CCHC-type domain-containing protein

Overview
NameCCHC-type domain-containing protein
Smed IDSMED30035290
Length (bp)1614
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CCHC-type domain-containing protein (SMED30035290) t-SNE clustered cells

Violin plots show distribution of expression levels for CCHC-type domain-containing protein (SMED30035290) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CCHC-type domain-containing protein (SMED30035290) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CCHC-type domain-containing protein (SMED30035290) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035290

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035290h1SMcG0004919 SmedASXL_007271SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30035290h1SMcG0004919 SmedASXL_007270SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 239.58 bits (610), Expect = 1.794e-71
Identity = 131/288 (45.49%), Postives = 179/288 (62.15%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELG 1455
            +P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ + NLI  + AL P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC       P        A+++ EY + + ELG
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQ--DKARMDKEYLSLMAELG 321          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 239.195 bits (609), Expect = 4.640e-71
Identity = 131/288 (45.49%), Postives = 179/288 (62.15%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELG 1455
            +P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ + NLI  + AL P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC       P        A+++ EY + + ELG
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQ--DKARMDKEYLSLMAELG 321          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 239.195 bits (609), Expect = 1.596e-70
Identity = 131/288 (45.49%), Postives = 179/288 (62.15%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELG 1455
            +P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ + NLI  + AL P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC       P        A+++ EY + + ELG
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQ--DKARMDKEYLSLMAELG 321          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 239.58 bits (610), Expect = 2.475e-70
Identity = 131/288 (45.49%), Postives = 179/288 (62.15%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELG 1455
            +P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ + NLI  + AL P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC       P        A+++ EY + + ELG
Sbjct:  165 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQ--DKARMDKEYLSLMAELG 446          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 238.424 bits (607), Expect = 3.439e-70
Identity = 131/288 (45.49%), Postives = 179/288 (62.15%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELG 1455
            +P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ + NLI  + AL P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC       P        A+++ EY + + ELG
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP--QSAQDKARMDKEYLSLMAELG 321          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: sfa-1 (SF1 protein; Splicing FActor [Source:UniProtKB/TrEMBL;Acc:G5EF97])

HSP 1 Score: 204.142 bits (518), Expect = 1.626e-57
Identity = 119/315 (37.78%), Postives = 174/315 (55.24%), Query Frame = 1
Query:  568 KRKRESKWGTGQAKVPMY-------LNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILG----EAQSI-------VTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELG 1455
            K++R S+W T ++ VP         L  +    Y +Q+++   T KL   ++    E   R PSP+PVY+  GKR+NT+E R R+ L+  +   I  L  + P   P AD +    R+ ++++IPQE +PD+NF GL+IGPRG T K LE ETG KI+IRGKGS K G+      P+PGE+EPLHAYVT      + KA EKI+++I +    P+  N+LRK Q+++LA+ NGT+R  +  N  +       E +S        VTN I C+ CG  GH+ +DC     +          A ++ EY   + ELG
Sbjct:  187 KKERRSRWSTTKSFVPGMPTILPADLTEDQRNAYLLQLEIEDATRKLRLADFGV-AEGRERSPSPEPVYDANGKRLNTREVRKRQELEQLRHEKIQALLKINPNFKPPADYRAPNIRLHDKVWIPQEQFPDLNFVGLLIGPRGNTLKSLEAETGAKIIIRGKGSIKEGKLTNRLGPMPGENEPLHAYVTGTDMNVIKKACEKIKQVIAEATALPD-NNELRKLQLRELALLNGTFRPEDLANGARCSNCGSDEHKSWECPDAPNVTNQIKCTNCGAFGHISKDCKNPKGMY------ASEAGMDDEYSALMAELG 493          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: gld-1 (Female germline-specific tumor suppressor gld-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17339])

HSP 1 Score: 101.293 bits (251), Expect = 1.047e-22
Identity = 78/226 (34.51%), Postives = 119/226 (52.65%), Query Frame = 1
Query:  787 FRARERLDD----RKRNLILRLHALRPELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKG--------SAKPGQFNGDGVPLPGEDEPLHAYVTSMSRES-----VDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNT-------IICSLCGGTGHLPRDCLVNSNLIPMM 1392
            F   ERL D    R R  + +    R EL   A  MI   I E+I++P+ +YPD NF G I+GPRGMT K+LE++TG KI++RGKG        SA  G+ N + +    ED+ LH  V     E+     +  A E+++K++   I  PE  ++L++ Q+ +LAI NGTYR  +  N  +++  A  +++ T       ++ S   G+G LP      S L P +
Sbjct:  167 FSNVERLLDDEIGRVRVALFQTEFPRVELPEPAGDMIS--ITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKANWEHL----EDD-LHVLVQCEDTENRVHIKLQAALEQVKKLL---IPAPEGTDELKRKQLMELAIINGTYRPMKSPNPARVM-TAVPLLSPTPLRSSGPVLMSPTPGSG-LPSTTFGGSILSPTL 380          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: gld-1 (Female germline-specific tumor suppressor gld-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17339])

HSP 1 Score: 101.293 bits (251), Expect = 1.047e-22
Identity = 78/226 (34.51%), Postives = 119/226 (52.65%), Query Frame = 1
Query:  787 FRARERLDD----RKRNLILRLHALRPELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKG--------SAKPGQFNGDGVPLPGEDEPLHAYVTSMSRES-----VDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNT-------IICSLCGGTGHLPRDCLVNSNLIPMM 1392
            F   ERL D    R R  + +    R EL   A  MI   I E+I++P+ +YPD NF G I+GPRGMT K+LE++TG KI++RGKG        SA  G+ N + +    ED+ LH  V     E+     +  A E+++K++   I  PE  ++L++ Q+ +LAI NGTYR  +  N  +++  A  +++ T       ++ S   G+G LP      S L P +
Sbjct:  167 FSNVERLLDDEIGRVRVALFQTEFPRVELPEPAGDMIS--ITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKANWEHL----EDD-LHVLVQCEDTENRVHIKLQAALEQVKKLL---IPAPEGTDELKRKQLMELAIINGTYRPMKSPNPARVM-TAVPLLSPTPLRSSGPVLMSPTPGSG-LPSTTFGGSILSPTL 380          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 94.3597 bits (233), Expect = 5.294e-21
Identity = 60/167 (35.93%), Postives = 93/167 (55.69%), Query Frame = 1
Query:  787 FRARERLDDRKRN---LILRLHALRPELVPHADKMIGARIE-ERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSA---KPGQFNGDGVPLPGEDEPLHAYVTSMSRES-----VDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYR 1251
            F   ERL D + N   ++L       E  P  D    + +  E++F+P +++PD NF G I+GPRGMT K+LE+ETG KI++RG+GS    K  + N          E LH  +     E+     + +A E++RK++   +  PE ++DL++ Q+ +LAI NGTYR
Sbjct:   48 FHHLERLADEEINKVRVVLFQCEFSKESAPLPDAEGDSTVHTEKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLL---VPAPEGEDDLKRKQLMELAIINGTYR 211          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 94.7449 bits (234), Expect = 8.954e-21
Identity = 60/167 (35.93%), Postives = 93/167 (55.69%), Query Frame = 1
Query:  787 FRARERLDDRKRN---LILRLHALRPELVPHADKMIGARIE-ERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSA---KPGQFNGDGVPLPGEDEPLHAYVTSMSRES-----VDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYR 1251
            F   ERL D + N   ++L       E  P  D    + +  E++F+P +++PD NF G I+GPRGMT K+LE+ETG KI++RG+GS    K  + N          E LH  +     E+     + +A E++RK++   +  PE ++DL++ Q+ +LAI NGTYR
Sbjct:   48 FHHLERLADEEINKVRVVLFQCEFSKESAPLPDAEGDSTVHTEKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLL---VPAPEGEDDLKRKQLMELAIINGTYR 211          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: SF1 (gene:FBgn0025571 transcript:FBtr0083456)

HSP 1 Score: 257.684 bits (657), Expect = 1.608e-76
Identity = 136/318 (42.77%), Postives = 197/318 (61.95%), Query Frame = 1
Query:  565 RKRKRESKWGTGQ----------AKVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETE-------GLNKLKILGEAQSIVTNTIICSLCGGTGHLPRDCLVN--SNLIPMMHFPPQHAKLEGEYDNFINELG 1455
            RKRKR+S+WG  +            +P  L+    E Y +Q Q+  ++ KL   +         R PSP+P+Y+ +GKR+NT+EFR R+RL++++  LI+++  + PE  P AD K    R+ +++ IPQE +PDINF GL+IGPRG T K +EK+TG KI+IRGKGS K G+    DG PLPGEDEPLHA++T+ + E+V KA +KI+ +I+ GIE PE  NDLR+ Q+++LA  NGT RE +         +        + I+TNTI+C+ CGGTGHL +DC      + +P M      AK++ EY + + ELG
Sbjct:  270 RKRKRKSRWGGSENDKTFIPGMPTILPSTLDPAQQEAYLVQFQIEEISRKLRTGDLGITQNPEERSPSPEPIYSSDGKRLNTREFRYRKRLEEQRHQLIVKMQTVNPEFKPPADYKPPVTRVSDKVLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGEDEPLHAFITAPNPEAVRKAVDKIKDVIRQGIEVPEGHNDLRRMQLRELAQLNGTLRENDIQRCTCGSTDHKSWQCPDKPIITNTIVCTSCGGTGHLTKDCRNKRPGSGVPGMACEDSQAKIDEEYMSLMAELG 587          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0100514)

HSP 1 Score: 90.1225 bits (222), Expect = 3.937e-19
Identity = 58/173 (33.53%), Postives = 98/173 (56.65%), Query Frame = 1
Query:  787 FRARERLDD----RKRNLILRLHALR--PELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGS--------AKPGQFNGDGVPLPGEDEPLHAYVTSMSRE--SVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
            F   ERL D    R R  + +++ ++  P  +P  +  +   + E++++P  ++PD NF G I+GPRGMT K+LE+ETG KI++RGKGS        A  G+ N + +      + LH  +T    E  +  K A+ + ++ +  +   E +++L+K Q+ +LAI NGTYR+T
Sbjct:   96 FTHVERLLDEEIARVRASLFQINGVKKEPLTLPEPEGSV-VTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHL-----SDDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRDT 262          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0084178)

HSP 1 Score: 89.7373 bits (221), Expect = 4.631e-19
Identity = 58/173 (33.53%), Postives = 98/173 (56.65%), Query Frame = 1
Query:  787 FRARERLDD----RKRNLILRLHALR--PELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGS--------AKPGQFNGDGVPLPGEDEPLHAYVTSMSRE--SVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
            F   ERL D    R R  + +++ ++  P  +P  +  +   + E++++P  ++PD NF G I+GPRGMT K+LE+ETG KI++RGKGS        A  G+ N + +      + LH  +T    E  +  K A+ + ++ +  +   E +++L+K Q+ +LAI NGTYR+T
Sbjct:   96 FTHVERLLDEEIARVRASLFQINGVKKEPLTLPEPEGSV-VTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHL-----SDDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRDT 262          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0335195)

HSP 1 Score: 89.7373 bits (221), Expect = 5.671e-19
Identity = 58/173 (33.53%), Postives = 98/173 (56.65%), Query Frame = 1
Query:  787 FRARERLDD----RKRNLILRLHALR--PELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGS--------AKPGQFNGDGVPLPGEDEPLHAYVTSMSRE--SVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
            F   ERL D    R R  + +++ ++  P  +P  +  +   + E++++P  ++PD NF G I+GPRGMT K+LE+ETG KI++RGKGS        A  G+ N + +      + LH  +T    E  +  K A+ + ++ +  +   E +++L+K Q+ +LAI NGTYR+T
Sbjct:   96 FTHVERLLDEEIARVRASLFQINGVKKEPLTLPEPEGSV-VTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHL-----SDDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRDT 262          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0084177)

HSP 1 Score: 89.7373 bits (221), Expect = 6.370e-19
Identity = 58/173 (33.53%), Postives = 98/173 (56.65%), Query Frame = 1
Query:  787 FRARERLDD----RKRNLILRLHALR--PELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGS--------AKPGQFNGDGVPLPGEDEPLHAYVTSMSRE--SVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
            F   ERL D    R R  + +++ ++  P  +P  +  +   + E++++P  ++PD NF G I+GPRGMT K+LE+ETG KI++RGKGS        A  G+ N + +      + LH  +T    E  +  K A+ + ++ +  +   E +++L+K Q+ +LAI NGTYR+T
Sbjct:   96 FTHVERLLDEEIARVRASLFQINGVKKEPLTLPEPEGSV-VTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHL-----SDDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRDT 262          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 246.514 bits (628), Expect = 3.465e-74
Identity = 132/292 (45.21%), Postives = 184/292 (63.01%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSI----VTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQH----AKLEGEYDNFINELG 1455
            +P  L  +    Y +Q+Q+  +T KL   +    +    R PSP+P+YN EGKR+NT+E+R R++L++ + +LI  +  L PE  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC   S+  P    PPQ     A+++ EY + + ELG
Sbjct:   40 IPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSTEPRSITNTTLCTKCGGAGHISSDCKFTSSFAPRPGEPPQSAQDKARMDKEYLSLMAELG 327          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 245.743 bits (626), Expect = 6.037e-73
Identity = 132/292 (45.21%), Postives = 184/292 (63.01%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSI----VTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQH----AKLEGEYDNFINELG 1455
            +P  L  +    Y +Q+Q+  +T KL   +    +    R PSP+P+YN EGKR+NT+E+R R++L++ + +LI  +  L PE  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC   S+  P    PPQ     A+++ EY + + ELG
Sbjct:  112 IPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSTEPRSITNTTLCTKCGGAGHISSDCKFTSSFAPRPGEPPQSAQDKARMDKEYLSLMAELG 399          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: qki2 (QKI, KH domain containing, RNA binding 2 [Source:NCBI gene;Acc:393815])

HSP 1 Score: 92.0485 bits (227), Expect = 3.827e-20
Identity = 51/136 (37.50%), Postives = 86/136 (63.24%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKP--------GQFNGDGVPLPGEDEPLHAYVT---SMSRESV--DKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
            A+++E++++P ++YPD NF G I+GPRG+T K+LE ETG KI++RGKGS +         G+ N + +     +E LH  +T   S +R  +   +A E+++K++   +   E ++ L+K Q+ +LAI NGTYR+ 
Sbjct:   59 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHL-----NEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDA 186          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: qki2 (QKI, KH domain containing, RNA binding 2 [Source:NCBI gene;Acc:393815])

HSP 1 Score: 92.0485 bits (227), Expect = 4.522e-20
Identity = 51/136 (37.50%), Postives = 86/136 (63.24%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKP--------GQFNGDGVPLPGEDEPLHAYVT---SMSRESV--DKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
            A+++E++++P ++YPD NF G I+GPRG+T K+LE ETG KI++RGKGS +         G+ N + +     +E LH  +T   S +R  +   +A E+++K++   +   E ++ L+K Q+ +LAI NGTYR+ 
Sbjct:   80 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHL-----NEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDA 207          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: qki2 (QKI, KH domain containing, RNA binding 2 [Source:NCBI gene;Acc:393815])

HSP 1 Score: 91.6633 bits (226), Expect = 5.971e-20
Identity = 51/136 (37.50%), Postives = 86/136 (63.24%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKP--------GQFNGDGVPLPGEDEPLHAYVT---SMSRESV--DKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
            A+++E++++P ++YPD NF G I+GPRG+T K+LE ETG KI++RGKGS +         G+ N + +     +E LH  +T   S +R  +   +A E+++K++   +   E ++ L+K Q+ +LAI NGTYR+ 
Sbjct:   80 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHL-----NEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDA 207          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: men1 (menin 1 [Source:NCBI gene;Acc:549115])

HSP 1 Score: 239.58 bits (610), Expect = 1.174e-71
Identity = 137/310 (44.19%), Postives = 188/310 (60.65%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQH----AKLEGEYDNFINELGVDGTDTKPAYLGFIPQHN 1509
            +P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ + NLI  +  L P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA ++IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC   S  + +    PQ     A+++ EY + + ELG     T P   G  P HN
Sbjct:   44 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVDQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFTS--VTVRPGEPQSAQDKARMDKEYLSLMAELGEAPVPT-PMGPGSGPSHN 346          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: men1 (menin 1 [Source:NCBI gene;Acc:549115])

HSP 1 Score: 238.424 bits (607), Expect = 2.001e-70
Identity = 146/337 (43.32%), Postives = 198/337 (58.75%), Query Frame = 1
Query:  562 TRKRKRESKWG----------TGQAKV-PMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQH----AKLEGEYDNFINELGVDGTDTKPAYLGFIPQHN 1509
            +RKRKR S+W            G   V P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ + NLI  +  L P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA ++IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC   S  + +    PQ     A+++ EY + + ELG     T P   G  P HN
Sbjct:   48 SRKRKR-SRWNDETPDQKTIIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVDQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFTS--VTVRPGEPQSAQDKARMDKEYLSLMAELGEAPVPT-PMGPGSGPSHN 376          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: men1 (menin 1 [Source:NCBI gene;Acc:549115])

HSP 1 Score: 238.039 bits (606), Expect = 4.114e-70
Identity = 146/337 (43.32%), Postives = 198/337 (58.75%), Query Frame = 1
Query:  562 TRKRKRESKWG----------TGQAKV-PMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQH----AKLEGEYDNFINELGVDGTDTKPAYLGFIPQHN 1509
            +RKRKR S+W            G   V P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ + NLI  +  L P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA ++IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC   S  + +    PQ     A+++ EY + + ELG     T P   G  P HN
Sbjct:   75 SRKRKR-SRWNDETPDQKTIIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVDQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFTS--VTVRPGEPQSAQDKARMDKEYLSLMAELGEAPVPT-PMGPGSGPSHN 403          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:Xenbase;Acc:XB-GENE-971062])

HSP 1 Score: 89.3521 bits (220), Expect = 6.090e-19
Identity = 48/136 (35.29%), Postives = 84/136 (61.76%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKP--------GQFNGDGVPLPGEDEPLHAYVTSMSRES-----VDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
             +++E++++P ++YPD NF G I+GPRG+T K+LE ETG KI++RGKGS +         G+ N + +     +E LH  +T    ++     + +A E+++K++   +   E ++ L+K Q+ +LAI NGTYR+ 
Sbjct:   81 VQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHL-----NEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDA 208          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:Xenbase;Acc:XB-GENE-971062])

HSP 1 Score: 83.9593 bits (206), Expect = 8.342e-17
Identity = 48/151 (31.79%), Postives = 84/151 (55.63%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKP-----------------------GQFNGDGVPLPGEDEPLHAYVTSMSRES-----VDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
             +++E++++P ++YPD NF G I+GPRG+T K+LE ETG KI++RGKGS +                        G+ N + +     +E LH  +T    ++     + +A E+++K++   +   E ++ L+K Q+ +LAI NGTYR+ 
Sbjct:  105 VQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKAVTNILECSILALNKEEQNRGKPNWEHL-----NEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDA 247          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 233.032 bits (593), Expect = 1.761e-72
Identity = 123/257 (47.86%), Postives = 166/257 (64.59%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDC 1362
            +P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ +  LI  + AL P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC
Sbjct:   14 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDC 266          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 233.032 bits (593), Expect = 1.761e-72
Identity = 123/257 (47.86%), Postives = 166/257 (64.59%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDC 1362
            +P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ +  LI  + AL P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC
Sbjct:   14 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDC 266          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 236.884 bits (603), Expect = 1.078e-70
Identity = 130/288 (45.14%), Postives = 178/288 (61.81%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELG 1455
            +P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ +  LI  + AL P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC       P        A+++ EY + + ELG
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQ--DKARMDKEYLSLMAELG 321          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 236.884 bits (603), Expect = 1.078e-70
Identity = 130/288 (45.14%), Postives = 178/288 (61.81%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELG 1455
            +P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ +  LI  + AL P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC       P        A+++ EY + + ELG
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQ--DKARMDKEYLSLMAELG 321          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 237.269 bits (604), Expect = 1.529e-70
Identity = 130/288 (45.14%), Postives = 178/288 (61.81%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELG 1455
            +P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ +  LI  + AL P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC       P        A+++ EY + + ELG
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQ--DKARMDKEYLSLMAELG 321          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q15637|SF01_HUMAN (Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4)

HSP 1 Score: 238.424 bits (607), Expect = 1.652e-69
Identity = 131/288 (45.49%), Postives = 179/288 (62.15%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELG 1455
            +P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ + NLI  + AL P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC       P        A+++ EY + + ELG
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP--QSAQDKARMDKEYLSLMAELG 321          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q64213|SF01_MOUSE (Splicing factor 1 OS=Mus musculus OX=10090 GN=Sf1 PE=1 SV=6)

HSP 1 Score: 236.498 bits (602), Expect = 1.152e-68
Identity = 130/288 (45.14%), Postives = 178/288 (61.81%), Query Frame = 1
Query:  610 VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELG 1455
            +P  L  E    Y +Q+Q+  +T KL   +         R PSP+P+YN EGKR+NT+EFR R++L++ +  LI  + AL P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC       P        A+++ EY + + ELG
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQ--DKARMDKEYLSLMAELG 321          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NIW7|BBP_NEUCR (Branchpoint-bridging protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=bbp-1 PE=3 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.887e-50
Identity = 117/360 (32.50%), Postives = 182/360 (50.56%), Query Frame = 1
Query:  565 RKRKRESKWG-------TGQAKVPMY----LNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMC-----REPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYR--ETEGLNKLKILG-------EAQSIVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEG-------------EYDNFINELGVDGTDTKPAYLGFIPQHNSGNTTQG 1530
            ++RK+ ++WG        G   +P      + SE  E Y++ +++  +T KL       +I+ +      R PSP P Y++ G+R+NT+E+R R++L+D +  LI +     P   P +D     + +E++++P  DYP+INF GL+IGPRG T K++E E+G KI IRGKGS K G+   D      ++E LH  + + + E V+KA + I  II+     PE QN+L++NQ+++LA  NGT R  E +       +G       E Q+   N IIC +CG  GH+ RDC          +  P   +  G             EY+  + ELG  GT   PA +   P   S   + G
Sbjct:   77 KRRKKRNRWGEATENKAAGLMGLPTAIVANMTSEQLEAYTLHLRIEEITQKL-------KIDDVVPADGDRSPSPAPQYDNHGRRVNTREYRYRKKLEDERHKLIEKAMKTIPNYHPPSDYRRPTKTQEKVYVPVNDYPEINFIGLLIGPRGNTLKKMETESGAKIAIRGKGSVKEGKGRSDAAHSSNQEEDLHCLIMADTEEKVNKAKKLIHNIIETAASIPEGQNELKRNQLRELAALNGTLRDDENQACQNCGQIGHRKYDCPEKQNYTAN-IICRVCGNAGHMARDCPDRQRGASWRNDGPGAGRTAGRIGSSGGGDAVDREYEQLMQELG--GTGAAPARIEAGPGSFSNGPSGG 426          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4WXV6|BBP_ASPFU (Branchpoint-bridging protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bbp PE=3 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 4.654e-48
Identity = 96/286 (33.57%), Postives = 155/286 (54.20%), Query Frame = 1
Query:  562 TRKRKRESKWGTGQ-----------AKVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEG--------LNKLKILGEAQSIVTNTIICSLCGGTGHLPRDC 1362
             ++RK+ ++WG  Q             +     +E  E Y++ +++  ++ KL   +         R PSP P Y++ G+R+NT+E+R R+RL+D +  L+ +     P   P +D     + +E++++P  DYP+INF GL+IGPRG T K++E E+G KI IRGKGS K G+   D      ++E LH  + + + E V+KA + +  +I+     PE QN+L++NQ+++LA  NGT R+ E         +   K     Q   T  IIC +CG  GH+ RDC
Sbjct:   61 VKRRKKRNRWGDAQENKAAGLMGLPTMIMANFTNEQLEAYTLHLRIEEISQKLRINDVVPADGD--RSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAMKTIPNYHPPSDYRRPTKTQEKVYVPVNDYPEINFIGLLIGPRGNTLKKMEAESGAKIAIRGKGSVKEGKGRSDAAHASNQEEDLHCLIMADTEEKVNKAKKLVHNVIETAASIPEGQNELKRNQLRELAALNGTLRDDENQACQNCGQIGHRKYDCPEQRNFTANIICRVCGNAGHMARDC 344          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|P0CO44|BBP_CRYNJ (Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=BBP PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 6.387e-47
Identity = 116/322 (36.02%), Postives = 172/322 (53.42%), Query Frame = 1
Query:  571 RKRESKWGTGQAKV-----PMYL--NSEDAEV--YSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD--KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKL-KILGE---------AQSIVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELGVDGTDT 1473
            RKR S+WG   AKV     P+ +  N    E+  Y+I ++L  +  KL   +     E   R PSP P Y+  G+R NT+E R R++L+D +  LI R     P   P  D     G+R +++++IP +++P+INF GL++GPRG + K++E+E+G KI IRGKGS K G+      P   EDE LH  +T+     V      I K+I+     PE +ND ++NQ+++LA  NGT R+ E  N+L +  GE          Q + +  +IC +CGG GH+ RDC    +  P +    Q A  + EY   + ELG  G  T
Sbjct:  129 RKRRSRWGDASAKVNVPGMPVAVMGNVSQTELDNYAIHVRLEEINRKLRTGDVVPP-EGQ-RSPSPTPQYDAYGRRTNTRELRYRKKLEDERTRLIDRAVKSDPNFRPPVDFQHKRGSRPQDKVYIPVKEFPEINFFGLLVGPRGNSLKKMERESGAKISIRGKGSVKEGKGRAGNFPQDEEDE-LHCLITADDESKVKTCVALINKVIETAASTPEGENDHKRNQLRELASLNGTLRDDE--NQLCQNCGEKGHRRWECPQQRVYSANVICRICGGAGHMARDCRGRGD--PSLTQNKQTA-FDSEYTALMAELGEGGGST 442          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A4V6J6 (SF1 protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 3.116e-108
Identity = 151/186 (81.18%), Postives = 172/186 (92.47%), Query Frame = 1
Query:  562 TRKRKRESKWGTGQAKVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGEDEPLHAYVTSMS 1119
             RKRKRESKW +GQAKVP+YL  +DAEVYSIQIQ+NS+TTKL Q+NY EEIE MCR  SPDPVY H+GKRINTKE+RARER+++RKRNLILRL+ALRP+LVPHADKM+GARIEE++FIPQ+DYPDINFAGLIIGPRGMTQK+LEKETGTKIL+RGKGSAKPG+ NG   PLPGEDEPLHAY+TSMS
Sbjct:   66 ARKRKRESKWSSGQAKVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIETMCRSASPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMS 251          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: G4VNH1 (Putative zinc finger protein OS=Schistosoma mansoni OX=6183 GN=Smp_021540 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 9.256e-84
Identity = 148/325 (45.54%), Postives = 209/325 (64.31%), Query Frame = 1
Query:  571 RKRESKWGTGQA----------KVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNG-DGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNTIICSLCGGTGHLPRDCLV----NSNLIPMMHFPPQHAKLEGEYDNFINELGVDGTDTKPAYL-GF 1494
            RKR+S+W   +           ++P  L  +   VY IQ+Q+  ++ +L   +         R PSP+P+Y+ +GKR+NT+E+R R++L+D +  L+ +L  + PE  P +D K    RI +++FIPQ+++PDINF GL+IGPRG T K LEK+TG K++IRGKGS K G+    DG+PLPGEDEPLHA++++ S E VDKA +KI +II+ GIE PE QNDLR+ Q+++LA+ NGT RE EGL KL+ + EAQSI TN I C +CGG GHL  DC       + L  +   P + AK++ EY   + ELGV G+   P  L GF
Sbjct:   32 RKRKSRWSAAETDRIFIPGMPTQLPPNLTPQQERVYIIQLQIEDMSRRLKSGDLGIPKNPEDRSPSPEPIYSSDGKRLNTREYRTRKKLEDDRHALVQQLMEINPEYKPPSDYKAPQNRITDKVFIPQDNHPDINFVGLLIGPRGNTLKALEKDTGAKVIIRGKGSVKEGKVGRRDGLPLPGEDEPLHAFISAPSAECVDKAVKKINEIIRQGIEIPESQNDLRRAQLRELALLNGTLREHEGLMKLRAMAEAQSIATNKIQCGICGGAGHLSTDCKALLGGQAYLDQLNANPSERAKMDSEYTALMAELGVGGSQGLPPGLRGF 356          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A0B7A7S8 (CCHC-type domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF98060 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 9.690e-84
Identity = 141/305 (46.23%), Postives = 201/305 (65.90%), Query Frame = 1
Query:  565 RKRKRESKWGTGQAK------VPMYLNSEDAEV----YSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNTIICSLCGGTGHLPRDCLVN----SNLIPMMHFPPQHAKLEGEY 1431
            +KRKR S+W T   +      +P  L S   E     Y + +Q+  +T KL   +      A  R PSP+P+YN+EGKR+NT+E+R R++L++ +  LI     L PE  P  D K    R+ +++ IPQE++P+INF GL+IGPRG T K LEK+TG KI+IRGKGS K G+    DG PLPGEDEPLHAYVT+ + E+V KA +KI++II+ GIE PE QNDLR+ Q+++LA+ NGT RE +GL KL+ + E+Q+I+TNTI+C++CGG GH+ +DC       +  +  +  P + AK++ EY
Sbjct:   40 QKRKRRSRWNTAAEEKTVIPGMPTVLPSNLTETQQRQYVVHLQIEEITRKLRTGDLGISANAEQRSPSPEPIYNNEGKRMNTREYRTRKKLEEDRHKLIQEAMKLNPEFKPPGDYKPPIIRVNDKVMIPQEEHPEINFVGLLIGPRGNTLKTLEKDTGAKIIIRGKGSVKDGKIGRKDGQPLPGEDEPLHAYVTAHNPENVKKAVDKIKEIIKQGIEVPEGQNDLRRQQLRELALLNGTLRENDGLTKLRQIAESQTIITNTIVCTVCGGAGHIAQDCKQKRPGETFRVQQVQNPAERAKMDSEY 344          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A5K4F2D9 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 9.865e-84
Identity = 148/325 (45.54%), Postives = 209/325 (64.31%), Query Frame = 1
Query:  571 RKRESKWGTGQA----------KVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNG-DGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNTIICSLCGGTGHLPRDCLV----NSNLIPMMHFPPQHAKLEGEYDNFINELGVDGTDTKPAYL-GF 1494
            RKR+S+W   +           ++P  L  +   VY IQ+Q+  ++ +L   +         R PSP+P+Y+ +GKR+NT+E+R R++L+D +  L+ +L  + PE  P +D K    RI +++FIPQ+++PDINF GL+IGPRG T K LEK+TG K++IRGKGS K G+    DG+PLPGEDEPLHA++++ S E VDKA +KI +II+ GIE PE QNDLR+ Q+++LA+ NGT RE EGL KL+ + EAQSI TN I C +CGG GHL  DC       + L  +   P + AK++ EY   + ELGV G+   P  L GF
Sbjct:   32 RKRKSRWSAAETDRIFIPGMPTQLPPNLTPQQERVYIIQLQIEDMSRRLKSGDLGIPKNPEDRSPSPEPIYSSDGKRLNTREYRTRKKLEDDRHALVQQLMEINPEYKPPSDYKAPQNRITDKVFIPQDNHPDINFVGLLIGPRGNTLKALEKDTGAKVIIRGKGSVKEGKVGRRDGLPLPGEDEPLHAFISAPSAECVDKAVKKINEIIRQGIEIPESQNDLRRAQLRELALLNGTLREHEGLMKLRAMAEAQSIATNKIQCGICGGAGHLSTDCKALLGGQAYLDQLNANPSERAKMDSEYTALMAELGVGGSQGLPPGLRGF 356          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A1S3KCY7 (splicing factor 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106180632 PE=4 SV=2)

HSP 1 Score: 280.796 bits (717), Expect = 1.638e-83
Identity = 150/315 (47.62%), Postives = 204/315 (64.76%), Query Frame = 1
Query:  565 RKRKRESKWGTGQAK----------VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNTIICSLCGGTGHLPRDCLVNS------NLIPMMHFPPQHAKLEGEYDNFINELG 1455
            +K+KR S+WG   A+          +P  L  E  + Y + +Q+  ++ +L   +         R PSP+P+YN EGKR+NT+E+R R++L++ +  LI     L  E  P AD K    R+ +++ IPQE++PDINF GL+IGPRG T K LEK+TG KI+IRGKGS K G+    DG PLPGEDEPLHAYVT+ + E+V KA EKI++II+ GIE PE QNDLR+ Q+++LA+ NGT RE +GL KLK L +AQ+IVTNTIIC++CGG GHL +DC          NL  M   P   AK++ EY + + ELG
Sbjct:   18 KKKKRRSRWGGDDAEKTFIPGMPTVIPTGLTMEQEKQYLVHLQIEEISRRLRTGDLGIPTNPEERSPSPEPIYNSEGKRLNTREYRTRKKLEEERHALIQDAMNLNDEYKPPADYKPPIIRVSDKVMIPQEEHPDINFVGLLIGPRGNTLKNLEKDTGAKIIIRGKGSVKEGKIGRKDGQPLPGEDEPLHAYVTANNPENVAKAVEKIKEIIKQGIEVPEGQNDLRRQQLRELALLNGTLRENDGLAKLKQLQQAQTIVTNTIICTVCGGAGHLGQDCKQKKPGDSFRNLTAMAPTPIDKAKMDSEYMSLMAELG 332          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 242.662 bits (618), Expect = 2.903e-71
Identity = 137/318 (43.08%), Postives = 194/318 (61.01%), Query Frame = 1
Query:  565 RKRKRESKWGT----------GQAKV-PMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQH----AKLEGEYDNFINELG 1455
            +K++++S+W +          G   V P  L  E    Y +Q+Q+  +T KL   +    +    R PSP+P+YN EGKR+NT+E+R R++L++ + +LI  +  L PE  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   QS     +TNT +C+ CGG GH+  DC   S+       PPQ     A+++ EY + + ELG
Sbjct:  166 QKKRKKSRWSSETPDQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSEPRSITNTTLCTKCGGAGHIASDCKFTSSYTQRQGEPPQSAQDKARMDKEYLSLMAELG 479          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: qki2 (protein quaking-B [Source:NCBI gene;Acc:103029551])

HSP 1 Score: 92.0485 bits (227), Expect = 3.656e-20
Identity = 51/136 (37.50%), Postives = 86/136 (63.24%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKP--------GQFNGDGVPLPGEDEPLHAYVT---SMSRESV--DKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
            A+++E++++P ++YPD NF G I+GPRG+T K+LE ETG KI++RGKGS +         G+ N + +     +E LH  +T   S +R  +   +A E+++K++   +   E ++ L+K Q+ +LAI NGTYR+ 
Sbjct:   80 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHL-----NEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDA 207          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: qki2 (protein quaking-B [Source:NCBI gene;Acc:103029551])

HSP 1 Score: 92.4337 bits (228), Expect = 4.557e-20
Identity = 51/136 (37.50%), Postives = 86/136 (63.24%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKP--------GQFNGDGVPLPGEDEPLHAYVT---SMSRESV--DKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
            A+++E++++P ++YPD NF G I+GPRG+T K+LE ETG KI++RGKGS +         G+ N + +     +E LH  +T   S +R  +   +A E+++K++   +   E ++ L+K Q+ +LAI NGTYR+ 
Sbjct:   80 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHL-----NEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDA 207          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: qki2 (protein quaking-B [Source:NCBI gene;Acc:103029551])

HSP 1 Score: 91.6633 bits (226), Expect = 5.060e-20
Identity = 51/136 (37.50%), Postives = 86/136 (63.24%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKP--------GQFNGDGVPLPGEDEPLHAYVT---SMSRESV--DKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
            A+++E++++P ++YPD NF G I+GPRG+T K+LE ETG KI++RGKGS +         G+ N + +     +E LH  +T   S +R  +   +A E+++K++   +   E ++ L+K Q+ +LAI NGTYR+ 
Sbjct:   80 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHL-----NEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDA 207          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: qkib (QKI, KH domain containing, RNA binding b [Source:ZFIN;Acc:ZDB-GENE-081028-54])

HSP 1 Score: 88.9669 bits (219), Expect = 5.360e-19
Identity = 49/136 (36.03%), Postives = 83/136 (61.03%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGS--------AKPGQFNGDGVPLPGEDEPLHAYVTSMSRES-----VDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
             +++E++++P ++YPD NF G I+GPRG+T K+LE ETG KI++RGKGS        A  G+ N + +     +E LH  +T    ++     + +A E++ K++   +   E ++ L+K Q+ +LAI NGTYR+ 
Sbjct:   80 VQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKVRANRGKPNWEHL-----NEDLHVLITVEDAQNRAEIKLKRAVEEVNKLL---VPAAEGEDSLKKMQLMELAILNGTYRDA 207          
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 234.572 bits (597), Expect = 2.656e-69
Identity = 136/315 (43.17%), Postives = 194/315 (61.59%), Query Frame = 1
Query:  565 RKRKRESKWGT---------GQAKV-PMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEG--LNKLKILGEAQSIVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQ----HAKLEGEYDNFINELG 1455
            RK+ + S+W T         G   V P  LN +    Y +Q+Q+  +  KL   +         R PSP+P+YN+EGKR+NT+E+R R++++D +  LI  ++ L P+  P AD K    +I ERI IPQ+++PDINF GLIIGPRG T K++EKE   KI+IRGKGS K G+     G PLPGEDEPLHA VT+ ++++V KA ++I+ I++ GIE PE QN+LR+ Q+++LA  NGT R+ E   L   +   E +S VTN  IC+ CGG GH+  DC ++S        PPQ     A+++ EY + + ELG
Sbjct:   85 RKKAKRSRWDTEMTEKIAVPGMPTVLPPGLNKDQERAYIVQLQIEDMNRKLRTGDLGIPPNPEERSPSPEPIYNNEGKRLNTREYRTRKKIEDDRHVLIQEMYRLNPDYKPPADYKPPAQKISERIMIPQDEHPDINFIGLIIGPRGNTLKKIEKECNAKIMIRGKGSVKEGKIGHKPGQPLPGEDEPLHALVTASTQDNVRKAVDQIKNILKQGIEVPEGQNELRRMQLRELARLNGTLRDDESRVLRPWQAPPETRS-VTNMTICNRCGGAGHIASDCRISS------MGPPQGNQERARMDEEYLSLMAELG 392          
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Match: khdrbs2 (KH domain containing, RNA binding, signal transduction associated 2 [Source:NCBI gene;Acc:768147])

HSP 1 Score: 58.5362 bits (140), Expect = 1.371e-9
Identity = 36/128 (28.12%), Postives = 69/128 (53.91%), Query Frame = 1
Query:  892 RIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGED------EPLHAYVTSMSRES-----VDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNG 1242
            ++ ER+ IP + +P  NF G ++GPRG + K +++ETGTK+ I GKGS +      + +   GE+      E LH  +   +  S     +  A ++++K +      P+  +++R+ Q+++L+   G
Sbjct:   36 KLAERVIIPAKQHPKFNFVGKLLGPRGNSLKRMQEETGTKMSILGKGSMRDKALE-EEMRKSGENKYAHLSEELHVLIEVFAPPSEAYSRMGHALDEVKKYL-----VPDYNDEIRQEQLRELSFLKG 157          
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Match: KHDRBS3 (KH RNA binding domain containing, signal transduction associated 3 [Source:HGNC Symbol;Acc:HGNC:18117])

HSP 1 Score: 56.6102 bits (135), Expect = 3.363e-9
Identity = 38/128 (29.69%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  892 RIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGE------DEPLHAYV-----TSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNG 1242
            ++ ER+ IP   +P  NF G ++GPRG + K L++ETGTK+ I GKGS +      D +   GE      +E LH  +      S +   +  A ++++K +      P+  +++R+ Q+++L+   G
Sbjct:   36 KLIERVIIPVRQHPKFNFIGKLLGPRGNSLKRLKEETGTKLSILGKGSMRDRDKEED-LRKSGEAKYAHLNEDLHVLIEVFAPPSQAYRRMGHALDEVKKYL-----VPDYNDEIRQQQLRELSFLKG 157          
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Match: khdrbs1a (KH domain containing, RNA binding, signal transduction associated 1a [Source:ZFIN;Acc:ZDB-GENE-000210-25])

HSP 1 Score: 53.5286 bits (127), Expect = 6.270e-8
Identity = 22/50 (44.00%), Postives = 34/50 (68.00%), Query Frame = 1
Query:  892 RIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAK 1041
            ++ E++ IP + +P  NF G ++GP+G T K L+ ETGT++ I GKG  K
Sbjct:   60 KLAEKVLIPAKQHPKFNFVGKLLGPQGNTLKRLQVETGTRMAIMGKGCMK 109          
BLAST of CCHC-type domain-containing protein vs. Ensembl Yeast
Match: MSL5 (Component of commitment complex; which defines first step in splicing pathway; essential protein that interacts with Mud2p and Prp40p, forming a bridge between the intron ends; also involved in nuclear retention of pre-mRNA; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000004106])

HSP 1 Score: 158.303 bits (399), Expect = 4.239e-43
Identity = 91/270 (33.70%), Postives = 146/270 (54.07%), Query Frame = 1
Query:  586 KWGTGQAKVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGE---DEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETE------GLNKLKILGEAQSIVTNT--IICSLCGGTGHLPRDC 1362
            ++ +  +K+   L  E    Y +  ++  +T KL   ++        R PSP PVY+ +GKR NT+E R R++L+D +  L+       P  VP  D     + +++ +IP + YPD+NF GL++GPRG T ++L++++  KI IRG+GS K G+ N   +P PG    ++PLH  + + S + + K  +  + I+   +  PE QNDL++ Q+++LA  NGT RE        GL   K        + N   I+C +CG TGH  RDC
Sbjct:   46 RFNSLPSKISGALTREQIYSYQVMFRIQEITIKLRTNDFVPPSRKN-RSPSPPPVYDAQGKRTNTREQRYRKKLEDERIKLVEIALKTIPYFVPPDDYKRPTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGK-NASDLP-PGAMNFEDPLHCLIIADSEDKIQKGIKVCQNIVIKAVTSPEGQNDLKRGQLRELAELNGTLREDNRPCPICGLKDHKRYDCPNRKIPNIQGIVCKICGQTGHFSRDC 312          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO45484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSV9])

HSP 1 Score: 145.206 bits (365), Expect = 7.437e-40
Identity = 83/202 (41.09%), Postives = 122/202 (60.40%), Query Frame = 1
Query:  565 RKRKRESKWGTGQAK---------VPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPG-QFNGDGVPL--PGEDEPLHAYVTSMSRESV 1131
            RK+KR+S+WG    K         +P  L  +  + Y +Q+++  ++  L   +         R PSP+P+YN +GKR+NT++FR R+RL+D +   I  +  + P+  P AD K    +I++++ IPQ++ P++NF GL+IGPRG T K +EKET  KI+IRGKGS K G Q  G  + L   GEDEPLHA VT  + ESV
Sbjct:   60 RKKKRKSRWGGEDKKMIIPGMPTTLPPNLKPDQQKAYLMQLRIEEISRMLRTGDLGIPDNPEDRSPSPEPIYNTDGKRLNTRDFRVRKRLEDERHKFIQDMMKINPDFKPPADYKPPLIKIQDKVMIPQDENPEVNFIGLLIGPRGNTLKNMEKETNAKIMIRGKGSIKDGKQGRGRDMQLMNSGEDEPLHALVTGPTAESV 261          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO30297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T170])

HSP 1 Score: 85.5001 bits (210), Expect = 2.406e-19
Identity = 45/131 (34.35%), Postives = 78/131 (59.54%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGE---DEPLHAYVTSMSRES-----VDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
             ++ E+++ P +++P  NF G +IGPRGMT +E+E  TG K+L+RGKGS K  +   +    P     DE LH  ++    E      ++KA E+++ +++      E +++++K Q+K LA+ NGT RE+
Sbjct:   51 VKLVEKVYAPVKEFPKFNFVGRVIGPRGMTLREIESTTGCKLLVRGKGSMKDKKLEEEKRGQPNYEHLDEDLHVLISCEDTEERCHTRLEKAVERVQSLLRP---VEEGEDEIKKKQLKDLALLNGTLRES 178          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO28641 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5W9])

HSP 1 Score: 64.6994 bits (156), Expect = 1.587e-12
Identity = 25/51 (49.02%), Postives = 38/51 (74.51%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAK 1041
             ++ E+++ P +++P  NF G +IGPRGMT +E+E  TG K+L+RGKGS K
Sbjct:   90 VKLVEKVYAPVKEFPKFNFVGRVIGPRGMTLREIESTTGCKLLVRGKGSMK 140          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO44127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWI4])

HSP 1 Score: 64.6994 bits (156), Expect = 2.478e-12
Identity = 39/130 (30.00%), Postives = 70/130 (53.85%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGEDEPLHAYV-------------TSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFN 1239
             ++ E++FIP +D+P  NF G ++GPRG T K L+  TGTK+ I GKGS +  +   +   L   ++P +A++                +   +  A E+I+K +      PE+ +++ + QM+++AI N
Sbjct:   47 VKLSEKVFIPVKDHPKFNFVGKLLGPRGNTFKRLQNSTGTKMSILGKGSMRDKEKEEE---LRATEDPKYAHLGEELHVLIEVEAPPGQAHARLGIAIEEIKKYL-----IPEMNDEIHQEQMREMAILN 168          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: sf1 (splicing factor 1 [Source:NCBI gene;Acc:101157648])

HSP 1 Score: 231.876 bits (590), Expect = 9.992e-68
Identity = 133/320 (41.56%), Postives = 191/320 (59.69%), Query Frame = 1
Query:  568 KRKRESKWGT----------GQAKV-PMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHF---PPQH----AKLEGEYDNFINELG 1455
            K++++S+W +          G   V P  L  +    Y +Q+Q+  +T KL   +    +    R PSP+P+YN EGKR+NT+E+R R+++++ +  LI  +  L P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   Q+     +TNT +C+ CGG GH+  DC   S           PPQ     A+++ EY + + ELG
Sbjct:   86 KKRKKSRWSSETPDQKTIIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKIEEERHALITEMIGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQNSEPRSITNTTLCTKCGGAGHISSDCKYTSTFAAHRATGGEPPQSAQDKARMDKEYLSLMAELG 401          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: sf1 (splicing factor 1 [Source:NCBI gene;Acc:101157648])

HSP 1 Score: 231.491 bits (589), Expect = 1.219e-67
Identity = 133/320 (41.56%), Postives = 191/320 (59.69%), Query Frame = 1
Query:  568 KRKRESKWGT----------GQAKV-PMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHAD-KMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFN-GDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQS----IVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHF---PPQH----AKLEGEYDNFINELG 1455
            K++++S+W +          G   V P  L  +    Y +Q+Q+  +T KL   +    +    R PSP+P+YN EGKR+NT+E+R R+++++ +  LI  +  L P+  P AD K    R+ +++ IPQ++YP+INF GL+IGPRG T K +EKE   KI+IRGKGS K G+    DG  LPGEDEPLHA VT+ + E+V KA E+IR I++ GIE PE QNDLRK Q+++LA  NGT RE +     +IL   Q+     +TNT +C+ CGG GH+  DC   S           PPQ     A+++ EY + + ELG
Sbjct:   86 KKRKKSRWSSETPDQKTIIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKIEEERHALITEMIGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQNSEPRSITNTTLCTKCGGAGHISSDCKYTSTFAAHRATGGEPPQSAQDKARMDKEYLSLMAELG 401          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045137.1 (protein quaking-B-like [Source:NCBI gene;Acc:101161529])

HSP 1 Score: 89.3521 bits (220), Expect = 3.503e-19
Identity = 48/136 (35.29%), Postives = 86/136 (63.24%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKP--------GQFNGDGVPLPGEDEPLHAYVT-----SMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
            A+++E++++P ++YPD NF G I+GPRG+T K+LE ETG KI++RGKGS +         G+ N + +     +E LH  +T     + ++  + +A  +++K++   +   E +++L+K Q+ +LAI NGTYR+ 
Sbjct:   82 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEMNRGKPNWEHL-----NEDLHVLITVEDTHNRAKIKLQRAINEVKKLL---VPAAEGEDNLKKMQLMELAILNGTYRDA 209          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033069.1 (protein quaking-B-like [Source:NCBI gene;Acc:101161529])

HSP 1 Score: 89.7373 bits (221), Expect = 3.934e-19
Identity = 48/135 (35.56%), Postives = 86/135 (63.70%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKP--------GQFNGDGVPLPGEDEPLHAYVT-----SMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRE 1254
            A+++E++++P ++YPD NF G I+GPRG+T K+LE ETG KI++RGKGS +         G+ N + +     +E LH  +T     + ++  + +A  +++K++   +   E +++L+K Q+ +LAI NGTYR+
Sbjct:   82 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEMNRGKPNWEHL-----NEDLHVLITVEDTHNRAKIKLQRAINEVKKLL---VPAAEGEDNLKKMQLMELAILNGTYRD 208          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044982.1 (protein quaking-B-like [Source:NCBI gene;Acc:101161529])

HSP 1 Score: 89.3521 bits (220), Expect = 3.982e-19
Identity = 48/136 (35.29%), Postives = 86/136 (63.24%), Query Frame = 1
Query:  889 ARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKP--------GQFNGDGVPLPGEDEPLHAYVT-----SMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
            A+++E++++P ++YPD NF G I+GPRG+T K+LE ETG KI++RGKGS +         G+ N + +     +E LH  +T     + ++  + +A  +++K++   +   E +++L+K Q+ +LAI NGTYR+ 
Sbjct:   82 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEMNRGKPNWEHL-----NEDLHVLITVEDTHNRAKIKLQRAINEVKKLL---VPAAEGEDNLKKMQLMELAILNGTYRDA 209          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000060577.1 (SMESG000060577.1)

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 472/483 (97.72%), Postives = 474/483 (98.14%), Query Frame = 1
Query:  118 MTRKENSPTPRNRRDSPXXXXXXXXXXXXYGCKRERSFEEQIRNKXXXXXXXXXXKTKEVDYDYKHDRKRHEHSRDHSDRIKHRKRERSNFSPTRNESLMKLENFEYSEHRSTKMTDDDTRRYSPTQHILRSDHKXXXXXXXXXXXXXTRKRKRESKWGTGQAKVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELGVDGTDTKPAYLGFIPQHNSGNTTQGTSSFVKNFIFRN 1566
            MTRKENSPT RNRRDSPRD DTKRRKDKDYG KRERSFEEQIRNKSPSRRDRSSRKTKEVD DYKHDRKRHEHSRDHSDRIKHRKRERSNFSPTRNESLMKLENFE SEHRS+K TD DTRRYSPTQHILRSDHKEENF NSDNNSESTRKRKRESKWGTGQAKVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDG PLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELGVDGTDTKPA+LGFIPQHNSGNTTQGTSSFVKNFIFRN
Sbjct:    1 MTRKENSPTRRNRRDSPRDFDTKRRKDKDYGFKRERSFEEQIRNKSPSRRDRSSRKTKEVDNDYKHDRKRHEHSRDHSDRIKHRKRERSNFSPTRNESLMKLENFENSEHRSSKRTDYDTRRYSPTQHILRSDHKEENFFNSDNNSESTRKRKRESKWGTGQAKVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGAPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELGVDGTDTKPAFLGFIPQHNSGNTTQGTSSFVKNFIFRN 483          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031867.1 (SMESG000031867.1)

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 319/467 (68.31%), Postives = 377/467 (80.73%), Query Frame = 1
Query:  232 EEQIRNKXXXXXXXXXXKTKEVDYDYKH-------------DRKRHEHSRDHSDRIKHRKRERSNFSPTRNESLMKLENFEYSEHRSTKMTD---------DDTRRYSPTQHILRSDHKXXXXXXXXXXXXXTRKRKRESKWGTGQAKVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELGVDGTDTKPAYLGFIPQHNSGNTTQGTSSFVKNFIFRN 1566
            +E  RNKSPSR D SSRK K+ D DYK               RKR ++S + S R KH KR+RS  + +R E  +K EN EYSE +S+K             D++ +   + +++ +   +   + +N+ ++TRKRKRESKW +GQAKVP+YL  +DAEVYSIQIQ+NS+TTKL Q+NY EEIEAMCR PSPDPVY H+GKRINTKE+RARER+++RKRNLILRL+ALRP+LVPHADKM+GARIEE++FIPQ+DYPDINFAGLIIGPRGMTQK+LEKETGTKIL+RGKGSAKPG+ NG   PLPGEDEPLHAY+TSMSRESVD+A EKI+KIIQDGIEFPELQNDLRKNQMKQLAI NGTYRET+GLNKLKIL EAQSI TNTIICSLCGGTGHLPRDC VNSN IPMM FP QH +LEGEY+NFINELG+D    KPAYLGF+PQ +SGN++QG SSFV+NFIFR+
Sbjct:   40 QESSRNKSPSRADHSSRKRKDKDRDYKRREHSNDSKRERSPKRKRQDYSPESSYRKKHHKRDRSYSNSSRKEKPIKQENNEYSETQSSKRISPKKETYDSYHDSQIFVKQESLIKQEASVKTEDSDNNSEKATRKRKRESKWSSGQAKVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLGFMPQQSSGNSSQGASSFVRNFIFRS 506          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031862.1 (SMESG000031862.1)

HSP 1 Score: 433.721 bits (1114), Expect = 1.774e-149
Identity = 215/347 (61.96%), Postives = 265/347 (76.37%), Query Frame = 1
Query:  568 KRKRESKWGTGQ----------AKVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFP----PQHAKLEGEYDNFINELGVDGTDTK-PAYLGFIPQHNSGN-TTQGTSSFVKNFIF 1560
            K+ R+S+W T +            +P  +N +DAEVY IQ+Q+  +T+KL ++NY  EIEAM R PSPDP+Y  +GKRINTKE+RARERL+DRK+ L+L+LH LRP+LVPH DK IG R EE++FIPQ+DYPDIN  GLIIGPRG+T K+LEKE   KI+IRGKGS   G+ N + VPLPGEDE LHAY+TS S+E V+KA ++I KIIQ+GI+FPEL+NDLRKNQMKQLAI NGTYRET+GLNKLK+LGEAQS VTNTIICSLCGGTGHLPRDC VN N      FP    PQ + L+GEY +F+NELG +G  T  PAYLGF+P+    N +  G +SFV+ F+F
Sbjct:   24 KKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDK-IGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQN---PAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLGFLPEFPPPNASVDGANSFVRKFVF 366          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000068399.1 (SMESG000068399.1)

HSP 1 Score: 89.3521 bits (220), Expect = 4.517e-19
Identity = 48/134 (35.82%), Postives = 83/134 (61.94%), Query Frame = 1
Query:  895 IEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKP--------GQFNGDGVPLPGEDEPLHAYVTSMSRES-----VDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRET 1257
            ++E++++P ++ P+ NF G I+GPRG+T K+LE+E   K++IRGKGS +         G+ N + +     ++ LH  +T    E+     +  A + I K I+ GI+ P+ ++D++K Q+ +LAI NGTYR+T
Sbjct:   92 LQEKVYVPVDENPNYNFIGRILGPRGLTAKQLEQELQCKLMIRGKGSLRNKEKEDELRGKPNWEHL-----NDKLHINITVEDYENRAVIKLKWALDAIEKFIEQGIKMPDGEDDIKKRQLMELAIINGTYRDT 220          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000080790.1 (SMESG000080790.1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.948e-13
Identity = 42/126 (33.33%), Postives = 69/126 (54.76%), Query Frame = 1
Query:  898 EERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGVPLPGE---DEPLHAYVT-----SMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYR 1251
            +E+IF+P ++ P+ NF G I+GPRG T K+LE++   KI+IRG+GS +           P     +E LH  +      +   E ++   E I   IQ+G+  PE  + L++ Q+ +L+I N + R
Sbjct:   64 QEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDCENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 189          
The following BLAST results are available for this feature:
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SF11.794e-7145.49splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
SF14.640e-7145.49splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
SF11.596e-7045.49splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
SF12.475e-7045.49splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
SF13.439e-7045.49splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfa-11.626e-5737.78SF1 protein; Splicing FActor [Source:UniProtKB/Tr... [more]
gld-11.047e-2234.51Female germline-specific tumor suppressor gld-1 [... [more]
gld-11.047e-2234.51Female germline-specific tumor suppressor gld-1 [... [more]
asd-25.294e-2135.93RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
asd-28.954e-2135.93RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SF11.608e-7642.77gene:FBgn0025571 transcript:FBtr0083456[more]
how3.937e-1933.53gene:FBgn0264491 transcript:FBtr0100514[more]
how4.631e-1933.53gene:FBgn0264491 transcript:FBtr0084178[more]
how5.671e-1933.53gene:FBgn0264491 transcript:FBtr0335195[more]
how6.370e-1933.53gene:FBgn0264491 transcript:FBtr0084177[more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf13.465e-7445.21splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
sf16.037e-7345.21splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
qki23.827e-2037.50QKI, KH domain containing, RNA binding 2 [Source:N... [more]
qki24.522e-2037.50QKI, KH domain containing, RNA binding 2 [Source:N... [more]
qki25.971e-2037.50QKI, KH domain containing, RNA binding 2 [Source:N... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
men11.174e-7144.19menin 1 [Source:NCBI gene;Acc:549115][more]
men12.001e-7043.32menin 1 [Source:NCBI gene;Acc:549115][more]
men14.114e-7043.32menin 1 [Source:NCBI gene;Acc:549115][more]
spsb36.090e-1935.29splA/ryanodine receptor domain and SOCS box contai... [more]
spsb38.342e-1731.79splA/ryanodine receptor domain and SOCS box contai... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sf11.761e-7247.86splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
Sf11.761e-7247.86splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
Sf11.078e-7045.14splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
Sf11.078e-7045.14splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
Sf11.529e-7045.14splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15637|SF01_HUMAN1.652e-6945.49Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 P... [more]
sp|Q64213|SF01_MOUSE1.152e-6845.14Splicing factor 1 OS=Mus musculus OX=10090 GN=Sf1 ... [more]
sp|Q8NIW7|BBP_NEUCR1.887e-5032.50Branchpoint-bridging protein OS=Neurospora crassa ... [more]
sp|Q4WXV6|BBP_ASPFU4.654e-4833.57Branchpoint-bridging protein OS=Neosartorya fumiga... [more]
sp|P0CO44|BBP_CRYNJ6.387e-4736.02Branchpoint-bridging protein OS=Cryptococcus neofo... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4V6J63.116e-10881.18SF1 protein (Fragment) OS=Dugesia japonica OX=6161... [more]
G4VNH19.256e-8445.54Putative zinc finger protein OS=Schistosoma manson... [more]
A0A0B7A7S89.690e-8446.23CCHC-type domain-containing protein (Fragment) OS=... [more]
A0A5K4F2D99.865e-8445.54Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A1S3KCY71.638e-8347.62splicing factor 1 isoform X1 OS=Lingula unguis OX=... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf12.903e-7143.08splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
qki23.656e-2037.50protein quaking-B [Source:NCBI gene;Acc:103029551][more]
qki24.557e-2037.50protein quaking-B [Source:NCBI gene;Acc:103029551][more]
qki25.060e-2037.50protein quaking-B [Source:NCBI gene;Acc:103029551][more]
qkib5.360e-1936.03QKI, KH domain containing, RNA binding b [Source:Z... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sf12.656e-6943.17splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
khdrbs21.371e-928.13KH domain containing, RNA binding, signal transduc... [more]
KHDRBS33.363e-929.69KH RNA binding domain containing, signal transduct... [more]
khdrbs1a6.270e-844.00KH domain containing, RNA binding, signal transduc... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MSL54.239e-4333.70Component of commitment complex; which defines fir... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO454847.437e-4041.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302972.406e-1934.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286411.587e-1249.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441272.478e-1230.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf19.992e-6841.56splicing factor 1 [Source:NCBI gene;Acc:101157648][more]
sf11.219e-6741.56splicing factor 1 [Source:NCBI gene;Acc:101157648][more]
ENSORLT00000045137.13.503e-1935.29protein quaking-B-like [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000033069.13.934e-1935.56protein quaking-B-like [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000044982.13.982e-1935.29protein quaking-B-like [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060577.10.000e+097.72SMESG000060577.1[more]
SMESG000031867.10.000e+068.31SMESG000031867.1[more]
SMESG000031862.11.774e-14961.96SMESG000031862.1[more]
SMESG000068399.14.517e-1935.82SMESG000068399.1[more]
SMESG000080790.13.948e-1333.33SMESG000080790.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035290 ID=SMED30035290|Name=CCHC-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1614bp
TCAAAAAGGCTTAAAACATATTTAAAATATAATATTTAATTGTTTAAATA
AGGAAGATTAAATTGAAAATTATATAATAAGATTCAAATTCAAAAAATTT
GATTTATAAAAATAAAAATGACCAGAAAAGAAAATTCTCCAACACCTAGA
AATAGAAGAGATTCGCCGCGTGATATTGATACAAAGAGAAGAAAAGATAA
AGACTACGGTTGTAAGAGAGAAAGATCTTTTGAAGAACAAATCAGAAATA
AATCTCCTTCAAGAAGAGATCGCTCATCTCGAAAAACGAAGGAGGTAGAT
TATGATTATAAACATGATCGTAAACGCCATGAACATTCTAGAGACCATTC
TGATCGTATAAAGCACCGTAAACGGGAGAGATCCAATTTCAGTCCAACCA
GAAATGAAAGTCTAATGAAATTAGAAAATTTTGAGTACTCTGAACATAGA
AGTACAAAAATGACTGATGATGATACGCGTAGATATTCTCCCACTCAACA
CATACTTCGAAGTGACCATAAAGAAGAAAATTTTTCAAACTCAGACAACA
ATTCTGAATCCACAAGGAAAAGAAAACGTGAAAGTAAATGGGGAACTGGT
CAAGCAAAAGTACCAATGTATTTAAACTCAGAAGATGCCGAAGTATATTC
GATCCAAATTCAATTGAATAGTGTCACAACCAAATTAACACAAAGAAATT
ACGCCGAAGAAATCGAAGCAATGTGCCGTGAACCATCCCCAGATCCAGTT
TATAATCACGAGGGTAAACGTATTAATACGAAAGAATTTCGAGCTCGAGA
ACGTTTAGATGATCGCAAACGAAATTTGATTCTCAGACTCCATGCATTAA
GGCCTGAACTAGTTCCTCACGCAGACAAAATGATTGGAGCGAGAATAGAA
GAAAGGATATTTATCCCACAGGAAGACTATCCCGACATTAACTTTGCAGG
ATTGATTATCGGCCCACGAGGAATGACACAAAAGGAACTTGAAAAAGAAA
CCGGTACAAAAATTCTGATACGTGGCAAAGGAAGCGCAAAACCAGGCCAA
TTTAATGGAGATGGCGTTCCTCTGCCCGGCGAAGATGAACCTCTTCATGC
TTATGTCACTTCAATGTCAAGAGAAAGTGTCGATAAAGCCGCAGAGAAAA
TAAGAAAAATAATCCAAGACGGAATTGAATTTCCCGAACTACAAAACGAT
TTGCGTAAAAATCAAATGAAACAATTAGCCATTTTTAACGGGACATACAG
GGAAACAGAAGGATTAAACAAATTGAAAATCCTTGGAGAGGCGCAGTCAA
TCGTTACAAACACTATAATCTGTAGTCTGTGCGGGGGTACCGGACATTTG
CCCAGGGATTGCTTGGTGAACAGTAACCTAATTCCGATGATGCATTTTCC
ACCTCAACACGCAAAATTAGAAGGAGAGTATGATAATTTTATTAATGAGC
TTGGAGTTGATGGAACCGATACGAAGCCAGCATATTTAGGATTTATTCCG
CAACATAATTCCGGAAATACGACTCAAGGAACCAGCTCATTCGTGAAAAA
TTTTATATTTAGAAACTGATCATGTGTTTGTTTTATATACTGTTGTATAA
ATATTATTCTCTGC
back to top

protein sequence of SMED30035290-orf-1

>SMED30035290-orf-1 ID=SMED30035290-orf-1|Name=SMED30035290-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=484bp
MTRKENSPTPRNRRDSPRDIDTKRRKDKDYGCKRERSFEEQIRNKSPSRR
DRSSRKTKEVDYDYKHDRKRHEHSRDHSDRIKHRKRERSNFSPTRNESLM
KLENFEYSEHRSTKMTDDDTRRYSPTQHILRSDHKEENFSNSDNNSESTR
KRKRESKWGTGQAKVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIE
AMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVP
HADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKIL
IRGKGSAKPGQFNGDGVPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQ
DGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNTI
ICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELGVDGT
DTKPAYLGFIPQHNSGNTTQGTSSFVKNFIFRN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036612KH_dom_type_1_sf
IPR031150BBP/SF1
IPR004087KH_dom
IPR004088KH_dom_type_1
IPR032570SF1-HH
IPR001878Znf_CCHC
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0008270zinc ion binding
GO:0045131pre-mRNA branch point binding
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004087K Homology domainSMARTSM00322kh_6coord: 258..350
e-value: 5.1E-11
score: 52.6
IPR004088K Homology domain, type 1PFAMPF00013KH_1coord: 262..346
e-value: 1.1E-6
score: 28.4
IPR032570Splicing factor 1, helix-hairpin domainPFAMPF16275SF1-HHcoord: 158..252
e-value: 2.7E-17
score: 63.1
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 187..384
e-value: 2.9E-45
score: 156.8
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 261..379
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..160
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..74
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 102..159
NoneNo IPR availablePANTHERPTHR11208RNA-BINDING PROTEIN RELATEDcoord: 102..451
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 275..345
score: 8.471
NoneNo IPR availableCDDcd02395SF1_like-KHcoord: 262..378
e-value: 6.50763E-41
score: 140.842
IPR031150BBP/SF1 familyPANTHERPTHR11208:SF45SPLICING FACTOR 1coord: 102..451
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 402..415
score: 8.73