVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSA----------PAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGP--------RDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF-PRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEI--RSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIF---SAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNRE 503          

HSP 6 Score: 126.716 bits (317), Expect = 1.648e-29
Identity = 145/567 (25.57%), Postives = 233/567 (41.09%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMS---PSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRP-------ITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML--SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLG--RVEAVDKDIGQN-AQMDYFLFNPSPL----FEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDN 2081
            I V + N   P F        + EN PA + +    A D D G NG++VY+I     S  F +   S +        + ++   D E ++ + L + A D G    T    + I +TDVND+ P  N S Y    PE+   G  +  + A D D  S    M S     A   ++++ +    GV++T+  L Y +    Y + + A +  +    +T+ V V +T +N+  P       N     V++E+    + +  V  +D+D G +G V        LF     + F    H   +   +S  DRE +    L +I  + G     + R        + V + D ND PP+F        + E   +GT V  + A D D     +    L  S      F+I+  +G+I      DRE    Y +   A D        +  + V + D NDN P FL T S  + EN    +    +EA D D+  N     + L    P     F +S +G   +   R +DRE+   + + +   D G+ PLTS+ T+ + + D NDN
Sbjct:  743 ISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGD--------VLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKT----GVLTTQGFLDYETKQ-TYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYN----FVVSESAPVGAPVGSVFATDRDAGIDGTV-----FYMLFGESRSKGFSVNEHTGEIIV-SSQLDREREASATLRVIAKNAG-----SIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGP-FLLTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSG--LLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDN 1277          

HSP 7 Score: 125.561 bits (314), Expect = 3.274e-29
Identity = 150/565 (26.55%), Postives = 239/565 (42.30%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKIL--QSF-DREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKD--ISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR------IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLES---IQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPF---------SGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHI----KENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTV 2051
            I V DVNDN P  +   +   I EN+P+   V +  A D D  +N   +Y++     ++ FVL     NQ      K  +L  Q F D E  + ++L + A +  +    S+  + + IT VN++ P+F Q  Y F   ES   G  +G VFATD+D  I   V  M+   + S+    FSV      +     + VSS  D        + +IA ++G+        VLV+V   + N P +  +S+  + R  ++E     +++  V+  D D     +        + F ++S    + F    H  L+    S  DRE    + L ++  DMG P  T T  + V ++D NDN P       S  + EN P G  V  L+A D D+  N        P   +    DP          SG++ T    DRE + E+ +     D     + S++T+H+++LD+NDNP +  R    H+         G +G V   D DI      D     P  +F    N    +SQ R  +     R+ + +   D  + P T++  V
Sbjct:  848 ISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLD-DGEADLFVL-----NQ------KTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSK---GFSV------NEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPV-FSSALYHGR--VSEAASVGTHVVGVSAHDFDSPPGWRT-------FSFLIQSGNAGRAFSINAHTGLIVV-ASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTS--SAKVTENQPAGMTVLNLEAGDPDLPPNK------GPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSE-ARDVRVHVNYFGSPFPGGFIGDVRPRDPDISDRFNCD-LTSGPFNVFSFQPNTCRLISQPRSAE----GRFELSVRGSDGKHSPATTTARV 1366          

HSP 8 Score: 120.553 bits (301), Expect = 1.209e-27
Identity = 119/444 (26.80%), Postives = 189/444 (42.57%), Query Frame = 3
Query: 1056 SGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMG-VPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL---RTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIF--------VSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI---FYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            +G P LT T TV V V D NDN P    A      R  + E+    S +A V  +D D G N  +  +L   D ++  N  + Q         ++T  T+S DRE ++ + L +   D G  P L+++  + V V D ND+ P F           + P GT V  + A D D G N  +++ LS      F++DP  G+I    +  +  + +  +     D      ++  T+ V   D  +  P+F    R+FSF   +     +  V A  +   +   + Y L +   L      GD+F        VS  R LD E    Y + + ARD G  P ++   +E+ + DINDN+P F   +         E      I    A+D D+G N ++ Y+I    I   F +N + G I    +L  E++   ++ + A D G
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLPRFGAA----ELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQ---------IIT--TASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF-PRFAPGPRSFSFREDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNL------GDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSR---FWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRG 416          

HSP 9 Score: 110.538 bits (275), Expect = 1.640e-24
Identity = 97/335 (28.96%), Postives = 158/335 (47.16%), Query Frame = 3
Query: 1404 GVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHL-ILRMNSSITIHVTILDENDNPPKFLRT--FSFHIKENLEG-VLGRVEAVDKDIGQNAQMDYFL-FNPSPLFEIS-RNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT----IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFI 2378
            G P LT T  +TV+V+DENDN P F       ++ E+ PIG+ V  + A D D G+NA I Y L      +F+++P +G I T  S DRE +  Y ++ TA D      ++SS T+ V + D ND+ P+FL     ++       G  +  V A D D G N  + + L  + S  F +  R G I  +  R L   R D  ++ +   D G  P ++ TTV +   D  +  P F  P P +  +   +   GT I    A    +     + Y + S      +F ++   G + ++++L  E+    ++++ ARDSG  P +    L ++ +
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLR-GGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAA--RALQGPR-DDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFA-PGP-RSFSFREDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVL 327          

HSP 10 Score: 93.9745 bits (232), Expect = 1.852e-19
Identity = 93/359 (25.91%), Postives = 153/359 (42.62%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPL--TSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAP----TSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNP 1469
            Q+ + +  VN+  P F +  +NF ++E++P    V    A D D G +G+V Y +   + S  F +        ++ + ++ +    DRE +    L +IAK+ G+        + + + ITD ND  P F+ + Y     E+   G  +  V A D D             S      FS      I+    L+ V+S  D      Y + ++AVD G P  T T+ V+V + D+NDN P +  +S+       +TEN  +   +  +   D D   N          Y F L    +   R ++ L ++         DRE K    L +  +D G P LT+T  + + V D+NDNP
Sbjct:  949 QVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSV--------NEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFS------INAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAK------VTENQPAGMTVLNLEAGDPDLPPN-------KGPYTFQLLG-SDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNP 1278          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 208.379 bits (529), Expect = 1.171e-54
Identity = 196/692 (28.32%), Postives = 305/692 (44.08%), Query Frame = 3
Query:  402 LSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLG-NPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDIND------NRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN-FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLG----RVEAVDKDIGQNAQMDYFLFNPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSP---------TFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI-FYINTSDGSIYLNKSLQ---------DEHILPDKIIISARDSGIIPKTTTSSLHLNFI 2378
            L+G+G     + +LV D NDN+P F        + E++P  ++V L  A D D G N  + Y ++     +    ++PST Q       +    S DRE  E + L + A D G  P L+SS T+ + +TDVNDH P+F  + Y    P S   G A+  V A D D      +  S S S+     FSV    GVI    AL       D  + +   D G P  +A +TV V   D  +                      +     +S+     V+      GN G V         F ++  Q+ E   H  L        D E + H++L +   D G P  +    + V V D NDN P F        + EN P  T V  L A+DKD G+N Q+ Y +    + N F ++P SG I +  + DRE  + Y++   A D      + ++ + +++ DENDN P+F + FS H++E  +  +G    RV  +D D G NA + + L +PS  F I    G+I VS  R L+RE    Y++++ A D      T ST V I++DD+NDN+P          F EP  G+ L           +    A D D G N ++ + ++SQT  F +    G I+  + L+           ++     +++A D G  P ++ +++ +N +
Sbjct:    6 LTGTG----TVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLR---GGDGHFSVNPSTGQ-------IITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASA--GFSVDPRRGVIHAARAL--QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDV---------FAVDP-QSGEVSVHRAL--------DHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVRE--DAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVS--RRLNREDRSGYAVKVRASDPA---WTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEAL-----------VARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIV 642          

HSP 2 Score: 170.244 bits (430), Expect = 6.925e-43
Identity = 179/684 (26.17%), Postives = 303/684 (44.30%), Query Frame = 3
Query:  369 NRDSQCILILELSGSGPKFY---QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREID-EEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATD--KDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRN---GDIFVSQKRYLDRERVDRYSIEIGARDHGN-RPL-TSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIV-YTIQSQT---IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTS 2357
            NR+ +    +++  S P +     + I+V DVNDN P F +  +  +  E S     V    A D D G NG V + ++  + +  F +   S        L+ +         +  ++  ++ A D G PPL+S  T+ I+I   N +AP+F +  Y      ++  G  I  + A D  +D++ ++   +    +S+   +F V   G +  + +L   + S  + + + A D G P L++ +T ++ VT+ N   P      ++    L L EN  + S +A+VT +D D G NG +   +   D + LF++             LV       D E +  + L++  +D G  + T    +++ V D NDNPP+         I EN P GT V  + A+D D   NA   Y L     + F ++  +G++TT+   D E +  Y++   A+++      S+  +HV I   N+  P+F+ R ++F + E+  +   +G V A D+D G +  + Y LF  S     S N   G+I VS +  LDRER    ++ + A++ G+ R        V + I D ND  P F       H  +S     GT +    A D D+    +   + IQS      F IN   G I +   L  E +    + + A D G  P T T+
Sbjct:  501 NREDRSGYAVKVRASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMR--SQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASR---RFDVDAGGFLHLRASLAGDAGSI-FSVTVEARDRGRPPLSSRATAIISVTEENQYAPRF----AHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASG-----DVLLV----GELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQ--LDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSAL--YHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTT 1160          

HSP 3 Score: 158.688 bits (400), Expect = 2.799e-39
Identity = 168/655 (25.65%), Postives = 281/655 (42.90%), Query Frame = 3
Query:  468 PSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKD--ISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRP-IIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMI-TTRVSFDREVQS--------EYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEGV--LGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLN 2372
            P F     +F   E+ P    + +  AR   R   G V Y +           + P + +       + + ++ D E    ++L++ A+D G PP ++ L +++D+ D+ND+AP+F+ S +    PE+    + I  + A DKD  I+ +V   +       I + F V  +      V+ +   +   Y + + A D G+PT   T  VL+ VTD NDN P   +I S++      + E+      + +V+  D D G N  +   L       L+    F        +T  +   +RE +  + + +  SD   P+ T +  +T+VV D NDN P F +    +   E       V R+ A D D G N Q+ + +  +  ENF +   SG I + R    R+           +Y    TA D     ++S  T+ + I+  N N P+FLR  +S  +   +     +  + AVD D   N Q+ Y +   N S  F++   G  F+  +  L  +    +S+ + ARD G  PL+S  T  I + + N  +P F  P     L+L      G+ +    A D D G N  IVY+I S     +F I+ + G + L   L  E      + + A D G   KT  S + ++
Sbjct:  230 PRFAPGPRSFSFREDQPPGTTITVVAARSSRRA--GPVSYHLASGGNLGDVFAVDPQSGE-------VSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPP-RTIVVLTAVDKDSGINGQVDYSI---IDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAH------VREDAAVGFPVLRVSTLDADEGPNAAITFSL-------LDPSLPFSIHPSTGEITV-SRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQ-TENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGG--FLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPP--LELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSIS 849          

HSP 4 Score: 157.532 bits (397), Expect = 6.285e-39
Identity = 170/666 (25.53%), Postives = 283/666 (42.49%), Query Frame = 3
Query:  456 NDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR------IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNY--LFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECL-ENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRM--NSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGR----VEAVDKDIGQNAQMDYFLF---NPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQ------SQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFI 2378
            N N P F R  ++  +A    A   +    A DPDR  NG + Y++     S +F +         D+   L +  S   +    F + + A+D G PPL+S  T  I +T+ N +AP+F       + PE+   G ++ +V ATD D      I+ S ++        S  FD  IS     V +    DY       + + A D G    T  S V + VTD+NDN P++  +    +   V+ EN  S + +  +   D D  +N      LD+    LF L       N++   L T      D E K  ++L +   +       +T  + V +   N+  P F ++  +  + E+ P+G  V  + A D+D G++  + YML  E   + F+++  +G I      DRE ++   ++  A +   +R      + ++V I D ND PP F     +H + +    +G     V A D D     +   FL    N    F I +  G I V+    LDRE V  Y++ + A D G  P T +T V + ++D+NDN P  +         ++     G  +   +A D D   N K  YT Q      +   ++  +S G +   + +  E      + ++  D+G  P T+T +LHL+ +
Sbjct:  645 NANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDV---------DAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDG-----SGLFD--ISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNAS----DYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVL-------NQKTGVLTT--QGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSAL-YHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASP--LDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLT----SSAKVTENQPAGMTVLNLEAGDPDLPPN-KGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVL 1272          

HSP 5 Score: 139.043 bits (349), Expect = 2.700e-33
Identity = 143/540 (26.48%), Postives = 229/540 (42.41%), Query Frame = 3
Query:  741 GNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKD------ISSRVT-----IMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSG-NPTLTATSTVLVHVTDIND------NRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEG-VLGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISRN-GDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI-FYINTSDGSIYLNKSLQDE 2288
            G P LT + T+ + + D ND+ P+F  +  R   PE    G  +  V ATD D      IS R+        ++PS + QI+   S+  +G  S             Y + + A+D G  P L++++T++V VTD+ND      N P +  A S+            + + +  VT  D D G NG +   L  +                 + +  P        +D   L +  SD G P  +    +TV  +D  +  P F     S S  E+ P GT +T + A                    + F +DP SG ++   + D E Q  Y++   A D      ++ + + V +LD NDN P+F  + F   + EN     +  + AVDKD G N Q+DY +   N   +F ++ N G+I       LDRE V  Y + + A D G+     +  V I + D NDNSP F +       ++  +   G  +     +D D G NA I +++   ++ F I+ S G I +++ L  E
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPS-TGQIITTASLDREGRES-------------YVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSA----------PAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGP--------RDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF-PRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEI--RSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIF---SAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNRE 503          

HSP 6 Score: 126.716 bits (317), Expect = 1.843e-29
Identity = 145/567 (25.57%), Postives = 233/567 (41.09%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMS---PSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRP-------ITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML--SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLG--RVEAVDKDIGQN-AQMDYFLFNPSPL----FEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDN 2081
            I V + N   P F        + EN PA + +    A D D G NG++VY+I     S  F +          +S  + ++   D E ++ + L + A D G    T    + I +TDVND+ P  N S Y    PE+   G  +  + A D D  S    M S     A   ++++ +    GV++T+  L Y +    Y + + A +  +    +T+ V V +T +N+  P       N     V++E+    + +  V  +D+D G +G V        LF     + F    H   +   +S  DRE +    L +I  + G     + R        + V + D ND PP+F        + E   +GT V  + A D D     +    L  S      F+I+  +G+I      DRE    Y +   A D        +  + V + D NDN P FL T S  + EN    +    +EA D D+  N     + L    P     F +S +G   +   R +DRE+   + + +   D G+ PLTS+ T+ + + D NDN
Sbjct:  743 ISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDI--------SRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKT----GVLTTQGFLDYETKQ-TYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYN----FVVSESAPVGAPVGSVFATDRDAGIDGTV-----FYMLFGESRSKGFSVNEHTGEIIV-SSQLDREREASATLRVIAKNAG-----SIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGP-FLLTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSG--LLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDN 1277          

HSP 7 Score: 125.561 bits (314), Expect = 3.853e-29
Identity = 150/565 (26.55%), Postives = 239/565 (42.30%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKIL--QSF-DREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKD--ISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYR------IPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLES---IQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPF---------SGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHI----KENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTV 2051
            I V DVNDN P  +   +   I EN+P+   V +  A D D  +N   +Y++     ++ FVL     NQ      K  +L  Q F D E  + ++L + A +  +    S+  + + IT VN++ P+F Q  Y F   ES   G  +G VFATD+D  I   V  M+   + S+    FSV      +     + VSS  D        + +IA ++G+        VLV+V   + N P +  +S+  + R  ++E     +++  V+  D D     +        + F ++S    + F    H  L+    S  DRE    + L ++  DMG P  T T  + V ++D NDN P       S  + EN P G  V  L+A D D+  N        P   +    DP          SG++ T    DRE + E+ +     D     + S++T+H+++LD+NDNP +  R    H+         G +G V   D DI      D     P  +F    N    +SQ R  +     R+ + +   D  + P T++  V
Sbjct:  848 ISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLD-DGEADLFVL-----NQ------KTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSK---GFSV------NEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPV-FSSALYHGR--VSEAASVGTHVVGVSAHDFDSPPGWRT-------FSFLIQSGNAGRAFSINAHTGLIVV-ASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTS--SAKVTENQPAGMTVLNLEAGDPDLPPNK------GPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSE-ARDVRVHVNYFGSPFPGGFIGDVRPRDPDISDRFNCD-LTSGPFNVFSFQPNTCRLISQPRSAE----GRFELSVRGSDGKHSPATTTARV 1366          

HSP 8 Score: 120.553 bits (301), Expect = 1.242e-27
Identity = 119/444 (26.80%), Postives = 189/444 (42.57%), Query Frame = 3
Query: 1056 SGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMG-VPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL---RTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIF--------VSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI---FYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            +G P LT T TV V V D NDN P    A      R  + E+    S +A V  +D D G N  +  +L   D ++  N  + Q         ++T  T+S DRE ++ + L +   D G  P L+++  + V V D ND+ P F           + P GT V  + A D D G N  +++ LS      F++DP  G+I    +  +  + +  +     D      ++  T+ V   D  +  P+F    R+FSF   +     +  V A  +   +   + Y L +   L      GD+F        VS  R LD E    Y + + ARD G  P ++   +E+ + DINDN+P F   +         E      I    A+D D+G N ++ Y+I    I   F +N + G I    +L  E++   ++ + A D G
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLPRFGAA----ELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQ---------IIT--TASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF-PRFAPGPRSFSFREDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNL------GDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSR---FWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRG 416          

HSP 9 Score: 110.153 bits (274), Expect = 1.757e-24
Identity = 97/335 (28.96%), Postives = 158/335 (47.16%), Query Frame = 3
Query: 1404 GVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHL-ILRMNSSITIHVTILDENDNPPKFLRT--FSFHIKENLEG-VLGRVEAVDKDIGQNAQMDYFL-FNPSPLFEIS-RNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT----IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFI 2378
            G P LT T  +TV+V+DENDN P F       ++ E+ PIG+ V  + A D D G+NA I Y L      +F+++P +G I T  S DRE +  Y ++ TA D      ++SS T+ V + D ND+ P+FL     ++       G  +  V A D D G N  + + L  + S  F +  R G I  +  R L   R D  ++ +   D G  P ++ TTV +   D  +  P F  P P +  +   +   GT I    A    +     + Y + S      +F ++   G + ++++L  E+    ++++ ARDSG  P +    L ++ +
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLR-GGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAA--RALQGPR-DDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFA-PGP-RSFSFREDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVL 327          

HSP 10 Score: 93.5893 bits (231), Expect = 2.036e-19
Identity = 93/359 (25.91%), Postives = 153/359 (42.62%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPL--TSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAP----TSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNP 1469
            Q+ + +  VN+  P F +  +NF ++E++P    V    A D D G +G+V Y +   + S  F +        ++ + ++ +    DRE +    L +IAK+ G+        + + + ITD ND  P F+ + Y     E+   G  +  V A D D             S      FS      I+    L+ V+S  D      Y + ++AVD G P  T T+ V+V + D+NDN P +  +S+       +TEN  +   +  +   D D   N          Y F L    +   R ++ L ++         DRE K    L +  +D G P LT+T  + + V D+NDNP
Sbjct:  949 QVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSV--------NEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFS------INAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAK------VTENQPAGMTVLNLEAGDPDLPPN-------KGPYTFQLLG-SDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNP 1278          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 256.144 bits (653), Expect = 1.151e-69
Identity = 217/653 (33.23%), Postives = 318/653 (48.70%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISS----RVTIMMSPSASSQIMDKFSVAFDGVISTKVALVY-VSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIA--SSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPEC-LENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKE--NLEGVLGRVEAVDKDIGQNAQMDYFLFNPSP----LFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            + V D+NDN P F  L +  +I E+   +    +  A DPD GNNG+V Y I     +  F L + +   G  S+L +   +  DRE  + +QL + A D G P L     I I I D NDHAP F Q+SY  +  E+   G +I +V A D+D  S    +  I      S+ I D  S    GVI TK  L + V +S+ +   +IA D G P+    +TV ++V D NDN P ++I     +  ++ + +EN   N+ IA + V+DKD   N Q E K+   D+   F +E +  +  +    L        DRE+   + L +  +D GVPS +T   + + V D NDN P F     + +I E    G+ V +L A D D G N  + Y ++    L  F +D  SG++TT    DRE  S   +  TA DH       S T+ VTI+D NDN P+F++ ++   I E  ++   + +V A D D G N ++ Y + +       LFE++    +  + K  LDRE    YS  + A+DHG+  L SS  VE+ I DINDN+P F    P ++    +E     K+    A D D G NA I Y I    +   F I++S G I    SL  E      +IISA+D G
Sbjct:   83 VQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTG--STLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSST--GVIRTKQNLDFEVKNSYTFN--VIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPL--------DRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWT-KSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFY---PVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGG 717          

HSP 2 Score: 193.741 bits (491), Expect = 5.137e-50
Identity = 195/691 (28.22%), Postives = 331/691 (47.90%), Query Frame = 3
Query:  390 LILELSGSGPKFYQ----LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGMITTRVSFDRE------VQSEYKVKATA-YDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKE-NLEGV-LGRVEAVDKDIGQNAQMDYFLFNPSPL---FEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            LI+     G K+      + + V +  DN+P F    +NF + EN P    V    A   D+  NGS+ YAI     +N F++ S        +   +KI    DRE   ++ L +IA+     PL++  T+ I++ D ND+APQF+ SS   +   + + GQ +    A D D      +    +++++ +   + +  GVI     L     +  Y + ++A DSG+P     ST+ +H+T   ++ P   ++S   +   VL     S  +   V V D+D G NGQ+   +       L  I  F   + Y        S  + +K  + L +  +D GVPS + + P+T+ ++D ND+  +F       ++ EN   GT V  L A   D      I Y ++S E   +F +D  SG ITTRV  DRE        + Y ++A A Y+   ++ + +I I VT+ D NDN P F R  ++  + E +L G  + R++A+D D G NA+  Y L + + +   F  S  G++ +S  + LDRE    Y++ + A D  N  L S+  +EI + D ND  P F  P+    +N++ + + G+ +    A D D G+N  I Y+I +     +F + ++ G + + KSL  E     ++ I+A+D G+IP ++T ++ +N +    + P
Sbjct:  709 LIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDK--NGSISYAIVSGDPTNLFLVDS--------TGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWIN-STSGVIKLARKLTDGDET-QYTVQVLASDSGSPP--QHSTMTIHITLSINHPPKFTLSSYVTH---VLASQPLSYQFFYVVAV-DQDSGKNGQLFYSIPQGNEEGLFGI--FPGGKLYI-----RKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSES--HFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVI-VTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLS--KTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVF--PESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAP 1367          

HSP 3 Score: 185.652 bits (470), Expect = 1.943e-47
Identity = 180/666 (27.03%), Postives = 297/666 (44.59%), Query Frame = 3
Query:  405 SGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAF-DGVISTKV-----ALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN-FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKENLEGV--LGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIF-VSQKRYLDRERV----DRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEP---KPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPD-----KIIISARDSG 2333
            SGS P+   + I +    ++ P F   ++   +  + P   +    +A D D G NG + Y+I P         I P          KL I +S  + +   + LI+ A D G P  ++S+ + I I D NDH   F  +++RF   E+   G  +G + A   D S    I+ S  +S      F+V    G I+T+V      L+  + S  Y +   A+ +        + V+V VTD+NDN P+   A       + ++E     S + ++   D D G+N +    L +    +   I +     H       + + DRE    + L +  +D    +L +T  I + V D ND  P+F     +V+I E+  IG+ V  L A DKDIG N  IKY +S   L   F+++  +G +    S D E    Y++  TA DH ++ ++S++ + V +LD NDN P F  +  +  ++EN+     +GR  A D+D G NA + + +++ +P    S N     ++    +D E +    D + + + A D G+  L++  ++ + + D NDNSP F+ P     G  LN          + T  A D D   N K+ Y+I S    Y N    +      LQ  H +PD     ++ I A D G
Sbjct:  923 SGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSI-PQGNEEGLFGIFPGG--------KLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSES---HFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVY----AITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHL------SKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN----------VMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPST----GQLQMIHQIPDNPTIYQLTIQASDGG 1552          

HSP 4 Score: 163.31 bits (412), Expect = 1.544e-40
Identity = 134/462 (29.00%), Postives = 210/462 (45.45%), Query Frame = 3
Query: 1086 TVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN---FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPP-------------KFLRTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNP--SPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            +V V V DINDN P            L + E+   N+     T +D D GNNG V+  +   DN   F+L +           +   P    DRE  D +QLNI  +D G P+L     I + + DEND+ P+F +     SI EN   G  + R+ A D+D G N  IKY +  + +++   F++D  +G+I T+ + D EV++ Y     A D  +   N   T+ + +LD NDN P             K +R+ +  I  N+  +L      DKD   N+Q +  + N      F++   G  F+  ++ LDRE V  Y++ +   D G    ++   V I + D+NDNSP F         N+S     G+ +    A D D G+N  + Y+I        F ++   G +   K L  E +    I I+A+D G  PKT ++++ +  I    +KP
Sbjct:   80 SVQVQVDDINDNEPRFPTLYYT----LRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKP---LDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYIL----VTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFT--SNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKP 528          

HSP 5 Score: 153.68 bits (387), Expect = 1.304e-37
Identity = 166/684 (24.27%), Postives = 301/684 (44.01%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNY--LFNLESIQNFENRRHYKLVTAPTSSFDREVKD----HHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN--FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKENLE-GVL-GRVEAVDKDIGQNAQMDYFLFNPSPLFEIS-RNGDIFVSQKRYLDRERVDR------YSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            ++ + ++D+NDN P F  + +   I EN P    +++  A D D G N  + Y I     +  F + S        S+  +  L S D E++E F LI+ AKD GN     +  + + + +  D+ P F    Y F   E++ +G  +G+V+AT KD +  ++  +     + +          ++ +   ++ ++   D      Y + +IA       L+A +TV + V D NDN P    +S      + +         +      D D G NG V  +L +N   L  + S             T+      R++ D     + + ++ SD G P   +T  I + +    ++PP F        +L + P+  +   + A+D+D G N Q+ Y + P+  E   F I P  G +  R S  + ++  Y +   A D  +   ++S+ + + I D ND+   F+  TF F + EN   G L G + A   D  +   + Y L +    F +  R+G I  + +  LDRE + +      Y ++  A  +          V + + D+NDN+P F   +    + +S  ++ G+ +F  KA+D D G+NAK  Y++ S T    F+IN+S G ++L+K+L  E      +++ A D+      +T+ + +    S   +P
Sbjct:  622 KVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQV-TATDADEGTNAVISYDIIGGNNNGNFSIDS--------STGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAIVSGDPTNLF---------LVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSV----IVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINS-------------TSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSI--NHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSI-PQGNEEGLFGIFP-GGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQI--TTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVF--SRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRP 1262          

HSP 6 Score: 152.14 bits (383), Expect = 3.392e-37
Identity = 158/580 (27.24%), Postives = 253/580 (43.62%), Query Frame = 3
Query:  690 DREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRL-VLTENCQSNSYIAKVTVSDKDHGNNGQVECKLD-----NNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPP----IFYRQHESVSIL--ENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN-FNIDPFSG--MITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKE---NLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPL--FEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQ-----TIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            DRE   +  L L   +  N P++    +++ + D+ND+ P+F    Y     ES+          ATD D  +  T+  +  AS      FS+      +     V      D      Y++ I A D G P L     + + + D ND+ P+       QN+ L  + EN +    I +V+ +D+D G+NG ++  +D     +N +F+L+S       +          + D EVK+ +  N+I SD GVPS      +T+ V D NDN P     +   H     +  EN  I T +  +   DKD   N+Q +  ++    E  F ++ F G   I  +   DRE+   Y +     D  +   ++   + + + D NDN P F    ++ +I E   N   VL ++ A D D G N  + Y +   + L  F++     + V+  + LDRE+V   +I I A+DHG+ P T STTV + I D NDN P F+  K      +S     G  +    A D D+G+N +I Y I S       +F +NT  G ++    L  E        + A+D G
Sbjct:   58 DRETTTQISLQLRTLNPSNQPIS----VQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTI-ASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVF-----TQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQ---------NLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVE-FLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVL-QLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGL-VTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFM--KSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHG 613          

HSP 7 Score: 112.849 bits (281), Expect = 4.320e-25
Identity = 135/536 (25.19%), Postives = 230/536 (42.91%), Query Frame = 3
Query:  210 NVKKTFPDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFY---QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDK-FSVAFDGVISTKVALVYV----SSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRP--IIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL--DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLE-NFNIDPFSGMITTRVSFDRE-VQSEYKVKATAYDHLILRM-NSSITIHVTILDEN 1772
            N K  +  +    +D F  F   +   + + ++LDRE         T+  YN       +++     S    Y   ++ I V D ND  P F    +   I E++   + V    A D D G NG + Y+I    ++  F + S        ++ +L + +S D E  + ++L + A+D G  PL+S++ + +++ DVND+AP F          E++  G  +G+  A+D+D  +   I  S    SQ   K FSV       T +A + +    +    +++ ++A D G+P L+   ++ V VTD NDN P  +   A++  ++  V+T           +T  D D  +NG+V   +   NN  FNL          H ++   PT          +QL I  SD G PS  T   ++V  +      P F       S+ EN   GT V  + A      +N  I+Y L+ +  +  F +   +G++ T    DRE + + + +   A D        SS T+ +T+ D N
Sbjct: 1191 NAKFFYSLVSGTGMDKF--FINSSTGELHLSKTLDRE---------TTSSYN-------LVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVES--------ATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFS--MYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLNVMT-----------ITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIH-QIPDNPT---------IYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 246.899 bits (629), Expect = 1.350e-66
Identity = 206/675 (30.52%), Postives = 317/675 (46.96%), Query Frame = 3
Query:  423 FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECK-LDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN-FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS----QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNKK 2417
            +  L I V DVNDN P F+R  +   I E+    + V    A D D G+NG V Y I  S   N    I        + S  + +++  DRE    + L + A+D GNPP ++++T+KI + DVND  PQF++  Y     E +   Q +  V ATD D  S   +      S   M+ FS+   +G +  K  L Y      + + + A D G P L   +TV + + D+NDN P  +  SS  + + ++ EN        +V   DKDHG NG++    + N+  F++      EN     +        DRE        I   D GVP    T  IT+ + D NDNPP F ++    SI EN   GT V ++KAID D G    +  ++S    +  F I+P  G+IT   + +   +  Y    +A D +   ++S+  ++V + D N + P+F  R++S  +KE+  L   +  V A D+D G NA++ Y +    P F +     + +     LDRE+VD Y  E+ A DHG   L + + V I I D+NDN P F+  KP     +  +   G ++    A D D G+NA+I+Y+  S    Q  F I+++ G I   K L  E I   ++ + A D G  P    +S+ +  I       PP+ +K
Sbjct:  111 YMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIG-------EVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFE-IVSGNDMNFFSINRINGEVRVKQKLDYEMIGV-FNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAP--QFVSS--HFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSIN-----ENTGGISI----KEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINP-QGLITLSCTLNYNTKHVYVFSVSASDGM---LSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGV-IKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFL--KPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPG--QASVKVKVILEDVKDSPPLFEK 754          

HSP 2 Score: 180.644 bits (457), Expect = 7.007e-46
Identity = 183/644 (28.42%), Postives = 283/644 (43.94%), Query Frame = 3
Query:  459 DNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSA--VSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQ--NFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLE---GVLGRVEAVDKDIGQNAQMDYFLFNPSP---LFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI-FYINTSDGSIYLNKSLQDEHILPDKIIISARDSGI 2336
            +N P F RL  +  ++E++     V    A DPD G+NG + Y++ PS   +S  +  I   T         +   +  DRE  +     + A+D G P L   + + I++ DVND+ P F ++ Y  + PE    G  +  V A+D D  S   +      S      FS+   G +S  V    V    D      Y + + A D GNP  +AT TV + + D+ND  P      S +     + E+   N  +  V  +D D G+NG+V  ++ +    N  SI   N E R   KL        D E+     L +   D G P L     + + + D NDN P F   H    I EN  +G +  R++A DKD G N +I +      L  F+I+  +G I+ +   DRE   ++     A D  +     +  I +T+LD NDNPPKF +  +   I EN      VL +V+A+D D G    + Y + + S     F I+  G I +S     + + V  Y   + A D     L+S+  V + + D N ++P F   +      +  +   GT + T  A D DTG NAKI Y+I +    F ++ + G I    SL  E +   +  ++A D GI
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGV-------ITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSI---GEVSGAVT---VMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQF----SKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKL--------DYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLP-FSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVL-QVKAIDPDSGPT-NVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHV--YVFSVSASDG---MLSSTALVYVNVTDSNTHAPEF--KRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGI 623          

HSP 3 Score: 171.4 bits (433), Expect = 5.880e-43
Identity = 183/725 (25.24%), Postives = 314/725 (43.31%), Query Frame = 3
Query:  255 NFQNFFRLN--DNNVEMLQSLDRE-----NLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSP--ECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENL--EGVLGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISRN-GDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIE--TIQGTKIFTAKAIDNDTGENAKIVYTIQ---SQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHL 2369
            N  NFF +N  +  V + Q LD E     NL+   + D  + + YN+ +                 + I + DVNDN P F    F   I EN     E     A D D G NG + ++   + +       S + N G      + I +  DRE   +F   + A+D G P    +  I I + D+ND+ P+F+Q  Y  +  E+   G ++ QV A D D S    ++ S  +SS     F +   G+I+    L Y +      + + +V + +  L++T+ V V+VTD N + P  +  S +      + E+    + +  V  +D+D G+N ++         +++ ++    +      V     S DRE  D ++  +  +D G+P L     + + + D NDN P+F +      + E++  G +V  + A D DIG NAQI Y  +   +    F ID   G+I T    DRE   EY++   A D       +S+ + V + D  D+PP F +  +   + E+      +  V+A  +D+     M Y +   N   +F+I+ N G I    K  LD E    Y + + A      P  + TTV + + DINDN+P         H+N++++   +     +   A D D  +  K+ + +    ++    +N + G + +NK L      P  I I+  D G+   + T S+ +
Sbjct:  277 NDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQ-DKGQPFLYNQTT-----------------VDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLP-----FSINENTG-----GISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPD-SGPTNVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTK----HVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAE----VKEDASLGTSVLTVLATDRDTGSNAKIS--------YSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMK--LDYETQSEYRLTVRATLS---PFFTETTVMVYLKDINDNTPVL----EAFHMNINVQEGKVPPEARYKIPAYDPDVSD--KLTFKVMEGNAKEWVTLNATSGELSVNKKLIQAS-KPANIKIAVTD-GLRTASATGSIMM 943          

HSP 4 Score: 162.155 bits (409), Expect = 4.127e-40
Identity = 123/419 (29.36%), Postives = 205/419 (48.93%), Query Frame = 3
Query: 1170 LTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKL-----VTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN--FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISR-NGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI--ETIQGTKIFTAKAIDNDTGENAKIVYT-IQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFI 2378
            ++E+ +  + +A V+ SD D G+NG +         +++   QN  +  ++ +     V       DRE  D H   +   D G PSL     +T+ V D NDN PIF R   +  I E+  IG  V  ++A D D G N ++KY +     +N  F+I   SG +T     DRE    Y ++  A D      ++++T+ +T+LD ND  P+F  + +S  I+E+  +  ++  V A D D G N ++ + +   N    F I+R NG++ V QK  LD E +  +++ + A+D G   L + TTV+I + D+NDN+P F+      H    I      G + +  +A D D G N +I ++ +Q+   F IN + G I + + L  E +      I ARD G+  K  T+ + +  +
Sbjct:   29 VSEDAEVGTVVATVSASDPDSGSNGMIR--------YSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQK--LDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVS----SHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLL 433          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 242.662 bits (618), Expect = 2.279e-65
Identity = 219/746 (29.36%), Postives = 342/746 (45.84%), Query Frame = 3
Query:  168 CVVEENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDNNVEMLQSLDR--ENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQ---LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKD---------HGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEGV--LGRVEAVDKDIGQNAQMDYFLF--NPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFI--EPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI--QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            C V EN    V +C V  T  D    +  N +  + +   N  M  ++DR    + T    D     +Y      + I    GS  +F     + I +AD NDN P+F   +  F I+E+SP    V    A D D G NG+V YAI      N F L           S  L +  + DRE    + L++ A D G+P  + + +I + + DVND+AP+F +S +     E       + QV   DKD  S   I +S S      D F++   G + +K  L Y +++  Y++ + A D G+P+ +AT+ V + + ++NDN P     S  Q   +   E+   N+++ K+  +D D          GN G                  +F+  +   L++      DRE   ++ L +  ++ G    +     T+ V D NDN P+F     + S+ ENLPIG  V ++ A D+D G NA++ Y LS      F ++P +G++TT+   DRE Q+ Y ++ TA DH     ++   I +TI D NDN P+F ++ ++  + EN      + RV A D D G N ++ Y +   N    F I S  G I V     +DRE +  Y++ I A+D G  P  S+  V I + D NDNSP F   E   G    +SI    G+++    A D D G NA++ Y+I     + F IN  +G + + K +  E +    + I A D G
Sbjct:  692 CTVGENLAAGVAVCYVTATDAD----SGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASY-----SLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPS-RFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQL--------DPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGS--DNFTIDSTGFVLSKTPLDYETTAA-YQLTVTARDGGSPSKSATAQVKITIINVNDNVP--SFVSPAQVTSI--PEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGS-----------------SFKIDQSSGLISV-AKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVG--VVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSI----GSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRG 1388          

HSP 2 Score: 227.254 bits (578), Expect = 1.849e-60
Identity = 210/711 (29.54%), Postives = 315/711 (44.30%), Query Frame = 3
Query:  336 QKCDTSKQYNYNRDSQCILILELSGSGPKFYQ-LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISS--RVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSF---------------DREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKI-FTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            ++ D     NY   +  +   E    G   Y    I V DVNDN P F+  ++   + EN P    V    A D D G N  V Y +     S KF  ++P+T         +   +  DRE    + L + A D G P  ++   I + I D+ND++PQF+QS Y     E+   G  I +V A+D D  +  RVT  +    S    + F +       T V +V   +   Y + I A DSG P   +T+ V + V D NDN PI    +SN+ +   + E     S +A VT +D+D G+N QV                       Y +V   TS+F               +RE    + L I  SD G P +T+ + +TVVV D NDNPP+F  Q    S+ EN    T V  + A D D+G NA ++Y ++S    + F I+  SG+I T    D E +S+Y ++ TA D    +  +   + + +++ ND  P F  + ++  ++EN      + +V A D+D   +          S  F I +   I +S    LDRE V  Y+I++   D GN PL++ T V I I D NDNSP F        +   +E    +   F   A D D G NA+I Y +     F I  S G I L + L  E+     + I ARD G  P+ ++ ++ +  I     +P
Sbjct: 1055 KRLDRETTANY---TLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTS-KF-EVNPATGL-------VTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSI---ISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIF---ASNETS-YGIDEGVSIGSRVAVVTATDRDEGSNAQV----------------------FYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGI-ISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSI---LENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRP 1717          

HSP 3 Score: 214.542 bits (545), Expect = 1.756e-56
Identity = 190/690 (27.54%), Postives = 322/690 (46.67%), Query Frame = 3
Query:  372 RDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVE---CKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEP----KPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            +DS  + I    G    F  L I V DVNDN P F    +   + E+    + V    A D D G N  + Y++  S  ++ F +         DS   ++   +FDRE    +Q+ L A+D G+P  +   T++I+I DVND+ P F+ + Y  +  E +  G A+  V A+DKD  +   +  S + S      F++ A  GV++   +L +   S  Y + +   D G+P LT TS +L++V DINDN P+   ++        + EN  + +   +V+ +D+D   NG +     K +++ +F ++            +  +P    D E K  + L +   D GVP    T  +T+ ++D ND+ P+F   + S  I E+  IG+ V  + A D D G   +++Y ++S      FNID  SG I      DRE    Y ++  A D      +SS  + + + D NDN P F   + F + E+      +G+V A D D   N  + Y L + + +F I+ +  + ++ K  LD E+  +Y + + A+D G    +S T V++++DD+NDN P F +       G++L        G  +    A D D+G N KI Y+I S      F ++   G I     L  E I    + I+A D  ++     ++++++      ++P
Sbjct:  135 KDSYTMRISAFDGKHTTFVPL-ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLV-SGDTSYFTV---------DSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFT-SGNTNHAFTLDAVTGVVTVSRSLDFEQRS-SYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSR----VKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGI-----ISIAKSP----DYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGL-ITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENL------AAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQP 788          

HSP 4 Score: 211.846 bits (538), Expect = 1.438e-55
Identity = 195/645 (30.23%), Postives = 302/645 (46.82%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN-FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKENLEGVLGR----VEAVDKDIGQNAQMDYFLF--NPSPLFEISRN-GDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT-IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            I V D NDN P F   ++ F I EN+PA  +V +  A D D G N ++ Y++      NKF++ S +         +++ +   D E  + + + + A D  +      +T+     DVND+AP F  S Y+    E +  G  + Q+ A D D+   +   +S S  S     F+V   GVI TK A    + +  Y++ + A D G+P+ +  +TV + + D+NDNRP+   A    +    + E+    + +  VT SDKD+GNN  +       + N+ F L+++           V   + S D E +  + L +  +D G P LT T  + + V D NDNPP+F        + EN P GT+V+   A D+D   N  + + +     +  F ID  +G+I+   S D E ++ Y +   A D  +     +  + + I D ND+ P F    +S  I E+   V+G     V A D D G   +++Y L   N    F I  N G I VS +  LDRE    YS+++ ARD G+   +SST V I + DINDNSP F  P       +S  +  G +I    A D D   N  + Y +   T +F INTS G I L   L  E      + ++A+D G
Sbjct:   58 IDVKDENDNAPEFPLNSYVFNIRENTPAA-QVAIVTATDRDSGTNAAITYSLFSG--ENKFMMNSKTG--------EIRTVTPLDHETKDSYTMRISAFDGKHTTFVPLITVD----DVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVG--INARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKA-SYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTAS----VDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTG---------VVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVS---ATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPEST--VIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSE--LDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGP---YVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGG 661          

HSP 5 Score: 177.178 bits (448), Expect = 7.165e-45
Identity = 177/562 (31.49%), Postives = 268/562 (47.69%), Query Frame = 3
Query:  432 LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFH--IKENL--EGVLGRVEAVDKDIGQNAQMDYFLFN--PSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTF 2093
            + I VAD NDN P F     ++ I E     + V +  A D D G+N  V Y+I     S  F +         +  L +K  +  +RE    + L + A D G+P +TS   + + + DVND+ P FN  SY  +  E+  Q  ++  V A D D+ +   +  S   S     +F + +  GVI T   L +   S  Y + + A DS     TA + V + V ++ND  P    A + QN    + EN  +++ + KV+ SD+D   +      L  + +   +S +   ++R   + TA     DRE+   + + +  +D G P L+    +T+ + DENDN P F     S SILEN    +   +L A D D G NA+I Y LS    + F I   SG+IT     DRE +S Y +   A DH      SSITI VT++D ND+ P  + + S    ++EN   E  + R+ A D D G NA++ + L +     +F + +  GDI  S K  LDRE+   Y++ IG  D GN  L+S   V I + D +DN P F
Sbjct: 1294 VAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTS-AFAI------NAMNGVLTVK--KEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSI-ISGNDEKRFKINSTSGVIMTTTPLDFEEKS-QYGLEVTATDS---KYTAKTNVTIRVINLNDITP----AFTQQNYTASVRENSPTSTSVVKVSASDRDSFGS------LSYSIVGGKDSDKFSIDQRSGIISTADV--LDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRN--DAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRP-LINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDI--STKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRF 1824          

HSP 6 Score: 166.777 bits (421), Expect = 1.129e-41
Identity = 154/565 (27.26%), Postives = 256/565 (45.31%), Query Frame = 3
Query:  681 QSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML-SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI---FYINTSDGSIYLNKSLQDEHILPDKIIISARD 2327
            + FDRE +  ++L ++A+D  N        + ID+ D ND+AP+F  +SY FN  E+    Q +  V ATD+D  +   I  S          FS     ++++K   +   +  D      Y + I A D  + T       L+ V D+NDN P   ++      +  + E+    S + ++T  D D G N ++   L   D +Y F ++S          + V     +FDRE K  +Q+ +   D G PS +    + + + D NDN P+F     + S+ E++ IG  +  + A DKD G NA ++Y   S      F +D  +G++T   S D E +S Y +  +  D     +  +  + + + D NDNPP F    +   +KEN      +V A D+D   N  + + +   N   +F I  +  I +S  +  D E   RY + + ARD G      +  V I I+D+ND+SP F      + +  S  T+ G+ + T  A D D+G   ++ Y + S  +   F I+ + GSI ++  L  E      + + ARD
Sbjct:   26 RKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQ-VAIVTATDRDSGTNAAITYS---------LFSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVP----LITVDDVNDNAPFFALSVY----KTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSY-FTVDS----------QGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT-QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGI-ISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPES--TVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARD 557          

HSP 7 Score: 144.05 bits (362), Expect = 1.190e-34
Identity = 135/483 (27.95%), Postives = 220/483 (45.55%), Query Frame = 3
Query:  429 QLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEGVLGRVEAVDKDI 1868
            +L ++V DVNDN P F+  ++   + ENS     V    A D D G N  + Y+I       +F +        + +S  +      D E   ++ L + A D      T+   + I + ++ND  P F Q +Y  +  E+     ++ +V A+D+D    ++  +     S   DKFS+    G+IST   L     S  Y I +   D+GNP L+  + V + + D NDN P  + +S +      + EN   +S+  K+  +D D G N ++   L  N  F + +            V       DRE K  + L I   D G P   ++  I V V D ND+ P+        S+ EN P  T V R+ A D D G+NA++ + +LS E    F +D  +G I+T+V  DRE Q+ Y ++    D     ++S   + + ++DE+DN P+F  T ++  I E+L      V+   +DI
Sbjct: 1397 ELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKI--------NSTSGVIMTTTPLDFEEKSQYGLEVTATD---SKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDS---DKFSIDQRSGIISTADVLDRELVSL-YAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSS----SILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSG---------VITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDI 1851          

HSP 8 Score: 112.849 bits (281), Expect = 4.762e-25
Identity = 115/395 (29.11%), Postives = 190/395 (48.10%), Query Frame = 3
Query:  396 LELSGSGPKFYQ---LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKD--ISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKD 1562
            LE++ +  K+     + I V ++ND  P+F +  +   + ENSP    V    A D  R + GS+ Y+I     S+KF +           S  +      DRE+   + + +   D GNPPL++   + I I D ND++P+F+ SSY  +  E+        ++ ATD D   ++R+T  +S +      D F + A  GVI+    L   + S  Y + I A D G P   ++ T+ V V DIND+RP+I  +S     R  + EN    +++ ++  SD D G N ++   L +N   ++ ++ N       K+        DRE +  + L I  +D G PSL++   + + V DE+DN P F     +V+I E+LP G  + ++ A D D
Sbjct: 1485 LEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASD--RDSFGSLSYSIVGGKDSDKFSI--------DQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRN------DAFMIGASSGVITLAQPLDRENKST-YDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSL----RGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKV------PLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 9 Score: 92.0485 bits (227), Expect = 1.150e-18
Identity = 79/271 (29.15%), Postives = 132/271 (48.71%), Query Frame = 3
Query: 1617 FNIDPFSGMITTRV-SFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-LRTFSFHIKENLEGV-LGRVEAVDKDIGQNAQMDYFLFNPSPLFEI-SRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNR---PLTSSTTVEIIIDDINDNSPTFIEP--KPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS-QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            F ID  +G ITT    FDRE +S Y++   A D           + + + DENDN P+F L ++ F+I+EN     +  V A D+D G NA + Y LF+    F + S+ G+I       LD E  D Y++ I A D  +    PL       I +DD+NDN+P F     K G + ++++    G+ +    A+D D G NA++ Y++ S  T ++   S G I    +   E     ++ + A+D G   ++  +++ +  +    ++P
Sbjct:   12 FTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMNSKTGEIRTVTP--LDHETKDSYTMRISAFDGKHTTFVPL-------ITVDDVNDNAPFFALSVYKTGVYEDVAV----GSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRP 269          

HSP 10 Score: 50.447 bits (119), Expect = 5.166e-6
Identity = 37/121 (30.58%), Postives = 54/121 (44.63%), Query Frame = 3
Query: 1902 NPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI-QSQTIFYINTSDGSI 2261
            N   +F I  +     +  R  DRE   RY + + A+D  NR     T V I + D NDN+P F  P      N+  E     ++    A D D+G NA I Y++   +  F +N+  G I
Sbjct:    7 NDQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEF--PLNSYVFNIR-ENTPAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMNSKTGEI 124          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 236.113 bits (601), Expect = 3.518e-63
Identity = 220/690 (31.88%), Postives = 327/690 (47.39%), Query Frame = 3
Query:  324 LITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLT-FNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQS---FDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNP-TLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLD--NNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML-----SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLEGVLGRVE--AVDKDIGQNAQMDYFLFNP-SPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTA----KAIDNDTGENAKIVYTIQSQTIFYINTSDGS------IYLNKSLQDEHILPDKII 2312
            + T    D  K   YN     + I+E S + PK Y + + V D+NDN PSF R T     + EN     + +L +A D D G+N +  Y I    V N F LIS     G D    L +  S    DRE  + + L + A D GNP     L + I + D ND+ P+F+  SY    PE+I  G +I QV A+DKDI +   I  S    S     F +    GVI   V L Y  +   Y I + A D G+   L++++ V + V D+NDN P+I + S        +TEN    + +A+V+VSD D G NG+V   L+  + Y      + N E+      + A   S DRE  DH  L  +C D G P  TT +   + V D ND  P F R      + EN  + T V  + A+D+D G N+++ Y +     S   L  F IDP SGMITT    DRE   +  +    +D     ++ + ++ V + D NDN P F + +++  + EN       V+  A D DIG+N+ + Y +  P +P F   R G   V+  R LD E    Y+ ++ A D G R  + + TV + + D+NDN P F +P      + S+E  + T+I  +    KAID D+ + A   + I+      + + DGS        L++  QD ++L  K +
Sbjct:   14 ITTKTVLDREKVSAYN-----LTIVEFS-TPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQ-KL-IAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDG-DLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDY-EAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHV-SYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDES------IIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKG--LVTNSRTLDHEVQSSYTFQVAATDGGGR--SCNATVHVSLTDLNDNQPVF-DPS-----SYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAV 676          

HSP 2 Score: 196.052 bits (497), Expect = 1.434e-50
Identity = 201/672 (29.91%), Postives = 312/672 (46.43%), Query Frame = 3
Query:  405 SGSGPK--FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISS--RVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL-DNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGV-PSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSS---ITIHVTILDENDNPPKFLRT-FSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRY-LDRERVDRYSIEIGARDHG---NRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIE----TIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI--FYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTT 2351
             GS P+     L + V DVND  P F   ++   + E +P  + +   +A D D G NG + YA      ++KF L     N G     K+ I    DRE  EE+ L +IA D G P  +SS  +K+ + DVND+ P F Q+SY F   E+      +G V A+D D  S   VT       +  I+DK +    G I+T   L   + +  Y   I+A D G+      + V V V D+ND  P     S N+ +  V  +    +S +  +   D   G N  +   +      F+L  +           V    S  DREV   H L+++ SD G   SL T   I + V D NDN P+F  +    ++ E LPIG+ V  + A+D D G N +++Y +++      F I+  +G+I+T  + D EV + Y ++ +A D    +  +S   +TI+V   D NDN P F +      I EN  +   +  ++A D D G N+++ Y + + SP      N +  + Q  + +DRE +  YS+++ A D        L ++ T++III D+NDN+P F+     ++L   +E      Q T I    A+D DTG+   + Y I S     F ++   G + L  SL  E +    + ISA D G  P T+
Sbjct:  887 GGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGL----RNGG-----KIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQT----GKITTSQVLDREAKA-SYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKF---SKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTG---------VLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVE--DANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVS----RNLTYVMEDEPFNFQVTSI---TALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTS 1523          

HSP 3 Score: 181.03 bits (458), Expect = 5.493e-46
Identity = 183/628 (29.14%), Postives = 302/628 (48.09%), Query Frame = 3
Query:  432 LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLK---LKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMS-PSASSQIMDKFSV-AFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRP--IIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKEN--LEGVLGRVEAVDKDIGQ--NAQMDYFL---FNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSI 2261
            L I++ D+NDN P F      + + E+ P + +V    A DPD G  G+V Y I           +SP T +     LK   LK++ S D E   ++ L + A DLG+PPLTS     + + DVND+ P+F +  +     E+   G ++ +V A D+D  S   +  S PS     MDKFS+    G+I T  +++       Y + + A     P   ++++V ++V D NDN P  I  + +      L + EN  +   I  +TV D D+GNN +V   + +       +I     R   +L T  T+  DRE K  +QL++   D+  P  T    IT+ ++D+NDNPP+F +   S +I E  P GT +  L A DKD G N  I Y LS +    ++ID  +G++ +   F+  ++ EY     A D       + + + + I D+N++ P+F +T +  HI  N     ++  V A D D  +  N ++ Y L    N + LF +  N     +   + +  +  R+++ I A DHG+ PL     V+I+I +I D+ P F+   P + +++   +  G+ I T +A       +A++ Y+I S      FY++   G I
Sbjct: 1424 LKIIIQDLNDNAPKFVSRNLTY-VMEDEPFNFQVTSITALDPDTGQGGNVEYRI-----------VSPDTGK-FSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVE--MDKFSIDKHSGLIVTN-SILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVT------LKVPENSPAR-LIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTI----GRSTGELST--TTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQ-GRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPAR-VSIPENSKVGSYITTVRA---RASSDAQVTYSIISGNKGRAFYVDPFTGVI 2017          

HSP 4 Score: 172.94 bits (437), Expect = 1.768e-43
Identity = 201/788 (25.51%), Postives = 340/788 (43.15%), Query Frame = 3
Query:  138 INILWYSNGECVVEENSPIFVRICNVKKTFPDIE-----NPTIDNFQNFFR-----LNDNNV-EMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQ--LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFV---LISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKD------------HGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGR----VEAVDKDIGQNAQMDY-FLFNPSPLFEISRNGDIFVSQKRYLDRERVDR-YSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETI-QGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTS------DGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSS 2360
            I++ +   G   V EN+ I  ++  V  +  D       N T++    +F      LND ++  + QSLDRE              ++   + CI      G  P+  +    I V DVND  P FDR T+  ++ EN+  +  V +  A D D G+N  +VY I  +  S  ++    I PS+         +      DRE   +  L ++  D G+PPL+ + ++ +++TD ND+ P FNQSSY  +  E+   G  + Q+ A D DI     I+ S      I+   +  F   +  +  LV  S + D      Y   + A D G  +  A  TV V +TD+NDN+P+ + +S +    +   EN +    I ++   D+D             GN  +V   +D + L  L  +                   DRE +D++ L +   D G         + + V D ND PPIF +   + +I E+    + +  + AI +D G NA++ Y +S    +N  +   +G +  +   D E      +   A D     +     + + ++D NDN P+F  + S  ++   +  +G     V   D D G   ++ +  L NP  LF +  N    +S  + +D     R Y++ + A+D G+ P +S+  +E+ + D+ND SP F       H+   +ET    + I    A D D+GEN +I Y   S+    ++TS       G I++   L  E I    + + A D G  P+ ++S+
Sbjct:  279 IHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRET-----------HDHFFLKAVCID----KGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGM-------ITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYS------ILTPNTPFF---LDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNA--TVHVSLTDLNDNQPVFDPSSYS----VEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEV-FSVDGSGLITLAKL------------------LDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQF-NSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGA-LSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHV---LETTPPDSNIIEVVATDVDSGENGRISYAFDSK----VDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHG-TPRRSSSA 1000          

HSP 5 Score: 159.073 bits (401), Expect = 4.087e-39
Identity = 177/653 (27.11%), Postives = 284/653 (43.49%), Query Frame = 3
Query:  432 LPILVADVNDNVPSFDRLTFNFKIAENSPAHNE--VELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSAS------------------SQIMDKFSV-----------AFDGVISTKVAL-VYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNN-GQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYML-SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTF--SFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPS--PLFEISRNGDIFVSQKRY-LDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKI--FTAK--AIDNDTGENAKIVYTIQSQTIFYINTSDG 2255
            L I V D NDN P+F       ++AE++ A     V    A D D G NG V Y+I     +  F + S +   G  ++ KL      DRE    F L++   D G PP +++  +K+ +TD+ND+ P F+  S   N  E    G  +  V ATD D  SR+T  +  +++                  +QI   F +           A  GVIS +  + V +  SF  +IP+ A+D G P   A    LV+V  I    P  E+ S        + EN    + +  V V+D   G   G++   ++N+  F +        R     V  P    D E K    L +   D   PS     P+ + V D ND  P+F +        E +P+GT V  + A DKD G N ++ + + S +   +F ID  +G+I T+ + D E    + V   A D     M++ +++ + +LD NDNPP F         + EN  L   L  + A D+D G NA++ + +   +   LF I +      +   +  +   V +YS+ I A D GN PL+S+ T+ + + D ++  P+F        ++   +     KI  F  +  A D D+G+  ++ +      +FY  TS+ 
Sbjct: 2053 LDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTT---GEITTAKL-----LDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLS-EVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSF-IQIPVQAMDQGVPPQRA----LVYVRIIITREPKFELPSYFGK----VPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIG------QRSGVISVNKP---LDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF------NRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFF------VFYNPTSNA 2666          

HSP 6 Score: 155.221 bits (391), Expect = 5.674e-38
Identity = 198/781 (25.35%), Postives = 342/781 (43.79%), Query Frame = 3
Query:  174 VEENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKF--YQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPD-RGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDL-GNPPLTSSLTIKIDITDVNDHAPQF-NQSSYRFNTPESIVQGQAIGQVFATDKDISS----RVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTL-TATSTVLVHVTDINDNRPIIEIASSNQNNRLV--LTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKL-----VTAPTSSFDREVKDHHQLNIICSDMGVPS---LTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPL----FEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSI-ETIQGTKIFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLN-FIRSGKSKPPPMNKKI 2420
            V+EN P+   +  V  +  D  +    N    +R +    + +       + T+Q  D   + +Y       ++    GS P+    Q+ ++V DVND  P F +  ++  + E+ P  + +   +A D D +G N  + Y I          +  P     +  +  L ++   DRE+     L ++A D  GN  L +   I+I++ DVND+ P F N+++++   PE +  G  +  V A D D       R  I+   +  +  +++ +    GVIST  AL +  ++  Y + + A D G     T+   V ++V D NDNRP  +       N ++  + EN   N+ +  +   D D G N ++   +D+              R H+K+     +   T   DRE    + L +  +D        L  T  + ++++D NDN P F  ++ +  ++E+ P   +VT + A+D D G    ++Y +       F++D  +G++    S D E   +Y +  +A D     + S    +V ++D NDNPP+F R  F   + EN      + +V A D+D G NA++ Y +  PS +    F I ++  + V+    LDRE+ D Y + + A         SST+V I + D NDN P FI P     + L + E      I+T    D D G N K++Y+I S      F I  S G +     L  E     ++ + A+D  I P   T+  ++  FI      PP   + +
Sbjct: 1025 VKENEPVATYLGAVSASDSDEGS----NGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASY----VFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMI----------VAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFK-TVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETT----GVISTLRALDFEVTN-RYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFD------KNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQ-----------SPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTY-VMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSI--PSGVEMDKFSIDKHSGLIVTNS-ILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPV----VTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKD--ITPPYYTAFANITIFIEDQNDNPPVFQQSL 1754          

HSP 7 Score: 148.288 bits (373), Expect = 6.530e-36
Identity = 146/503 (29.03%), Postives = 234/503 (46.52%), Query Frame = 3
Query:  978 GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQ-----VECKLDNNYLFNLESIQNFENRRHYKLVTAPTS-SFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLS----PECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDH-LILRMNSSITIHVTILDENDNPPKFLRTF----SFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEIS---RNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHL--NLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT-------IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            GVI+TK  L     S  Y + I+       T   + TVLV+V D+NDN P     +S    +LV+ EN +   +  K+   D D G+N       V   + N  +F L S ++ +   +  LV   +S   DRE  D + LNI  SD G P+      +++ V+D NDN P F     S +I EN+ +GT + ++ A DKDIG NA+I+Y +     P+ +  F I P +G+I   V  D E +  Y +   A D     +++SS  + + +LD NDN P    ++    S+ + EN  +   + RV   D D G+N +++  L      F +     N +  ++  + LDRE  D + ++    D G+ P T+  +  I + D+ND +P F        +  N ++ T+    +    A+D D G N+++VYTI + T        F I+ S G I     L  E I    + +   D G  P +   S+ +N   S  + P
Sbjct:   12 GVITTKTVLDREKVSA-YNLTIVEFS----TPPKSYTVLVYVQDLNDNSPSFVRGTSA---KLVVFENDKD--FRQKLIAVDSDFGSNSTQSYTIVSGNVGN--VFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAI--FGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTL----VAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDP 496          

HSP 8 Score: 145.206 bits (365), Expect = 7.051e-35
Identity = 180/716 (25.14%), Postives = 287/716 (40.08%), Query Frame = 3
Query:  423 FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRF----NTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQN-NRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHY------KLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTK--VTRLKAIDKDIGVNAQIKY-MLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKE------------------------NLEG------VLGRVEAVDKDIGQNAQMDY-FLFNPSPLFEISRNGDI-FVSQKRYLD-RERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPK---PGQHLNLSIETIQGTKIFTAKAIDNDTG-ENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            F  + I + D NDN P F +  ++  I+E +P    +    A D D G+NG++VY +     ++ + + S  +  G   S        F+  I +E+    IAKD G  P  + + ++I I D N+HAPQF ++ Y      NT  S +          TDK  + +VT  +  S +S  +         V+ +    V  S+ F       + + IIA D G+P L     V + + +I D+ P       NQ   R+ + EN +  SYI  V           +     D    +++  I   + R  Y       +  A   + D E   + +L+++ +  G  SL     + + V D NDN P F+  +    + E+        V ++ A D D G N ++ Y + +      F ID  +G ITT    DRE  + + +     D  I   +++  + V + D NDNPP F      +I+E                        NL+        + RV A D+D G NAQ+ Y F    S   +   + D   +S +R +D R R     I + A D G  P  +   V III           EPK   P     +    + GT + T +  DN  G    +I Y I++   F I    G I +NK L  E      +++SA D     K     +++N       KP
Sbjct: 1733 FANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLS----NDTYGVYSIDSRTGIVYSAA-----RFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSL--------FVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFL----NQTPARVSIPENSKVGSYITTV-----------RARASSDAQVTYSI--ISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITR---------EPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKP 2405          

HSP 9 Score: 140.969 bits (354), Expect = 1.266e-33
Identity = 161/645 (24.96%), Postives = 265/645 (41.09%), Query Frame = 3
Query:  468 PSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQS-FDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD-GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDI--GVNAQIKYML--SPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT--FSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISR-NGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTK---IFTAKAIDNDTGENAKIVYTIQS---QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTT 2351
            P F R  F   ++EN P    V    A D D G+N  + Y+I      +KF +         D    L +  S  DRE  + + L + A  +  P   SS +++I++ D ND+ P+F         PE+    + I  +   D D  +   ++ S   S      F++    G +ST   L   + +  Y++ + A D   P  TA + + + + D NDN P+ + +  +      ++E     + I  +T SDKD G+NG +   L N+  + + SI +         +    + F+  +K  +    I  D G        P+ + ++D+N++ P F +    V I  N      VT + A D D     N ++ Y L  S      F ++  +G + T   F    Q  + +   A DH    +     + + I +  D+PP+FL        I EN + V   +  V      +AQ+ Y +   N    F +    G I V+    LD E    + + + A   G   L     ++I + D NDNSP F    P   L    E     K   +    A D D+G N K+ Y+I +     +F I+++ G I   K L  E      ++I   DSGI PK+T
Sbjct: 1539 PEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSI---------DKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPEN-SPARLIYTLTVQDLDYGNNTKVLYS-IMSGNTDGAFTIGRSTGELSTTTKLDRETKA-SYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSS----TISELTPPGTSILNLTASDKDSGSNGNIVYTLSND-TYGVYSIDSRTG------IVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSK-VGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAF---HPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKST 2156          

HSP 10 Score: 100.138 bits (248), Expect = 4.005e-21
Identity = 87/329 (26.44%), Postives = 143/329 (43.47%), Query Frame = 3
Query:  669 LKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMI 1646
            + + +  D E    F L++ A D   P     + + I+++DVND  P F QS Y     E I  G  +  V A DKD  +   +  +  +     DK S A D   GVI T+ AL + +    + + + A D G+P +    +V + V D+NDN P+  +   N    L   EN   NS + ++  +D+D G N ++   +       L  I  F       L T  T  ++      + L I  +D G P L++   I V V DE++  P F R      +  N  IG  V ++ A D+D G   ++ ++          ++  +G+I
Sbjct: 2359 ISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGD---DKGSFAIDRKTGVIRTQRALDHETIK-THHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVL---ENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGW----LTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNALKMNATTGII 2676          

HSP 11 Score: 90.5077 bits (223), Expect = 3.316e-18
Identity = 80/263 (30.42%), Postives = 126/263 (47.91%), Query Frame = 3
Query: 1635 SGMITTRVSFDREVQSEYKVKATAYDHLILRMNS---SITIHVTILDENDNPPKFLRTFS--FHIKENLEGVLGRVEAVDKDIGQNAQMDYFLF--NPSPLFEI----SRNGDIFV-----SQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQS----QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSL 2363
            +G+ITT+   DRE       K +AY+  I+  ++   S T+ V + D NDN P F+R  S    + EN +    ++ AVD D G N+   Y +   N   +F++      +GD++      +    +DRER+D Y + I A D GN        + I ++D NDN P F        +  +I+   GT I    A D D G NA+I Y+I++    Q IF I+ + G I  N  L  E      I++ A D G   + ++S++
Sbjct:   11 AGVITTKTVLDRE-------KVSAYNLTIVEFSTPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDV--GTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAI 264          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO33359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF2])

HSP 1 Score: 210.69 bits (535), Expect = 1.576e-56
Identity = 204/771 (26.46%), Postives = 347/771 (45.01%), Query Frame = 3
Query:  165 ECVVEENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGP------KFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTS--SLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDIS--SRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKA---IDKDIGVNAQIKYMLSPECL-ENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLE-GV-LGRVEAVDKDIGQNAQMDYFLF--NPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSS--TTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI---QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTT--SSLHLNFIRSGKSKP 2399
            E  V EN+P+   +  VK     ++  +  N    + + + N     ++D     +  +  T K++++ +  +  L + +S +G        F  + I+V D NDN P F +  +   + EN      V    A D D G N  + Y+I      + FV+I+ S +   D  L        D+E  E + L+LI  D+G PPL S   + + + ++ VN+HAP+F    Y  + PE++  G +I +V A + D+S  +R   ++  +ASS++   F V   G I+       ++   DY                                      + +     + EN  S + +  +   D+D G NGQV       Y     S++          V + T+  DRE    + + ++  D G P  T +  + V V D NDNPP+F   + ++ + E   IGT++ R+ A    DKD GVNA+I+Y L    + + F+I+  +G IT + + D E +S Y  +  A D    R+  S ++ +TI+D NDN P FL T +   + EN+  G  + +V A D D   N ++ + +   N    F I +N  + V+  + LD E V  Y++ I A D G+ PL SS    + + + +INDNSP F +      ++ +  T  G  I    A D D+  N K++++I    S   F ++ + G +  NKSL  E +    ++I A D G  P  ++    LH++ +    + P
Sbjct:  115 ETRVSENTPLGTIVARVKA----VDKDSTSNADLIYSIQNGNNNGSFTIDN----STGEIMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSGNTDDAFVIIADSGDISLDKPL--------DKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKV---FLVNQTGDIT-------LARELDYE-------------------------------------TRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVF------YYIVTSSVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGKFVIDQNTGV-VTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDEN--TTVGHVILRVTASDLDSSLNGKVLFSILEGNSDGKFVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSP 813          

HSP 2 Score: 154.066 bits (388), Expect = 2.878e-38
Identity = 170/664 (25.60%), Postives = 283/664 (42.62%), Query Frame = 3
Query:  468 PSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFD---GVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTAT--STVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSS------FDREVKDHHQLNIICSDMGVPSLTTTRP--ITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDI-FVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKA---IDNDTGENAKIVYTIQSQTI---FYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKP 2399
            P F++  ++  I E+      +   LARD D   N  V Y+I   +  + + +I   T     S       + FD E    +   + A+D G+P  ++  TI + ITD ND+ P F    Y     E+   G  + +V A DKD +S   ++ S    +   +  S   D   G I T+    +  +   Y + I   D+G P L++   + V++ V D NDN P  E A   +     + EN    + + +VT  DKD G N  ++  + +             N     ++ A +         D+E  +++ L +I +DMG+P L + +   + V+V   N++ P F  +  + SI ENLP+GT + R++A++ D+ V A+  Y++         +   +G IT     D E +  Y+            M  ++T    +L           T   H               D+D G N Q+ Y++   S     + N     VS    LDRE V +Y++ + A+D G+ P T+S  V++ + D NDN P F        L LS  T  GT+I    A    D D G NA+I Y ++   +   F IN + G I + +++  E        + A D G    T +SS+ +  I    ++P
Sbjct:    1 PIFNQTLYSAIIPEDFTVGGTLLTVLARDQDAALNARVTYSIVSFSTESDYFVIDNITGVVRSS-------KEFDYETQRMYSFSVRAEDRGSPIRSAIATIHVQITDTNDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQNGN---NNGSFTIDNSTGEIMTRKEFDFEKTE-RYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPP--EFA--QKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSG------------NTDDAFVIIADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYE----------FEMYENVTSGTQVL-----------TLFAH---------------DRDEGINGQVFYYIVTSSVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLY--YTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRP 599          

HSP 3 Score: 113.62 bits (283), Expect = 1.568e-25
Identity = 101/326 (30.98%), Postives = 155/326 (47.55%), Query Frame = 3
Query: 1470 PIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLEN--FNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL-RTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFLFNP--SPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSS--TTVEIIIDDINDNSPTFIEPK--PGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTI---FYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPP 2405
            PIF +   S  I E+  +G  +  + A D+D  +NA++ Y +     E+  F ID  +G++ +   FD E Q  Y     A D      ++  TIHV I D NDN P F    +   + EN  L  ++ RV+AVDKD   NA + Y + N   +  F I  +    +++K + D E+ +RY++ I   D G   L+S     V II+ D NDN P F + +     + N ++    GT +    A D D+G NA + Y+I S      F I    G I L+K L  E I    +++   D GI P  +   + +N I SG ++  P
Sbjct:    1 PIFNQTLYSAIIPEDFTVGGTLLTVLARDQDAALNARVTYSIVSFSTESDYFVIDNITGVVRSSKEFDYETQRMYSFSVRAEDRGSPIRSAIATIHVQITDTNDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQNGNNNGSFTIDNSTGEIMTRKEF-DFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTV----GTVVLRVTAHDKDSGPNAMLKYSIHSGNTDDAFVIIADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAP 321          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 292.738 bits (748), Expect = 2.475e-82
Identity = 237/795 (29.81%), Postives = 371/795 (46.67%), Query Frame = 3
Query:  174 VEENSPIFVRICNVKKTFPDIENP-----TIDNFQNFFRLNDNNVEML---QSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPK-----FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAI-------------------------KPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGV-----ISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSN----QNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFE---NRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYF-LFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHL 2369
            + E  P  VR+ NV      +        T+++   FF++++   E+    + +DRE L   Q+C    Q  ++ +++C +  E+S  GP       ++  +++ D+NDN PSF        + EN P      LP A D D G NG   Y +                         + ++ S+ F L    T  G     +L I  + DRE  + ++L L  +D G+PP +S   +++ ITDVND+ P+F +S Y  + PE+   G  I Q+ A D D+            + QI   F  A + V     +      + V    D       R  ++A D G P     +TV++++ D NDN P IEI        ++    + E+   ++ IA V VSD+D G NG V C +  +  F L+     E   N++ Y L T+  +  D E    + + I+  D G PSLT+   + V V D NDNPPIF +    VS  EN   G +VT + A D D G NA+I Y L       F+ID  SG I    + DRE +  Y+ K  A D  I  +  S T+ V + D+NDN PKF++  F+F++KENL+    +G V  +D D GQNA+M  F           +  G IF +     DRE+   Y+  + A D G+ P +++ TV + + D NDN+PT   P    +  L   +   T + T  A D DTG NA + Y+I       +F I+ + G I L   L+ +H    ++++   D+G   ++TT+ +H+
Sbjct:   34 LAEEGPADVRVGNVAADLGMVAGSREVTFTLESGSEFFKIDNITGELTTNEKRIDREKL---QQC----QMIFD-ENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQP-QLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVG----------VNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTS--APLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLS--FDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHV 805          

HSP 2 Score: 62.3882 bits (150), Expect = 3.224e-9
Identity = 62/236 (26.27%), Postives = 98/236 (41.53%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFN---QSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIE 1136
            +LV D NDN P F +  F F + EN   ++ V +    D D+G N  +            F+          + +  +    SFDRE    +   + A D G+PP +++ T+ + + D ND+AP       SSY    P S V+   +  V ATD D      +  S    +           GVIS    L        +R+ +   D+G P+ + T+ V V+V +   N  I+E
Sbjct:  595 VLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEM----------GLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVR-TVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGL-HRLVVQVTDNGQPSQSTTTLVHVYVNETLSNSTIVE 818          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 292.738 bits (748), Expect = 4.929e-82
Identity = 237/795 (29.81%), Postives = 371/795 (46.67%), Query Frame = 3
Query:  174 VEENSPIFVRICNVKKTFPDIENP-----TIDNFQNFFRLNDNNVEML---QSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPK-----FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAI-------------------------KPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGV-----ISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSN----QNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFE---NRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYF-LFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHL 2369
            + E  P  VR+ NV      +        T+++   FF++++   E+    + +DRE L   Q+C    Q  ++ +++C +  E+S  GP       ++  +++ D+NDN PSF        + EN P      LP A D D G NG   Y +                         + ++ S+ F L    T  G     +L I  + DRE  + ++L L  +D G+PP +S   +++ ITDVND+ P+F +S Y  + PE+   G  I Q+ A D D+            + QI   F  A + V     +      + V    D       R  ++A D G P     +TV++++ D NDN P IEI        ++    + E+   ++ IA V VSD+D G NG V C +  +  F L+     E   N++ Y L T+  +  D E    + + I+  D G PSLT+   + V V D NDNPPIF +    VS  EN   G +VT + A D D G NA+I Y L       F+ID  SG I    + DRE +  Y+ K  A D  I  +  S T+ V + D+NDN PKF++  F+F++KENL+    +G V  +D D GQNA+M  F           +  G IF +     DRE+   Y+  + A D G+ P +++ TV + + D NDN+PT   P    +  L   +   T + T  A D DTG NA + Y+I       +F I+ + G I L   L+ +H    ++++   D+G   ++TT+ +H+
Sbjct:   34 LAEEGPADVRVGNVAADLGMVAGSREVTFTLESGSEFFKIDNITGELTTNEKRIDREKL---QQC----QMIFD-ENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQP-QLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVG----------VNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTS--APLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLS--FDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHV 805          

HSP 2 Score: 62.003 bits (149), Expect = 3.711e-9
Identity = 62/236 (26.27%), Postives = 98/236 (41.53%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFN---QSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIE 1136
            +LV D NDN P F +  F F + EN   ++ V +    D D+G N  +            F+          + +  +    SFDRE    +   + A D G+PP +++ T+ + + D ND+AP       SSY    P S V+   +  V ATD D      +  S    +           GVIS    L        +R+ +   D+G P+ + T+ V V+V +   N  I+E
Sbjct:  595 VLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEM----------GLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVR-TVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGL-HRLVVQVTDNGQPSQSTTTLVHVYVNETLSNSTIVE 818          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 292.738 bits (748), Expect = 9.617e-82
Identity = 237/795 (29.81%), Postives = 372/795 (46.79%), Query Frame = 3
Query:  174 VEENSPIFVRICNVKKTFPDIENP-----TIDNFQNFFRLNDNNVEML---QSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPK-----FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAI-------------------------KPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGV-----ISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSN----QNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFE---NRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYF-LFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHL 2369
            + E  P  VR+ NV      +        T+++   FF++++   E+    + +DRE L   Q+C    Q  ++ +++C +  E+S  GP       ++  +++ D+NDN PSF        + EN P      LP A D D G NG   Y +                         + ++ S+ F L    T  G +   +L I  + DRE  + ++L L  +D G+PP +S   +++ ITDVND+ P+F +S Y  + PE+   G  I Q+ A D D+            + QI   F  A + V     +      + V    D       R  ++A D G P     +TV++++ D NDN P IEI        ++    + E+   ++ IA V VSD+D G NG V C +  +  F L+     E   N++ Y L T+  +  D E    + + I+  D G PSLT+   + V V D NDNPPIF +    VS  EN   G +VT + A D D G NA+I Y L       F+ID  SG I    + DRE +  Y+ K  A D  I  +  S T+ V + D+NDN PKF++  F+F++KENL+    +G V  +D D GQNA+M  F           +  G IF +     DRE+   Y+  + A D G+ P +++ TV + + D NDN+PT   P    +  L   +   T + T  A D DTG NA + Y+I       +F I+ + G I L   L+ +H    ++++   D+G   ++TT+ +H+
Sbjct:   38 LAEEGPADVRVGNVAADLGMVAGSREVTFTLESGSEFFKIDNITGELTTNEKRIDREKL---QQC----QMIFD-ENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDG-EKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVG----------VNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTS--APLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLS--FDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHV 809          

HSP 2 Score: 62.003 bits (149), Expect = 4.065e-9
Identity = 62/236 (26.27%), Postives = 98/236 (41.53%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFN---QSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIE 1136
            +LV D NDN P F +  F F + EN   ++ V +    D D+G N  +            F+          + +  +    SFDRE    +   + A D G+PP +++ T+ + + D ND+AP       SSY    P S V+   +  V ATD D      +  S    +           GVIS    L        +R+ +   D+G P+ + T+ V V+V +   N  I+E
Sbjct:  599 VLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEM----------GLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVR-TVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGL-HRLVVQVTDNGQPSQSTTTLVHVYVNETLSNSTIVE 822          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 292.352 bits (747), Expect = 1.085e-81
Identity = 237/795 (29.81%), Postives = 372/795 (46.79%), Query Frame = 3
Query:  174 VEENSPIFVRICNVKKTFPDIENP-----TIDNFQNFFRLNDNNVEML---QSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPK-----FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAI-------------------------KPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGV-----ISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSN----QNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFE---NRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYF-LFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQT---IFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHL 2369
            + E  P  VR+ NV      +        T+++   FF++++   E+    + +DRE L   Q+C    Q  ++ +++C +  E+S  GP       ++  +++ D+NDN PSF        + EN P      LP A D D G NG   Y +                         + ++ S+ F L    T  G +   +L I  + DRE  + ++L L  +D G+PP +S   +++ ITDVND+ P+F +S Y  + PE+   G  I Q+ A D D+            + QI   F  A + V     +      + V    D       R  ++A D G P     +TV++++ D NDN P IEI        ++    + E+   ++ IA V VSD+D G NG V C +  +  F L+     E   N++ Y L T  ++  D E    + + I+  D G PSLT+   + V V D NDNPPIF +    VS  EN   G +VT + A D D G NA+I Y L       F+ID  SG I    + DRE +  Y+ K  A D  I  +  S T+ V + D+NDN PKF++  F+F++KENL+    +G V  +D D GQNA+M  F           +  G IF +     DRE+   Y+  + A D G+ P +++ TV + + D NDN+PT   P    +  L   +   T + T  A D DTG NA + Y+I       +F I+ + G I L   L+ +H    ++++   D+G   ++TT+ +H+
Sbjct:   34 LAEEGPADVRVGNVAADLGMVAGSREVTFTLESGSEFFKIDNITGELTTNEKRIDREKL---QQC----QMIFD-ENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDG-EKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVG----------VNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHT--SAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLS--FDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHV 805          

HSP 2 Score: 62.003 bits (149), Expect = 4.202e-9
Identity = 62/236 (26.27%), Postives = 98/236 (41.53%), Query Frame = 3
Query:  438 ILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFN---QSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIE 1136
            +LV D NDN P F +  F F + EN   ++ V +    D D+G N  +            F+          + +  +    SFDRE    +   + A D G+PP +++ T+ + + D ND+AP       SSY    P S V+   +  V ATD D      +  S    +           GVIS    L        +R+ +   D+G P+ + T+ V V+V +   N  I+E
Sbjct:  595 VLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEM----------GLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVR-TVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGL-HRLVVQVTDNGQPSQSTTTLVHVYVNETLSNSTIVE 818          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh11 (protocadherin-11 X-linked [Source:NCBI gene;Acc:101161492])

HSP 1 Score: 285.419 bits (729), Expect = 4.031e-80
Identity = 233/771 (30.22%), Postives = 375/771 (48.64%), Query Frame = 3
Query:  117 LVSLFIYINILWYSNG-ECVVEENSPIFVRICNVKKTFPDIENPTID-----NFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQ-YNYNRDSQCILILELSGSGPKFYQL---PILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIAS--SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLR-TFSFHIKENLE--GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNL-SIETIQGTKIFTAKAIDNDTGENAKIVYTIQS----------QTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG 2333
            LV L   + IL  +   + +V+E  P  VRI N+ K      +P+I       F+  ++  D  +  +++   E   TN + D  K       + +C   +E++    + ++L     L+ DVNDN P F     N  I EN+  +    +P A DPD G NG   Y +  S    +F L    T +G D   +L + Q+ DRE  + F + +  +D GNPP +S+  +++ I+DVND+ P F  S    + PE+   G ++ Q+ ATD D  S   I  +   S+QI       F   I++   L+ V    D      +++ ++A D G  +  + +TV+V+VTD+NDN P I+     +  N  ++L+EN   N+ IA +TV+DKD    G+V C  D++  F L+ + N      + L TA  +  D E    + + I+ SD G P L T+  + + +KDENDN PIF +    +SI EN    T++ ++ A D D G NA+I Y L P+  + F+ID  SG+++     DRE Q  +     A D+    + S++T+ + + D NDN P F    ++F++ ENL   G +G +   D D G NA +   + N    F I     + +      DRE+   Y+  + A D G  P +S   V I + D+NDN P F+ P      +L    T  G  +    AIDNDTG NA++ Y+I S          + +F I+   G+I L + +    +   ++++  RD G
Sbjct:   10 LVVLLTCVLILCKAQERDYIVKEEQPENVRIGNLLKDLDLNLDPSIRLSSPLQFKPVYKTGDVPLVRVEANTGEIFTTNHRIDREKLCSGVFTEKRCYYEIEVAVLPDEIFRLVKIRFLIEDVNDNAPLFQSTVINISIPENTAINTRYPVPSAFDPDVGINGIQNYELVKSV--TEFGLDIIETPEG-DKWPQLIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIHFA--FSNQISSSTKRHF--AINSSTGLITVKQPLDREVTPVHKLIVLASDGG--STPSRATVIVNVTDVNDNVPAIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACYTDHDVPFRLKPVFN----DQFLLETA--APLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDGFHIDRRSGILSVGKRLDREKQERFSFIVIARDNGSTPLQSNVTVRLIVQDLNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAAITLSILNGKDNFIIDPQTGV-IKPNITFDREQQSSYTFMVKAIDGGQPPTSSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVRTTTTPGAVVTRVFAIDNDTGMNAELQYSIISSIIITSRVSPRGLFTIDKISGNITLQEKIVGADLGLHRLVVKVRDLG 764          

HSP 2 Score: 171.014 bits (432), Expect = 8.207e-43
Identity = 204/794 (25.69%), Postives = 350/794 (44.08%), Query Frame = 3
Query:  174 VEENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDNNVEMLQSLDRE---NLITNQKCDTSKQYNYNRDSQCILI-LELSGSGPKFYQ--LPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQG---HDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNT-------PESIVQGQAIGQVFATDKD--ISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFL---RTFSFHIKENLE---GVLGRVEAVDKDIGQNAQMDYFLFN---------PSPLFEISR-NGDIFVSQKRYLDRERVDRYSIEIGARDHGN-RPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQ-SQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSG--IIP--------------KTTTSSLHLNFIRSGKSKP 2399
            + EN+ I  R        PD+    I N++    + +  ++++++ + +    LI  Q  D  K     RD+  + I +E  G+ PK     L + ++DVNDN P F        + EN+P    V    A D D G+N  + +A      SN+   IS ST +    + S+  + + Q  DRE+    +LI++A D G+ P  S  T+ +++TDVND+ P  + + Y  N         E+      I  +  TDKD  +  +V          ++   F+  F  ++ T   L Y  ++ +Y I I+A D G P L  ++ VL+ + D NDN PI          +L + EN   ++ + K++ +D D G+N ++       Y    ++   F   R   +++      DRE ++     +I  D G   L +   + ++V+D NDN P F     +  + ENLP+   V  +   D D G NA I   +     +NF IDP +G+I   ++FDRE QS Y     A D      +S   + + ++D NDN P F+     +S+ +         V+ RV A+D D G NA++ Y + +         P  LF I + +G+I + +K       + R  +++  RD G    L + T V + ++D   N+ TFI+    + L  S+ET     I  ++      G    ++  I  + T+  +      I++   ++       K++   + SG  + P              K +  SL LNF+   +SKP
Sbjct:  148 IPENTAINTRYPVPSAFDPDVGINGIQNYELVKSVTEFGLDIIETPEGDKWPQLIVQQNLDREK-----RDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIHFAF-----SNQ---ISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDGGSTP--SRATVIVNVTDVNDNVPAID-TRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACYTDHDVPFRLKPVFNDQF--LLETAAPLDY-ETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIF----PQPEIQLSIPENNDPSTQLIKISATDADSGSNAEII------YTLGPDAPDGFHIDRRSGILSV-GKRLDREKQERFSFIVIARDNGSTPLQSNVTVRLIVQDLNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAAITLSIL-NGKDNFIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTSSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVRTTTTPGAVVTRVFAIDNDTGMNAELQYSIISSIIITSRVSPRGLFTIDKISGNITLQEKIVGADLGLHRLVVKV--RDLGQPESLQAITLVHLFVNDTVSNA-TFIQ----EQLRKSMETPLDRNIGDSEVTPQANGYVIVVIAIIAGTMTVILV------IFVTALVRCRQTPRHKVVQKGKQSGEWVSPNQDNRQIKKKKKRKKRSPKSLLLNFVTIDESKP 897          

HSP 3 Score: 149.443 bits (376), Expect = 4.490e-36
Identity = 132/444 (29.73%), Postives = 202/444 (45.50%), Query Frame = 3
Query: 1101 VTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYL-FNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKY----MLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKF-------LRTFSFHIKEN--LEGVLGRVEAVDKDIGQNAQMDYFL-----FNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTI--QSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHL 2369
            + D+NDN P+ +    N    + + EN   N+     +  D D G NG    +L  +   F L+ I+  E  +  +L+     + DRE +D   + I   D G P  ++T  + V + D NDN PIF      VS+ EN P GT V +L A D D G NAQI +     +S     +F I+  +G+IT +   DREV   +K+   A D       +++ ++VT  D NDN P         L   +  + EN  L   +  +   DKD     ++  +      F   P+F    N    +     LD E    Y+I+I A D G  PL +S  V I I D NDN+P F  P+P   L++       T++    A D D+G NA+I+YT+   +   F+I+   G + + K L  E       I+ ARD+G  P  +  ++ L
Sbjct:  129 IEDVNDNAPLFQSTVIN----ISIPENTAINTRYPVPSAFDPDVGINGIQNYELVKSVTEFGLDIIETPEGDKWPQLIVQ--QNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDGGSTPSRATVIVNVT--DVNDNVPAIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACYTDHDVPFRLKPVF----NDQFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIF--PQPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDGFHIDRRSGILSVGKRLDREKQERFSFIVIARDNGSTPLQSNVTVRL 558          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000014472.1 (SMESG000014472.1)

HSP 1 Score: 2155.95 bits (5585), Expect = 0.000e+0
Identity = 1058/1062 (99.62%), Postives = 1061/1062 (99.91%), Query Frame = 3
Query:   99 MKTWMTLVSLFIYINILWYSNGECVVEENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNKKIEPKSSLSRDXXXXXXXXXXXXXFTCLLMLVTYFCASMIVQKRRQQRRMNIKDEIGNGRRNDGWFYVYCCCEPAAAASADLTTNRQCHKAINIPPGSTVDRKCSLPVCLNRWDKSKEIGLEEDPLYSYREFTMKPSVVNSHTPVVYDRMMSVPRTVNPYWQYKTIADPNIGFCSNFMSEDQNLPEVVYHQGNAYLYKHSRPDLGDCNSLEVISQNIYGDLSPSTVQSSIKLSLLPQANFENERTNKIENESLKSVSVERLDESKEQFFQPNSRYAGYVVGSPCYANSFV 3284
            MKTWMTLVSLFIYINILWYSNGECVVEENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDNNVE+LQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVAD+NDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNKKIEPKSSLSRDLVLSLGIGLVLLIFTCLLMLVTYFCASMIVQKRRQQRRMNIKDEIGNGRRNDGWFYVYCCCEPAAAASADLTTNRQCHKAINIPP STVDRKCSLPVCLNRWDKSKEIGLEEDPLYSYREFTMKPSVVNSHTPVVYDRMMSVPRTVNPYWQYKTIADPNIGFCSNFMSEDQNLPEVVYHQGNAYLYKHSRPDLGDCNSLEVISQNIYGDLSPSTVQSSIKLSLLPQANFENERTNK+ENESLKSVSVERLDESKEQFFQPNSRYAGYVVGSPCYANSFV
Sbjct:    1 MKTWMTLVSLFIYINILWYSNGECVVEENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDNNVELLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADINDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNKKIEPKSSLSRDLVLSLGIGLVLLIFTCLLMLVTYFCASMIVQKRRQQRRMNIKDEIGNGRRNDGWFYVYCCCEPAAAASADLTTNRQCHKAINIPPSSTVDRKCSLPVCLNRWDKSKEIGLEEDPLYSYREFTMKPSVVNSHTPVVYDRMMSVPRTVNPYWQYKTIADPNIGFCSNFMSEDQNLPEVVYHQGNAYLYKHSRPDLGDCNSLEVISQNIYGDLSPSTVQSSIKLSLLPQANFENERTNKMENESLKSVSVERLDESKEQFFQPNSRYAGYVVGSPCYANSFV 1062          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000014472.1 (SMESG000014472.1)

HSP 1 Score: 2144.01 bits (5554), Expect = 0.000e+0
Identity = 1054/1058 (99.62%), Postives = 1057/1058 (99.91%), Query Frame = 3
Query:  111 MTLVSLFIYINILWYSNGECVVEENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNKKIEPKSSLSRDXXXXXXXXXXXXXFTCLLMLVTYFCASMIVQKRRQQRRMNIKDEIGNGRRNDGWFYVYCCCEPAAAASADLTTNRQCHKAINIPPGSTVDRKCSLPVCLNRWDKSKEIGLEEDPLYSYREFTMKPSVVNSHTPVVYDRMMSVPRTVNPYWQYKTIADPNIGFCSNFMSEDQNLPEVVYHQGNAYLYKHSRPDLGDCNSLEVISQNIYGDLSPSTVQSSIKLSLLPQANFENERTNKIENESLKSVSVERLDESKEQFFQPNSRYAGYVVGSPCYANSFV 3284
            MTLVSLFIYINILWYSNGECVVEENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDNNVE+LQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVAD+NDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNKKIEPKSSLSRDLVLSLGIGLVLLIFTCLLMLVTYFCASMIVQKRRQQRRMNIKDEIGNGRRNDGWFYVYCCCEPAAAASADLTTNRQCHKAINIPP STVDRKCSLPVCLNRWDKSKEIGLEEDPLYSYREFTMKPSVVNSHTPVVYDRMMSVPRTVNPYWQYKTIADPNIGFCSNFMSEDQNLPEVVYHQGNAYLYKHSRPDLGDCNSLEVISQNIYGDLSPSTVQSSIKLSLLPQANFENERTNK+ENESLKSVSVERLDESKEQFFQPNSRYAGYVVGSPCYANSFV
Sbjct:    1 MTLVSLFIYINILWYSNGECVVEENSPIFVRICNVKKTFPDIENPTIDNFQNFFRLNDNNVELLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPKFYQLPILVADINDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPPMNKKIEPKSSLSRDLVLSLGIGLVLLIFTCLLMLVTYFCASMIVQKRRQQRRMNIKDEIGNGRRNDGWFYVYCCCEPAAAASADLTTNRQCHKAINIPPSSTVDRKCSLPVCLNRWDKSKEIGLEEDPLYSYREFTMKPSVVNSHTPVVYDRMMSVPRTVNPYWQYKTIADPNIGFCSNFMSEDQNLPEVVYHQGNAYLYKHSRPDLGDCNSLEVISQNIYGDLSPSTVQSSIKLSLLPQANFENERTNKMENESLKSVSVERLDESKEQFFQPNSRYAGYVVGSPCYANSFV 1058          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000033799.1 (SMESG000033799.1)

HSP 1 Score: 392.889 bits (1008), Expect = 9.108e-119
Identity = 265/758 (34.96%), Postives = 418/758 (55.15%), Query Frame = 3
Query:  168 CVVEENSPIFVRICNVKKTFPDIENPTID--NFQNFFRLN-DNNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPK---FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQ-SSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIAS-SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLES--IQNFEN-RRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNI--DPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEGVLGRVEAVDKDIGQNAQMDY----FLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIET-IQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNF 2375
            C  +E++PI   +C++   F     P +   +++N F++N  N + ++ S+DRE+L                   CI+    + + PK    +QLPI + D+NDN P FD+L++N +I EN  + +  +LP+ARD D G N  ++Y+I+       F L+    N+    ++KL     FDRE  + ++L+ IA D G P  T  + I I I D+NDHAP+F+    Y     E  ++G  I  +  TDKD  + +T++++ ++  ++   F V+    ++    L Y SS   + IPIIAVD+G P LT ++T+ V+V DINDN P I I + S+ ++   L EN    S++A VTV+D D   NG V+C L   +N   F L S    NF N +R+Y++VT     FDRE   H+++ + C D G+P L++ + IT+ ++DENDNPP F +      I EN+  G+ +  L A D DIG NA+I Y + PE  +N     +P +G++T  VSFDRE+ +    KA A D     +NSS+ + + I DEND  P FL + + F IKE   G +G+VEA D D   N+ + +    FL N   L+ +  +G+IF  +   LDRE    Y + + A+D+G    +SS  V+I ++DINDNSP F +P    ++    ET + GT I    A D+D  EN K+ Y + +   F I+   G +++N++L    ++P +++I A+D+G    TTT++L L F
Sbjct:   34 CRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESL---------------NPVDCIV----NKTKPKDFQIFQLPIDIEDINDNSPIFDKLSYNIEIDENIQSGHIQQLPVARDSDYGINSEIIYSIE-GKDKGFFKLLQMKNNKPIFKTMKL-----FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPIIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTL--REFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYDNDSNSNSDIIFSFTGFLHN--HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQLLF 761          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000033799.1 (SMESG000033799.1)

HSP 1 Score: 392.504 bits (1007), Expect = 2.198e-118
Identity = 265/758 (34.96%), Postives = 418/758 (55.15%), Query Frame = 3
Query:  168 CVVEENSPIFVRICNVKKTFPDIENPTID--NFQNFFRLN-DNNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILELSGSGPK---FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQ-SSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIAS-SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLES--IQNFEN-RRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNI--DPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEGVLGRVEAVDKDIGQNAQMDY----FLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIET-IQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNF 2375
            C  +E++PI   +C++   F     P +   +++N F++N  N + ++ S+DRE+L                   CI+    + + PK    +QLPI + D+NDN P FD+L++N +I EN  + +  +LP+ARD D G N  ++Y+I+       F L+    N+    ++KL     FDRE  + ++L+ IA D G P  T  + I I I D+NDHAP+F+    Y     E  ++G  I  +  TDKD  + +T++++ ++  ++   F V+    ++    L Y SS   + IPIIAVD+G P LT ++T+ V+V DINDN P I I + S+ ++   L EN    S++A VTV+D D   NG V+C L   +N   F L S    NF N +R+Y++VT     FDRE   H+++ + C D G+P L++ + IT+ ++DENDNPP F +      I EN+  G+ +  L A D DIG NA+I Y + PE  +N     +P +G++T  VSFDRE+ +    KA A D     +NSS+ + + I DEND  P FL + + F IKE   G +G+VEA D D   N+ + +    FL N   L+ +  +G+IF  +   LDRE    Y + + A+D+G    +SS  V+I ++DINDNSP F +P    ++    ET + GT I    A D+D  EN K+ Y + +   F I+   G +++N++L    ++P +++I A+D+G    TTT++L L F
Sbjct:   50 CRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESL---------------NPVDCIV----NKTKPKDFQIFQLPIDIEDINDNSPIFDKLSYNIEIDENIQSGHIQQLPVARDSDYGINSEIIYSIE-GKDKGFFKLLQMKNNKPIFKTMKL-----FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPIIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTL--REFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYDNDSNSNSDIIFSFTGFLHN--HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQLLF 777          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000033799.1 (SMESG000033799.1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.737e-118
Identity = 265/759 (34.91%), Postives = 419/759 (55.20%), Query Frame = 3
Query:  168 CVVEENSPIFVRICNVKKTFPDIENPTID--NFQNFFRLN-DNNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILILEL-SGSGPK---FYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQ-SSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIAS-SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLES--IQNFEN-RRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNI--DPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEGVLGRVEAVDKDIGQNAQMDY----FLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIET-IQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNF 2375
            C  +E++PI   +C++   F     P +   +++N F++N  N + ++ S+DRE+L                    +  LE+ + + PK    +QLPI + D+NDN P FD+L++N +I EN  + +  +LP+ARD D G N  ++Y+I+       F L+    N+    ++KL     FDRE  + ++L+ IA D G P  T  + I I I D+NDHAP+F+    Y     E  ++G  I  +  TDKD  + +T++++ ++  ++   F V+    ++    L Y SS   + IPIIAVD+G P LT ++T+ V+V DINDN P I I + S+ ++   L EN    S++A VTV+D D   NG V+C L   +N   F L S    NF N +R+Y++VT     FDRE   H+++ + C D G+P L++ + IT+ ++DENDNPP F +      I EN+  G+ +  L A D DIG NA+I Y + PE  +N     +P +G++T  VSFDRE+ +    KA A D     +NSS+ + + I DEND  P FL + + F IKE   G +G+VEA D D   N+ + +    FL N   L+ +  +G+IF  +   LDRE    Y + + A+D+G    +SS  V+I ++DINDNSP F +P    ++    ET + GT I    A D+D  EN K+ Y + +   F I+   G +++N++L    ++P +++I A+D+G    TTT++L L F
Sbjct:   34 CRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESL------------------NPVDFLEIVNKTKPKDFQIFQLPIDIEDINDNSPIFDKLSYNIEIDENIQSGHIQQLPVARDSDYGINSEIIYSIE-GKDKGFFKLLQMKNNKPIFKTMKL-----FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPIIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTL--REFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYDNDSNSNSDIIFSFTGFLHN--HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQLLF 763          
The following BLAST results are available for this feature:
BLAST of Protocadherin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11X3.827e-8332.14protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X5.591e-8232.14protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X6.025e-8232.14protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X6.095e-8232.14protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X8.825e-8232.14protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-17.641e-5828.46FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-18.166e-5230.20FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-13.914e-3725.26CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-41.726e-3325.63Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
hmr-13.134e-3127.70Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ft1.011e-6430.06gene:FBgn0001075 transcript:FBtr0077478[more]
ds1.391e-6129.21gene:FBgn0284247 transcript:FBtr0078045[more]
ds1.391e-6129.21gene:FBgn0284247 transcript:FBtr0343249[more]
stan2.983e-5429.91gene:FBgn0024836 transcript:FBtr0304900[more]
stan3.168e-5429.91gene:FBgn0024836 transcript:FBtr0304899[more]
back to top
BLAST of Protocadherin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh113.781e-8530.71protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh117.208e-8530.71protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
CT030123.18.041e-7728.77protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CR847522.11.222e-7631.63pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
pcdh91.306e-7631.63protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000047798.16.105e-8330.97protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.19.581e-8330.97protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047804.11.091e-8230.97protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
emc72.968e-7628.48ER membrane protein complex subunit 7 [Source:Xenb... [more]
emc73.539e-7628.48ER membrane protein complex subunit 7 [Source:Xenb... [more]
back to top
BLAST of Protocadherin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11x1.550e-8131.30protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x4.984e-8131.30protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x3.090e-8031.30protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x3.527e-8031.50protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x3.527e-8031.50protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q71M42|PC11X_PANTR7.389e-8232.14Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WYY1|PC11X_PANPA7.813e-8232.14Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q6WXV7|PC11X_PONPY2.497e-8131.21Protocadherin-11 X-linked OS=Pongo pygmaeus OX=960... [more]
sp|Q6X862|PC11X_GORGO2.664e-8132.14Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q9BZA7|PC11X_HUMAN4.238e-8132.14Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Protocadherin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0S1VVS01.841e-8931.14Protocadherin-h OS=Lethenteron camtschaticum OX=98... [more]
A0A210PLG88.767e-8428.85Protocadherin-1 OS=Mizuhopecten yessoensis OX=6573... [more]
W5KV428.963e-8430.65Protocadherin 11 OS=Astyanax mexicanus OX=7994 PE=... [more]
K1R9J31.166e-8330.42Protocadherin-11 X-linked OS=Crassostrea gigas OX=... [more]
A0A3B1ISQ58.335e-8330.65Protocadherin 11 OS=Astyanax mexicanus OX=7994 PE=... [more]
back to top
BLAST of Protocadherin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh113.395e-8730.65protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh113.157e-8630.65protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh113.553e-8630.74protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh91.126e-7430.77protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh7b1.187e-7429.77protocadherin 7 [Source:NCBI gene;Acc:103034658][more]
back to top
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh112.324e-7030.48protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000010725.12.417e-5927.03pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000008517.12.979e-5828.86pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000004043.11.024e-5428.32pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004042.11.171e-5428.32pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354121.151e-6933.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482371.350e-6630.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461892.279e-6529.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404703.518e-6331.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333591.576e-5626.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh7b2.475e-8229.81protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b4.929e-8229.81protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b9.617e-8229.81protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b1.085e-8129.81protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh114.031e-8030.22protocadherin-11 X-linked [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Protocadherin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014472.10.000e+099.62SMESG000014472.1[more]
SMESG000014472.10.000e+099.62SMESG000014472.1[more]
SMESG000033799.19.108e-11934.96SMESG000033799.1[more]
SMESG000033799.12.198e-11834.96SMESG000033799.1[more]
SMESG000033799.12.737e-11834.91SMESG000033799.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035296 ID=SMED30035296|Name=Protocadherin|organism=Schmidtea mediterranea sexual|type=transcript|length=3415bp
GAATATTAAAACATCAAGGGTGCGGGAATTAGTAATTATGATGACATTAC
TTGTCATAACTCTAAATTCTTTAATCCAAGAAAATAAAAAAGAAAAGGAT
GAAGACATGGATGACCCTAGTGAGTTTATTTATTTATATAAATATTCTTT
GGTATTCAAATGGCGAATGCGTCGTGGAAGAAAACTCGCCTATATTCGTC
CGGATTTGCAACGTTAAAAAAACATTCCCTGACATAGAAAATCCAACTAT
AGACAATTTCCAAAACTTTTTTCGTTTGAATGATAACAATGTCGAGATGC
TGCAAAGTCTGGACCGTGAGAATTTGATAACTAACCAGAAATGTGACACG
AGCAAGCAATACAATTACAATCGAGACAGTCAATGCATCCTTATTTTGGA
ACTTTCGGGGTCTGGACCAAAATTCTACCAGCTGCCTATTCTGGTTGCAG
ATGTCAATGATAACGTTCCGTCTTTTGATAGACTTACGTTCAACTTTAAA
ATCGCCGAAAATTCTCCTGCTCACAATGAGGTCGAGTTGCCGTTGGCGAG
GGATCCTGATAGGGGCAACAATGGTTCAGTAGTCTATGCAATAAAACCAA
GTGCAGTGTCAAACAAATTCGTCCTCATTTCTCCATCAACAAATCAGGGA
CACGATTCCAGTTTGAAGTTAAAGATCCTTCAGTCATTCGATCGAGAAAT
CGACGAAGAATTCCAGTTGATACTCATTGCCAAAGATCTTGGAAATCCTC
CTTTAACATCTTCACTTACAATCAAGATTGACATAACAGACGTGAACGAT
CATGCTCCACAATTCAATCAGTCCTCATATCGGTTCAACACTCCTGAATC
TATTGTCCAAGGCCAAGCAATTGGTCAAGTGTTTGCTACAGACAAGGACA
TTTCAAGTCGAGTGACAATAATGATGTCTCCCAGTGCCAGCAGCCAAATT
ATGGACAAATTCTCAGTAGCATTTGACGGGGTCATTTCTACAAAAGTAGC
ATTAGTCTATGTATCCAGTTCCTTTGACTATCGAATACCTATCATAGCAG
TAGACAGTGGTAATCCGACCTTGACCGCAACGTCTACAGTACTTGTACAC
GTAACCGACATCAATGACAACCGGCCCATCATAGAAATAGCATCAAGTAA
CCAGAATAATAGACTCGTTCTTACAGAAAATTGTCAATCTAATTCATATA
TTGCAAAGGTGACGGTTAGTGATAAAGATCACGGAAATAATGGCCAAGTC
GAATGCAAGTTGGACAATAATTATCTTTTCAATCTGGAGTCAATTCAGAA
CTTTGAAAATCGTCGACATTACAAGTTAGTTACGGCTCCAACGTCCAGTT
TCGACAGAGAAGTGAAAGATCATCATCAATTAAATATTATATGCAGCGAC
ATGGGGGTACCCTCTCTAACAACGACTCGTCCAATCACGGTTGTCGTGAA
AGACGAGAATGACAATCCTCCAATATTCTATAGGCAGCATGAATCGGTAT
CAATCTTAGAAAATTTGCCTATCGGAACGAAAGTAACCCGATTGAAGGCA
ATAGATAAGGATATTGGGGTAAATGCTCAAATAAAGTATATGCTATCCCC
AGAGTGTTTAGAAAACTTTAATATAGATCCTTTCAGCGGAATGATAACGA
CTCGAGTTTCATTCGATAGAGAAGTTCAAAGTGAGTATAAAGTAAAGGCA
ACAGCTTATGACCATCTTATATTAAGAATGAATTCAAGCATCACAATCCA
TGTGACTATCCTAGATGAAAACGACAACCCACCGAAGTTTCTGAGAACCT
TTTCTTTCCATATTAAAGAGAATCTCGAAGGCGTTCTCGGGCGTGTTGAG
GCAGTCGACAAAGATATAGGTCAAAATGCCCAAATGGATTATTTTCTATT
TAATCCTTCACCTTTGTTTGAAATATCAAGAAATGGGGATATTTTCGTGT
CACAGAAACGATATCTAGATAGAGAAAGAGTTGACAGATATAGTATTGAA
ATCGGAGCTCGAGACCATGGCAACCGACCTTTAACGTCATCAACTACCGT
TGAAATCATAATAGACGACATCAATGATAATTCTCCAACCTTCATTGAAC
CGAAACCCGGGCAACATTTGAACTTGTCAATTGAAACCATTCAAGGAACA
AAGATATTTACAGCAAAGGCAATTGACAATGATACAGGAGAAAATGCAAA
AATTGTTTATACGATTCAATCGCAAACCATTTTCTATATAAACACATCGG
ATGGAAGCATATATTTGAACAAGAGTCTCCAAGATGAACATATCCTCCCG
GACAAGATCATAATTTCTGCAAGGGACAGTGGAATTATTCCCAAAACCAC
TACCTCATCTTTGCATTTAAATTTCATTAGGTCCGGCAAATCCAAGCCAC
CTCCAATGAATAAGAAGATCGAACCCAAATCTTCCTTATCTCGAGATCTC
GTTCTTAGTCTCGGTATTGGACTGGTGCTTCTCATTTTCACATGCCTTTT
AATGCTTGTCACTTACTTTTGCGCCTCAATGATCGTACAGAAGCGTCGAC
AGCAAAGACGAATGAATATTAAAGATGAAATTGGCAACGGCCGACGAAAC
GATGGCTGGTTCTACGTTTACTGTTGCTGTGAGCCGGCAGCGGCGGCATC
GGCCGACCTCACCACGAACCGACAATGCCACAAAGCAATAAACATTCCAC
CTGGCTCGACAGTTGATCGGAAATGTAGCTTGCCAGTTTGTTTGAACCGT
TGGGATAAATCTAAAGAGATCGGACTAGAAGAAGATCCTCTCTATTCCTA
CCGAGAGTTTACGATGAAGCCTTCGGTTGTCAACAGTCACACTCCCGTGG
TTTATGACCGCATGATGTCAGTTCCCCGAACAGTAAATCCTTACTGGCAG
TACAAAACAATTGCAGATCCAAATATAGGATTTTGTTCAAACTTCATGTC
AGAAGACCAAAATTTGCCGGAAGTCGTTTATCATCAGGGAAATGCCTACC
TCTACAAACATTCTCGTCCAGATCTAGGGGACTGTAATTCCTTAGAGGTT
ATCAGTCAAAACATTTACGGTGACTTGAGTCCGTCAACAGTGCAAAGCTC
CATCAAATTATCTCTTTTACCTCAAGCAAATTTCGAAAATGAAAGAACTA
ATAAAATAGAAAACGAAAGCCTCAAGTCTGTGTCCGTTGAGCGTCTTGAC
GAATCGAAAGAGCAATTTTTCCAGCCAAACAGCCGCTACGCTGGTTACGT
CGTCGGCAGTCCGTGTTACGCAAACAGTTTTGTATAAAAATGACGCTACA
ATTTTCTTTTATGATAATTCTCTTTTAATAGCTACAAATACAAATAAAGA
TATATACATATACATATATACACATAGAGATATAGATATATTAATCAACG
GTATTTTGCTGTCAG
back to top

protein sequence of SMED30035296-orf-1

>SMED30035296-orf-1 ID=SMED30035296-orf-1|Name=SMED30035296-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1063bp
MKTWMTLVSLFIYINILWYSNGECVVEENSPIFVRICNVKKTFPDIENPT
IDNFQNFFRLNDNNVEMLQSLDRENLITNQKCDTSKQYNYNRDSQCILIL
ELSGSGPKFYQLPILVADVNDNVPSFDRLTFNFKIAENSPAHNEVELPLA
RDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDRE
IDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPE
SIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKV
ALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASS
NQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQ
NFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVV
KDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLS
PECLENFNIDPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITI
HVTILDENDNPPKFLRTFSFHIKENLEGVLGRVEAVDKDIGQNAQMDYFL
FNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTT
VEIIIDDINDNSPTFIEPKPGQHLNLSIETIQGTKIFTAKAIDNDTGENA
KIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKT
TTSSLHLNFIRSGKSKPPPMNKKIEPKSSLSRDLVLSLGIGLVLLIFTCL
LMLVTYFCASMIVQKRRQQRRMNIKDEIGNGRRNDGWFYVYCCCEPAAAA
SADLTTNRQCHKAINIPPGSTVDRKCSLPVCLNRWDKSKEIGLEEDPLYS
YREFTMKPSVVNSHTPVVYDRMMSVPRTVNPYWQYKTIADPNIGFCSNFM
SEDQNLPEVVYHQGNAYLYKHSRPDLGDCNSLEVISQNIYGDLSPSTVQS
SIKLSLLPQANFENERTNKIENESLKSVSVERLDESKEQFFQPNSRYAGY
VVGSPCYANSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
GO:0010923negative regulation of phosphatase activity
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 546..563
score: 42.47
coord: 239..268
score: 33.28
coord: 512..538
score: 26.09
coord: 310..322
score: 33.4
coord: 458..471
score: 29.23
coord: 324..343
score: 47.49
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 371..458
e-value: 1.0E-16
score: 71.5
coord: 148..237
e-value: 8.7E-19
score: 78.4
coord: 482..562
e-value: 2.0E-22
score: 90.5
coord: 583..663
e-value: 2.8E-22
score: 90.0
coord: 689..768
e-value: 0.0096
score: 24.5
coord: 261..343
e-value: 4.7E-9
score: 46.1
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 568..655
e-value: 3.4E-14
score: 53.1
coord: 679..756
e-value: 9.9E-11
score: 41.9
coord: 131..230
e-value: 5.9E-12
score: 45.9
coord: 358..450
e-value: 1.9E-7
score: 31.4
coord: 466..555
e-value: 6.9E-15
score: 55.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 560..661
e-value: 1.2E-22
score: 82.5
coord: 120..234
e-value: 6.3E-24
score: 86.6
coord: 235..342
e-value: 1.1E-20
score: 76.2
coord: 456..559
e-value: 5.3E-27
score: 96.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 343..455
e-value: 2.1E-21
score: 78.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 662..760
e-value: 5.1E-15
score: 57.9
NoneNo IPR availablePANTHERPTHR24028:SF257coord: 51..602
coord: 620..756
coord: 548..668
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 51..602
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 620..756
coord: 548..668
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 461..564
score: 23.901
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 350..460
score: 18.749
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 683..770
score: 13.97
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 127..239
score: 22.278
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 240..345
score: 19.429
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 52..126
score: 9.388
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 564..665
score: 22.037
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 567..661
e-value: 3.08568E-23
score: 93.1469
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 243..341
e-value: 4.71137E-17
score: 75.4277
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 466..560
e-value: 8.20528E-29
score: 108.94
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 130..235
e-value: 3.41254E-21
score: 87.3689
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 355..456
e-value: 7.63729E-18
score: 77.7389
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 683..758
e-value: 1.51992E-13
score: 65.4125
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.813
NoneNo IPR availableTMHMMTMhelixcoord: 791..813
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 653..663
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 448..458
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 227..237
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 333..343
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 338..452
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 119..232
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 227..360
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 448..571
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 653..769
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 552..666