Protocadherin-11 X-linked

Overview
NameProtocadherin-11 X-linked
Smed IDSMED30035286
Length (bp)3214
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-11 X-linked (SMED30035286) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30035286) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-11 X-linked (SMED30035286) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30035286) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035286

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035286SMESG000067388.1 SMESG000067386.1 dd_Smed_v4_15376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035286SMESG000067388.1 SMESG000067386.1 dd_Smed_v6_15376_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035286SMESG000067388.1 SMESG000067386.1 OX_Smed_1.0.09117ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 231.106 bits (588), Expect = 7.244e-62
Identity = 231/811 (28.48%), Postives = 391/811 (48.21%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATD---FDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIF----KNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C         ++ C  EV + +    I  + ++  +IED+NDNAP++      +S  ENS I S+ +LP A D D+G NG   Y +  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F ++    E  + EN+P GT +  L A D D G N +  F  S   S    + F L   TG + IK  +D +    H +  V+  D  + P    + A+V +++ D+ND  P+I   Y  NP + T+   + EN    T I  I+V D+D+    +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      I EN   G  L  ++  +D DS  N +  + L  ++P +  F++D++  +L      DRE+   +   ILA D+G   LTS+  V+V I D NDN  + T    +FY+ EN  R   +G+I  TD    DN  +   I +++   F+I+  +G +    S DRE+QE++   V A D      ++S  VT+ VVD NDNKP+F     N +  + +  S +PG  + +++A D D G N  V+Y +   + ++ LF +D ++G++ L        + LH +          ++A D GQP+  ++FS + +    N +   +   ++  + S +  +  N               +L+AA++G + ++++I I  +V
Sbjct:   87 VYKTGD--VPLIRIEEDTGEIFTTGARIDREKLCAG----IPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEI--EVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNH-KLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTV--VLSENIPLNTKIALITVTDKDADHNGRVTC---FTDHEIPFRLRPVFS------NQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQL-MKVSATDADSGPNAEINYLLGPDAPPE--FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVL-PSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-LFAIDQETGNITLMEKCDVTDLGLHRVL---------VKANDLGQPD--SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVV 855          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 231.106 bits (588), Expect = 7.244e-62
Identity = 231/811 (28.48%), Postives = 391/811 (48.21%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATD---FDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIF----KNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C         ++ C  EV + +    I  + ++  +IED+NDNAP++      +S  ENS I S+ +LP A D D+G NG   Y +  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F ++    E  + EN+P GT +  L A D D G N +  F  S   S    + F L   TG + IK  +D +    H +  V+  D  + P    + A+V +++ D+ND  P+I   Y  NP + T+   + EN    T I  I+V D+D+    +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      I EN   G  L  ++  +D DS  N +  + L  ++P +  F++D++  +L      DRE+   +   ILA D+G   LTS+  V+V I D NDN  + T    +FY+ EN  R   +G+I  TD    DN  +   I +++   F+I+  +G +    S DRE+QE++   V A D      ++S  VT+ VVD NDNKP+F     N +  + +  S +PG  + +++A D D G N  V+Y +   + ++ LF +D ++G++ L        + LH +          ++A D GQP+  ++FS + +    N +   +   ++  + S +  +  N               +L+AA++G + ++++I I  +V
Sbjct:   87 VYKTGD--VPLIRIEEDTGEIFTTGARIDREKLCAG----IPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEI--EVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNH-KLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTV--VLSENIPLNTKIALITVTDKDADHNGRVTC---FTDHEIPFRLRPVFS------NQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQL-MKVSATDADSGPNAEINYLLGPDAPPE--FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVL-PSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-LFAIDQETGNITLMEKCDVTDLGLHRVL---------VKANDLGQPD--SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVV 855          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 231.106 bits (588), Expect = 8.365e-62
Identity = 231/811 (28.48%), Postives = 391/811 (48.21%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATD---FDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIF----KNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C         ++ C  EV + +    I  + ++  +IED+NDNAP++      +S  ENS I S+ +LP A D D+G NG   Y +  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F ++    E  + EN+P GT +  L A D D G N +  F  S   S    + F L   TG + IK  +D +    H +  V+  D  + P    + A+V +++ D+ND  P+I   Y  NP + T+   + EN    T I  I+V D+D+    +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      I EN   G  L  ++  +D DS  N +  + L  ++P +  F++D++  +L      DRE+   +   ILA D+G   LTS+  V+V I D NDN  + T    +FY+ EN  R   +G+I  TD    DN  +   I +++   F+I+  +G +    S DRE+QE++   V A D      ++S  VT+ VVD NDNKP+F     N +  + +  S +PG  + +++A D D G N  V+Y +   + ++ LF +D ++G++ L        + LH +          ++A D GQP+  ++FS + +    N +   +   ++  + S +  +  N               +L+AA++G + ++++I I  +V
Sbjct:   98 VYKTGD--VPLIRIEEDTGEIFTTGARIDREKLCAG----IPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEI--EVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNH-KLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTV--VLSENIPLNTKIALITVTDKDADHNGRVTC---FTDHEIPFRLRPVFS------NQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQL-MKVSATDADSGPNAEINYLLGPDAPPE--FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVL-PSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-LFAIDQETGNITLMEKCDVTDLGLHRVL---------VKANDLGQPD--SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVV 866          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 230.72 bits (587), Expect = 1.144e-61
Identity = 231/811 (28.48%), Postives = 391/811 (48.21%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATD---FDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIF----KNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C         ++ C  EV + +    I  + ++  +IED+NDNAP++      +S  ENS I S+ +LP A D D+G NG   Y +  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F ++    E  + EN+P GT +  L A D D G N +  F  S   S    + F L   TG + IK  +D +    H +  V+  D  + P    + A+V +++ D+ND  P+I   Y  NP + T+   + EN    T I  I+V D+D+    +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      I EN   G  L  ++  +D DS  N +  + L  ++P +  F++D++  +L      DRE+   +   ILA D+G   LTS+  V+V I D NDN  + T    +FY+ EN  R   +G+I  TD    DN  +   I +++   F+I+  +G +    S DRE+QE++   V A D      ++S  VT+ VVD NDNKP+F     N +  + +  S +PG  + +++A D D G N  V+Y +   + ++ LF +D ++G++ L        + LH +          ++A D GQP+  ++FS + +    N +   +   ++  + S +  +  N               +L+AA++G + ++++I I  +V
Sbjct:   98 VYKTGD--VPLIRIEEDTGEIFTTGARIDREKLCAG----IPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKET--EIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNH-KLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTV--VLSENIPLNTKIALITVTDKDADHNGRVTC---FTDHEIPFRLRPVFS------NQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQL-MKVSATDADSGPNAEINYLLGPDAPPE--FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVL-PSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-LFAIDQETGNITLMEKCDVTDLGLHRVL---------VKANDLGQPD--SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVV 866          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 230.335 bits (586), Expect = 1.515e-61
Identity = 232/811 (28.61%), Postives = 388/811 (47.84%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATD---FDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIF----KNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C         ++ C  EV + +    I  + ++  +IED+NDNAP++      +S  ENS I S+ +LP A D D+G NG   Y +  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F ++    E  + EN+P GT +  L A D D G N +  F  S   S    + F L   TG + IK  +D +    H +  V+  D  + P    + A+V +++ D+ND  P+I   Y  NP + T+   + EN    T I  I+V D+D+    +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      I EN   G  L  ++   D DS  N K  + L  ++P +  F++D +  +L      DRE+   +   ILA D+G   LTS+  V+V I D NDN  + T     FY+ EN  R   +G+I  TD    DN  +   I +++   F+I+  +G +    S DRE+QE++   V A D      ++S  VT+ VVD NDNKP+F     N +  + +  S +PG  + +++A D D G N  V+Y +   + ++ LF +D ++G++ L        + LH +          ++A D GQP+  ++FS + +    N +   +   ++  + S +  +  N               +L+AA++G + ++++I I  +V
Sbjct:   66 VYKTGD--VPLIRIEEDTGEIFTTGARIDREKLCAG----IPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEI--EVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNH-KLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTV--VLSENIPLNTKIALITVTDKDADHNGRVTC---FTDHEIPFRLRPVFS------NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQL-TKVSAMDADSGPNAKINYLLGPDAPPE--FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVL-PSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-LFAIDQETGNITLMEKCDVTDLGLHRVL---------VKANDLGQPD--SLFSVVIVNLFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVV 834          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 208.379 bits (529), Expect = 2.794e-54
Identity = 224/807 (27.76%), Postives = 368/807 (45.60%), Query Frame = 3
Query:  222 IYRIKEETEIGYVIDYIKPNDQNNLKIFNT-----NDNGVNCFELESSTGKLFITRRIDREEICPTNRLLK-SNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSK--GLDKVHCES---YFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHS--TVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFT---IDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLG----VIKATDF---DNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEP--LFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWT---TNRNEPASRESDKSKKSSYDQFLNENVLIAAISGLLV 2546
            +  + E+T I  +I  +K +  ++  ++ +     +    N F L++ +G++ + + +DRE +     +LK +  ++ + TI  +   +       + + DV DN+PI+  D       E++PIG+      A D+D G NG++ Y + E   +N   +   +G+ I+    LDRE  ++  + +IA D G+P + +   V + ++DVNDN P F    +     + EN     VI  +KA D DFG NG+  + M+  +S  +    +   TGEV ++ +ID  +        VI      +P +LSS   + I++ DIND  PT+        +A    T+ EN +    +G++   D DS   G+ K   E    + +D D        G        I + +  DRET ++ + ++   D    S  T   + +++ D+NDN P F+K  Y+  I E  P G+ +   + +   D++ + K T  IE      F+   I  Q  IL       R+   V +++I A D G   L   C+V V I DVN  P       +  +  +  + S +G     +KA D    DN  I Y ID  S   F I+  SG + + + LDRE++ T  + VTASD        ST + V++ D NDN P F + +    I      G    ++ A DAD G NG+V Y L +SS      LF LD  SG L ++  L   R       L I A D+G P   ++ +  EI  T    N N P        ++ SYD ++ EN  + +  G +V
Sbjct:  171 VKELPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVL--DKHILKVTAYERVDPTISASTTVV-------VHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGV-IQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSY--NVTILENITIPAVIATVKATDEDFGTNGKVHYSMA--SSSGIGGLTIDYSTGEVTLRERIDAKNSPIT---AVIRAKDGAQP-ALSSTVPLTINVIDINDHAPTLI-------AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDS-------GL-------IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQI---ITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGG--LQGRCVVNVFIDDVNSAPY----FNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID--SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLD--REQFAVIVLPIFARDRGTP---SLSAASEITLTLSDVNDNAPT------FEQLSYDLYIAENSPVGSTVGTIV 915          

HSP 2 Score: 149.828 bits (377), Expect = 4.047e-36
Identity = 163/626 (26.04%), Postives = 282/626 (45.05%), Query Frame = 3
Query:  207 LSSNKIYRIKEETEIGYVIDYIKPNDQNNL--KIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIK-LTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQ--DNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPT-GEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDS-FFTIDQ---QNQILK--SKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENK-----QRSLLGVIKATDFD-NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDR 2024
            +++ K+  ++E   IG  +  +   D+++    I   +  G   F ++  +G +  T+ +DRE          +     +VT + +   ++N    ++++++D+NDNAP +   +  V+ +E  P GS+    +A D D   + ++ YR+E   R  F +    D G  +  +  L R+   V  + I A D G         V V I DVN + P F D  F    ++ E+SP G  ++ LKA DHD G+N    +      S +  + F + P+ G++ + S +D + D+  F   V   DHA  P + S++  +E+ + DIND  P          S++   TI E+    T   Q+S  D D      V    YFL+    +P I +   +     +  + K DRE  + +   I   D  T   S    +T+ + DVNDN P F + +Y  YI EN P+G+ +   +   D D  +N   +  I    D+  F I++   QN +++  ++  FD E  +      L    G  +L+S+  V +H+ DVNDN     P +  F I  N+         +G I A D D N T+ Y ++         EK++G++ ++    R
Sbjct:  480 IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRE---------TTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGG--LQGRCVVNVFIDDVN-SAPYFNDHPF--SVKIPEHSPIGYPVITLKAEDHDRGDNARIVY------SIDSSQFFRIDPSSGDISVSSDLDRE-DRATFSVIVTASDHASPPLNTSTQ--IEVILDDINDNSPQFT-------SSSYAATISEDIPVGTSFLQVSAIDADIGPNGIV---DYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGT-IVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG--QLSSTVPVRIHVSDVNDN----KPALKDFVILMNRFDNVQMARQIGFIPAFDPDQNATLEYFLEENDL--IEAEKYTGKILVKQEWKR 1060          

HSP 3 Score: 140.198 bits (352), Expect = 4.112e-33
Identity = 171/628 (27.23%), Postives = 281/628 (44.75%), Query Frame = 3
Query:  486 LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENT--QMLDRE----KKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVF--ENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN--KQRSLLGVIKATDFD---NQTIYYLIDNKSQSK----FSIEKHSGRLFLQNSLDREEQETHHITVTASD----SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPLFNLDSDS 2300
            + I + DVNDNAP++ +D   V+  EN  I +  +  +ATD D G+NG+V Y M S            GL I+ +  ++  RE    K +    +I A+D   P  S+ + +T+ +ID+ND+ P    ++   +K +   EN   G  +  + A+D D G NG   + M      E  + F++   +G ++    +D ++    +  KV  +D      SL++   + + ++DIND  PT        D    N TI E     + I  +   D D         E     + ++  I+ IG    ++  I+S     +  + K+  EI  TD         + + I DVN + P FN   +   I E+ PIG  +   +   D D  +N +   SI+S    FF ID  +  +      DRE  +   + + A DH    L +S  + V + D+NDN    T       ISE+     S L V  A D D   N  + Y ++  S S     F +++ SG L + + LDRE+     + + A D    SL  AS  +T+ + D NDN P F+ ++  + I  +   G  +  IVA DAD G+N  + + I   +  K  LF+++ D+
Sbjct:  361 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSS-------GIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAP----TLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM------EGSEDFIIDEDSGLIKTTKLLDRET-TARYSLKVTARDMGTP--SLNTSTTIAVVLKDINDNAPTF-------DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEA---DREVFSILDIG----DQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVIT-LKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQV-SAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAAS-EITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAK--LFDIEEDA 946          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 149.443 bits (376), Expect = 4.391e-36
Identity = 163/626 (26.04%), Postives = 282/626 (45.05%), Query Frame = 3
Query:  207 LSSNKIYRIKEETEIGYVIDYIKPNDQNNL--KIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIK-LTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQ--DNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDS-FFTID---QQNQILK--SKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENK-----QRSLLGVIKATDFD-NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDR 2024
            +++ K+  ++E   IG  +  +   D+++    I   +  G   F ++  +G +  T+ +DRE          +     +VT + +   ++N    ++++++D+NDNAP +   +  V+ +E  P GS+    +A D D   + ++ YR+E   R  F +    D G  +  +  L R+   V  + I A D G         V V I DVN + P F D  F    ++ E+SP G  ++ LKA DHD G+N    +      S +  + F + P +G++ + S +D + D+  F   V   DHA  P + S++  +E+ + DIND  P          S++   TI E+    T   Q+S  D D      V    YFL+    +P I +   +     +  + K DRE  + +   I   D  T   S    +T+ + DVNDN P F + +Y  YI EN P+G+ +   +   D D  +N   +  I    D+  F I+   +QN +++  ++  FD E  +      L    G  +L+S+  V +H+ DVNDN     P +  F I  N+         +G I A D D N T+ Y ++         EK++G++ ++    R
Sbjct:  121 IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRE---------TTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGG--LQGRCVVNVFIDDVN-SAPYFNDHPF--SVKIPEHSPIGYPVITLKAEDHDRGDNARIVY------SIDSSQFFRIDPSSGDISVSSDLDRE-DRATFSVIVTASDHASPPLNTSTQ--IEVILDDINDNSPQFT-------SSSYAATISEDIPVGTSFLQVSAIDADIGPNGIV---DYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGT-IVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG--QLSSTVPVRIHVSDVNDN----KPALKDFVILMNRFDNVQMARQIGFIPAFDPDQNATLEYFLEENDL--IEAEKYTGKILVKQEWKR 701          

HSP 2 Score: 140.198 bits (352), Expect = 3.501e-33
Identity = 171/628 (27.23%), Postives = 281/628 (44.75%), Query Frame = 3
Query:  486 LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENT--QMLDRE----KKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVF--ENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN--KQRSLLGVIKATDFD---NQTIYYLIDNKSQSK----FSIEKHSGRLFLQNSLDREEQETHHITVTASD----SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPLFNLDSDS 2300
            + I + DVNDNAP++ +D   V+  EN  I +  +  +ATD D G+NG+V Y M S            GL I+ +  ++  RE    K +    +I A+D   P  S+ + +T+ +ID+ND+ P    ++   +K +   EN   G  +  + A+D D G NG   + M      E  + F++   +G ++    +D ++    +  KV  +D      SL++   + + ++DIND  PT        D    N TI E     + I  +   D D         E     + ++  I+ IG    ++  I+S     +  + K+  EI  TD         + + I DVN + P FN   +   I E+ PIG  +   +   D D  +N +   SI+S    FF ID  +  +      DRE  +   + + A DH    L +S  + V + D+NDN    T       ISE+     S L V  A D D   N  + Y ++  S S     F +++ SG L + + LDRE+     + + A D    SL  AS  +T+ + D NDN P F+ ++  + I  +   G  +  IVA DAD G+N  + + I   +  K  LF+++ D+
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSS-------GIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAP----TLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM------EGSEDFIIDEDSGLIKTTKLLDRET-TARYSLKVTARDMGTP--SLNTSTTIAVVLKDINDNAPTF-------DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEA---DREVFSILDIG----DQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVIT-LKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQV-SAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAAS-EITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAK--LFDIEEDA 587          

HSP 3 Score: 111.309 bits (277), Expect = 2.504e-24
Identity = 115/405 (28.40%), Postives = 180/405 (44.44%), Query Frame = 3
Query: 1134 VVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATDFD-NQTIYYLIDNKSQSKFS---IEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
            +VEI + D+ND  P  A       S + N TILEN +    I  +   D D     KVH  S    +      I   T E      V+ R+      S + A IR  D +    S+   LTI ++D+ND+ P          ++EN  IG  +  R++  D+DS  NG    S+E   D  F ID+ + ++K+    DRE  + + LK+ A D G   L +S  + V +KD+NDN            ISE   R S +  +KA D D +Q I Y I+   +  FS   I      L +   L R++ +   + ++A+D        V  V +D+ ++ P F +    +KI      G+ +  + A D D G+N  + Y +  S +    F +D  SGD+ ++  L
Sbjct:    1 MVEITVVDVNDNAPVFA-------SDSYNVTILENITIPAVIATVKATDEDFGTNGKVH-YSMASSSGIGGLTIDYSTGE------VTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEV-GRVYAIDEDSGPNGIIKYSMEGSED--FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF----FRIDPSSGDISVSSDL 383          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 124.405 bits (311), Expect = 2.337e-28
Identity = 183/730 (25.07%), Postives = 305/730 (41.78%), Query Frame = 3
Query:  324 VNCFELESSTGKLFITRRIDREEIC----PTN-RLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLP------EATDIDIGSNGQVIYRM---ESKYRNSFRLFQDNGLYIENTQML-DREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKH-------FLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKV--------HCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD-TSDHSTVKNLTIIILDVNDNPPEFN----KGTY--------HFYIKENEPIGTMLDNRMFVSDKDS-NNNGKFTLSIESPGD--SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSS-------CIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLG----VIKATDFDNQT--IYYLID-NKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKIC-KIVATDADHG-NNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
            +N F ++  TG + +   +   ++     P N  ++  ++  C V    TH +      L I IEDVN+N P +  D A  S       G+ ++ P      EATD D  +NG ++Y +   +S+ R +F + +  G+   +  ++ DRE +   ++ + A D G        Q +VE++D+NDN P+F    +      FE    GT ++ + A D+D  +N E T+ +  +T+   E          + R +GE+ +   I   + K  F F VI  D+ + P +L S A V +++ D   + P     P      T++  +  N   +      S   R+S  + K+          ES F   +K         N      +V     D E  +     +  TD TS  ++ K   + + DVND  P+F      GT         H      +PI T+   +   +D D   N   + +  E+ G+    F ID+    +     FDRE++ ++ L + A D     L  +         V + I DVNDN         Q YI   K+    G     IKA D D  +   Y+LI     +  F +   SG +F++  LD E  + +H+ + ASD  H A+T V + + D NDN P F+       +   +    K+   + ATDAD    +  + Y L+     E +F +   SG + L  +L
Sbjct:  795 MNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSY---ATLLIGIEDVNNNKPEFP-DCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAV--GTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQK--FIFNVIADDNGI-PEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFE-------NGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTV---KAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNA---PSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADE-VFRIGKYSGTIELVKAL 1501          

HSP 2 Score: 123.25 bits (308), Expect = 5.366e-28
Identity = 175/699 (25.04%), Postives = 302/699 (43.20%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNG-LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFG-NNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIG----QISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRE--TESKLNAEIRCTDTS--DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIG-TMLDNRMFVSDKDSNNNGKFTLSIESPGDSFF-TIDQQNQ-----ILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFD-NQTIYYLIDNKSQSK--FSIEKHSGRLFLQNSLDREEQETHHITVTASD-SLHTASXXXXXXXXDENDNKP---------IFKNMNKVIKIDASESPGFKICKIVATDADHGNNGL-----VKYILKKSSYKEPLFNLDSDSGDLHLAVS 2324
            F ++  TG++F   + DRE+I      ++++++           N + V ++ I+I DVNDNAP +   K I    E+   G      +A D+D  SN +         R  F +  D+G ++++  + LD E  + Y +++IA D      +N   V + I DVNDN P+F    +     + E+     V+  + A D D    +    +R+    + EV +  + + +G +E+   +D D       +  +VQ    +   L   A V+++++DIND  P    +P       +   I EN   +   G     +   D D    +  + E   + N  +N       ++ N   I + R  DRE  +E +   E+R  D          N+TI + D+NDN P F K  Y   ++E  PIG  ++    F +D+++ +N  FT  +    D F+ T D+ ++     +L+ K   D E V+      L I   D R  +   V+V + D ND+   I          +  + + +G   ATD D   T  + I+ +S  K  F+I++  G L + ++LDRE+   +++ + A D S +     V V + D NDN P         IF+    V ++          C+I ATD D    G      V    K S Y   +FN + D G+  + ++
Sbjct: 1271 FRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNV-KVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVK--EPLDFEASDQYHLVLIASDGRHNATTN---VYIHIEDVNDNAPQFEQQKY-ATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFR--IGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP---IFPER-----LFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQ-NTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDN-VFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQ-DGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGT--------CEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTIT 1941          

HSP 3 Score: 85.8853 bits (211), Expect = 1.409e-16
Identity = 125/520 (24.04%), Postives = 222/520 (42.69%), Query Frame = 3
Query:  183 FALIDIEGLSSNKIYRIKEETEIGYVIDYIKPNDQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREE-ICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKN----VYEIIIIAQDNGSPYK-SNELQVTVEIIDVNDNPPKFTDSIFRPEKQ----VFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV---RPTGEVEIK---SKIDYDSDKTHFEFKVIVQDHA---VEPY-SLSSEAVVEIDIQDIND---EFPTIAFYPRNPDSATMNPTILENSSTMTP--IGQISVHDRDSKGLDKVHCESYFLDNDKLNPII---AIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVK--NLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIE 1652
            ++++D++  S       + +  I Y ++   P D+               F ++ STG + +TR +D ++   P    LK   ++     + +H +      L+I I+DVNDN P +T         E+ P+        A D D G N ++ Y +++   ++F +   NG  I     LD ++ N    VY   + A+D+G P   S+   + +   + ND       ++F P  Q    V E++  GT ++ ++A D D     E T+          +K  L      TG V+++   S  D    +      VIVQD     V P  + +S A + I I+D+N+   EFP  A Y    D A     I+E +    P  I ++   D DS     +    Y+  ++     +     G   P+   +     FDRET  + +  ++ TD  D   +     ++ ++D+NDN P+F + +Y   +   E +GT +   +F  D D+ +N + T S+E
Sbjct:  547 YSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKW------------FRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDN---RESHVD------LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDN---HNFSI-NSNG-EISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDE-----SAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKY---SDIA----KIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVV-----FDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVIT-VFAFDNDAAHNAEITYSLE 1019          

HSP 4 Score: 76.2554 bits (186), Expect = 1.474e-13
Identity = 108/441 (24.49%), Postives = 175/441 (39.68%), Query Frame = 3
Query:  318 NGVNCFELESSTGKLFITRRIDRE---------EICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDN-------GLYIENTQMLDRE---KKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLS---SEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIG--QISVHDRDSKGLD---KVHCESYFLDNDKLNPII-AIGTNEPNEFNIVSNRKFDRETESK---LNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYH 1547
            NG + F ++ +TGK+F  R +DRE         E+   +R + S      VTIK+T               D+NDNAP +   +   S  E +PIG+      A D D  +   V     S+  + F +  D        G+ +   Q LD E   +++ + + I   D        E  V V ++D ND+ P    +    E +V E+ P GT I    A D D G+     FR++  + P  ++ F +   G + +   +D +         + V +  +E Y  S      +V + +QD+ND  P     PR        P I   ++ +  +G  +I   DRD+        +     F  +  LN I  A G        I   ++FDRE       L   +   D +      ++ +II D+NDN     + T H
Sbjct: 1597 NGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVT---------------DMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGV-LRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPHIHGAT---EHRVREDVPRGTSIGRYTATDRDAGDTAR--FRINRQSDP--KRQFTIDQDGTLRVAHTLDRED--------IAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPR--------PCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADRAGRRNEASVHVIIGDLNDNTMHDGRMTIH 1995          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 124.405 bits (311), Expect = 2.337e-28
Identity = 183/730 (25.07%), Postives = 305/730 (41.78%), Query Frame = 3
Query:  324 VNCFELESSTGKLFITRRIDREEIC----PTN-RLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLP------EATDIDIGSNGQVIYRM---ESKYRNSFRLFQDNGLYIENTQML-DREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKH-------FLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKV--------HCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD-TSDHSTVKNLTIIILDVNDNPPEFN----KGTY--------HFYIKENEPIGTMLDNRMFVSDKDS-NNNGKFTLSIESPGD--SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSS-------CIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLG----VIKATDFDNQT--IYYLID-NKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKIC-KIVATDADHG-NNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
            +N F ++  TG + +   +   ++     P N  ++  ++  C V    TH +      L I IEDVN+N P +  D A  S       G+ ++ P      EATD D  +NG ++Y +   +S+ R +F + +  G+   +  ++ DRE +   ++ + A D G        Q +VE++D+NDN P+F    +      FE    GT ++ + A D+D  +N E T+ +  +T+   E          + R +GE+ +   I   + K  F F VI  D+ + P +L S A V +++ D   + P     P      T++  +  N   +      S   R+S  + K+          ES F   +K         N      +V     D E  +     +  TD TS  ++ K   + + DVND  P+F      GT         H      +PI T+   +   +D D   N   + +  E+ G+    F ID+    +     FDRE++ ++ L + A D     L  +         V + I DVNDN         Q YI   K+    G     IKA D D  +   Y+LI     +  F +   SG +F++  LD E  + +H+ + ASD  H A+T V + + D NDN P F+       +   +    K+   + ATDAD    +  + Y L+     E +F +   SG + L  +L
Sbjct:  795 MNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSY---ATLLIGIEDVNNNKPEFP-DCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAV--GTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQK--FIFNVIADDNGI-PEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFE-------NGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTV---KAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNA---PSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADE-VFRIGKYSGTIELVKAL 1501          

HSP 2 Score: 123.25 bits (308), Expect = 5.366e-28
Identity = 175/699 (25.04%), Postives = 302/699 (43.20%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNG-LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFG-NNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIG----QISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRE--TESKLNAEIRCTDTS--DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIG-TMLDNRMFVSDKDSNNNGKFTLSIESPGDSFF-TIDQQNQ-----ILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFD-NQTIYYLIDNKSQSK--FSIEKHSGRLFLQNSLDREEQETHHITVTASD-SLHTASXXXXXXXXDENDNKP---------IFKNMNKVIKIDASESPGFKICKIVATDADHGNNGL-----VKYILKKSSYKEPLFNLDSDSGDLHLAVS 2324
            F ++  TG++F   + DRE+I      ++++++           N + V ++ I+I DVNDNAP +   K I    E+   G      +A D+D  SN +         R  F +  D+G ++++  + LD E  + Y +++IA D      +N   V + I DVNDN P+F    +     + E+     V+  + A D D    +    +R+    + EV +  + + +G +E+   +D D       +  +VQ    +   L   A V+++++DIND  P    +P       +   I EN   +   G     +   D D    +  + E   + N  +N       ++ N   I + R  DRE  +E +   E+R  D          N+TI + D+NDN P F K  Y   ++E  PIG  ++    F +D+++ +N  FT  +    D F+ T D+ ++     +L+ K   D E V+      L I   D R  +   V+V + D ND+   I          +  + + +G   ATD D   T  + I+ +S  K  F+I++  G L + ++LDRE+   +++ + A D S +     V V + D NDN P         IF+    V ++          C+I ATD D    G      V    K S Y   +FN + D G+  + ++
Sbjct: 1271 FRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNV-KVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVK--EPLDFEASDQYHLVLIASDGRHNATTN---VYIHIEDVNDNAPQFEQQKY-ATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFR--IGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP---IFPER-----LFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQ-NTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDN-VFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQ-DGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGT--------CEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTIT 1941          

HSP 3 Score: 85.8853 bits (211), Expect = 1.409e-16
Identity = 125/520 (24.04%), Postives = 222/520 (42.69%), Query Frame = 3
Query:  183 FALIDIEGLSSNKIYRIKEETEIGYVIDYIKPNDQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREE-ICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKN----VYEIIIIAQDNGSPYK-SNELQVTVEIIDVNDNPPKFTDSIFRPEKQ----VFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV---RPTGEVEIK---SKIDYDSDKTHFEFKVIVQDHA---VEPY-SLSSEAVVEIDIQDIND---EFPTIAFYPRNPDSATMNPTILENSSTMTP--IGQISVHDRDSKGLDKVHCESYFLDNDKLNPII---AIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVK--NLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIE 1652
            ++++D++  S       + +  I Y ++   P D+               F ++ STG + +TR +D ++   P    LK   ++     + +H +      L+I I+DVNDN P +T         E+ P+        A D D G N ++ Y +++   ++F +   NG  I     LD ++ N    VY   + A+D+G P   S+   + +   + ND       ++F P  Q    V E++  GT ++ ++A D D     E T+          +K  L      TG V+++   S  D    +      VIVQD     V P  + +S A + I I+D+N+   EFP  A Y    D A     I+E +    P  I ++   D DS     +    Y+  ++     +     G   P+   +     FDRET  + +  ++ TD  D   +     ++ ++D+NDN P+F + +Y   +   E +GT +   +F  D D+ +N + T S+E
Sbjct:  547 YSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKW------------FRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDN---RESHVD------LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDN---HNFSI-NSNG-EISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDE-----SAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKY---SDIA----KIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVV-----FDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVIT-VFAFDNDAAHNAEITYSLE 1019          

HSP 4 Score: 76.2554 bits (186), Expect = 1.474e-13
Identity = 108/441 (24.49%), Postives = 175/441 (39.68%), Query Frame = 3
Query:  318 NGVNCFELESSTGKLFITRRIDRE---------EICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDN-------GLYIENTQMLDRE---KKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLS---SEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIG--QISVHDRDSKGLD---KVHCESYFLDNDKLNPII-AIGTNEPNEFNIVSNRKFDRETESK---LNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYH 1547
            NG + F ++ +TGK+F  R +DRE         E+   +R + S      VTIK+T               D+NDNAP +   +   S  E +PIG+      A D D  +   V     S+  + F +  D        G+ +   Q LD E   +++ + + I   D        E  V V ++D ND+ P    +    E +V E+ P GT I    A D D G+     FR++  + P  ++ F +   G + +   +D +         + V +  +E Y  S      +V + +QD+ND  P     PR        P I   ++ +  +G  +I   DRD+        +     F  +  LN I  A G        I   ++FDRE       L   +   D +      ++ +II D+NDN     + T H
Sbjct: 1597 NGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVT---------------DMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGV-LRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPHIHGAT---EHRVREDVPRGTSIGRYTATDRDAGDTAR--FRINRQSDP--KRQFTIDQDGTLRVAHTLDRED--------IAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPR--------PCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADRAGRRNEASVHVIIGDLNDNTMHDGRMTIH 1995          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 123.25 bits (308), Expect = 5.261e-28
Identity = 150/609 (24.63%), Postives = 272/609 (44.66%), Query Frame = 3
Query:  498 IEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDID-----------IGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTI-AFYPRNPDSATMNPTILENSSTMTPIGQISVHD--RDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENK--QRSLLGVIK--ATDFDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS-LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSS 2264
            ++D NDNAP +      +  +E + +G+  +LP  TD D           +  N   ++++ S+  N     Q     + N Q LDRE ++ YE++I AQD G P K  +L+ ++EIID NDN P F+ S  R    V  N   G+ ++ ++A D D G N   ++ +   ++P    +F +  +G +   + +   S  TH +  V+  DH     SLSS AVV I +       P +   +    +SA +    +ENS+  + + ++S+    RD+K           + +  L P     T++ + + ++     DRET S+ + +                + I D+NDN P+++    H  +   +     L  +    D D   NG    S+        +ID++   +    T D    S  K ++ A D G   L++   V   + D    P      + Q  I E+      L+ V+   +   +++ I Y + N+ +   +++  SG + +Q + D E+Q+++  TV A+++   T+++ +++ + D NDN PIF      + +     P   +  + A+D D G  G V Y IL +SS
Sbjct:  112 VDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNE----QLQADLVVNGQ-LDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRS--RYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPS-NSNFAISQSGVITTTASLLPAS--TH-DVIVVASDHGSP--SLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHL----MENSTLGSIVARVSIAQQYRDTK--------LRLIGSSALCP---QQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIGDINDNAPQWHSSQIHISLNRTQGGSRTLTAK----DPDLGQNGWIRYSVLD--TELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDE-HLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESS 685          

HSP 2 Score: 121.709 bits (304), Expect = 1.626e-27
Identity = 159/683 (23.28%), Postives = 296/683 (43.34%), Query Frame = 3
Query:  492 IIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIY-----RMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDK----LNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHST--VKNLTIIILDVNDNPPEFNKGTYHFYIKEN-------EPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD---SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPA 2456
            + I D+NDNAP W + +  +S N     G  R+L  A D D+G NG + Y      + S  + + R+F  N         +D    +  +  + A+D GSP  S +LQV  +++D    PP+F  ++++ E  + E++P GT ++ + A +   GN+    + +        ++H  V   +G V I+   D++  K+ ++  VI    A    S +S +++ I ++D+ND +P   FYP        + T+ E      P+  +S  D DS    +V   SY + ++     +NP+            + + +   R    + +  +   D    S+    N+ I ++D +   P+F++  Y     E+         +G M   +  +   D ++N              F+ID+    +      D +      L I A     E   +  +++  I+D NDNP   +  + +  I E+ K      V++A+D D     +  Y +I +   S   I++ +G+L   + LD E    + + V A+D      +++ T+ + V+D NDN P F+     +++  +  P   + K+VA D D   NG + Y I   S Y    F +D   G+++   S+   R + ++  + I A D+G P + +  S        N N P+
Sbjct:  429 LTIGDINDNAPQWHSSQIHISLNRTQ--GGSRTL-TAKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVPN--------TIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVE--IPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQ-----DEHLTVDTMSGTVCIQKTFDFEKQKS-YQTTVI----ATNANSETSTSLISIRLKDVNDNWPI--FYPNE-----YHLTVREGPKPEEPLLVVSASDMDSGTFGEV---SYHILSESSSFSINPVTG---------EVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHN--------------FSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIF--IEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEY----FGIDEKLGNVYTKRSID--REVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPS 1044          

HSP 3 Score: 118.627 bits (296), Expect = 1.378e-26
Identity = 151/626 (24.12%), Postives = 274/626 (43.77%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPNDQ---NNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEF--NIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIII--LDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNP---VIITPLINQFYISENKQRSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            I E+T IG  +  +  N+    N+ +I  +  N      +++ +G + I +  D E+       + + N   E +  L          +SI ++DVNDN PI+  ++  ++  E         +  A+D+D G+ G+V Y + S+  +SF +    G       +     +  + +++ A+D G     N   + + +ID +   P+F+ S +  E +  E+  PG  I          G+ G  +       S + + +F +   TG++ +   +D D   T     V++   A  P   S++  V I I+D ND  P  +       S+ +  +I E+     P   +   D+D K   +V    Y + +      I I     ++F   + +    D E        ++ TD        N+T+ I  LDVNDN PEF K  Y   + EN P  T++  ++   DKDS  NG+    I + G  +F ID++   + +K + DRE +S   + I+A D G    +S+    + + DVNDNP   + ITP++     + +   + +G I A D D   N ++ Y    + QS   + K +G ++L+  L+  ++    ++V  SD
Sbjct:  549 IPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSL----------ISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSE-SSSFSINPVTGEVFAQKPL----ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKY--EIRTTEDILPGIAI----------GSVGAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDT-----VLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFS-------SSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVR---YSIISSHPGSSIEI-----DQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIV-GKVVARDKDSLENGQIVYRITN-GSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIV---VPAGSPLSTAIGTIVAMDPDKGLNGSVLY--RAQLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSD 1120          

HSP 4 Score: 101.293 bits (251), Expect = 3.025e-21
Identity = 170/678 (25.07%), Postives = 277/678 (40.86%), Query Frame = 3
Query:  486 LSIIIEDVNDNAP-IWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNG-LYIENTQMLDREKKNVYEIIIIAQDNGSP--YKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSD---KTHFEF-KVIVQDHAVEPYSLSSE----AVVEIDIQDINDEFPTIAFY-PRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVS-------NRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMF--VSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKV---TFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDV--NDNPVIITPLINQFYISENKQRSL-LGVIKATDFDNQTIYYLIDNKSQSK-FSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXX---XXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPLFNLDSDSGDLHL----AVSLHTIRPIDTNTFLDIEACDQGQPNQCTI 2408
            + + + D NDN P +  +  + +   E+S +G       A+D+DIG NG+  + +      S  L  + G L +     L       ++I +   D+G P  Y    L+++      N NP     +     KQ +           L  +D      G+F  ++ P      E   L     E  I S    DS+   +T+ E  + I++ ++++     S       V++ + ++ND  P+     PR        P  L   S +  +G        +K +D +    YFL +D            P  FNI             D E   +    I+ TD S   T  NLTI + D+NDN P F+K  Y   +       T    + F  +   D +  G  T S+     S F +  ++  L  KV     +R  V+V      A D+G    ++S  V V I +    D P        +F + EN +  L +G +   +  ++  +Y I +   SK FSI+K  GRLF+   +DRE++ TH   V   + + T+        V+V+DENDN P+F ++   + +  S + G KI +I+A+D D G NG V Y IL  +     +  L+ D+G + L       L    P  T   L +EA D G P +  +
Sbjct: 1713 VRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDLVLRRLSSLQS-----WKIKLRVVDHGVPGLYVEKNLEIS------NRNPQTEAKAPLEFLKQTY-----------LSTIDEGL-PRGQFIAKLQP------ELAGLTYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQQIGTRVDVRVNNLNDNVPSFPMSKPRR------VPENLRVGSYVATVG--------AKDVDNLAPLRYFLVSDS-------SGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGS-FDTFTNLTIFVSDINDNAPTFSKPLYQTTVSP----ATFSPGQPFAKIEAHDLDARGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGERYLVTV-----TATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEF-RFEVMENSKIGLQIGNLSGEE--SREFHYRIQDPEASKIFSIDKF-GRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLN--IVTLNPDTGSIQLNEWNDAQLDEF-PNATWQIL-VEARDHGHPARAAV 2322          

HSP 5 Score: 80.1073 bits (196), Expect = 9.485e-15
Identity = 82/278 (29.50%), Postives = 128/278 (46.04%), Query Frame = 3
Query:  327 NCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRME--SKYRNSFRLFQDNG-LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTD--SIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEI 1145
            +  E++  TG+L     +D E      R  K   +  ++ I     N+     L I + DVNDNAP +      +   ENSP  +      A D D   NGQ++YR+   S+Y   F + +  G +Y + +  +DRE  +  +I I+A+D G P +S+     + ++DVNDNPP       I  P       SP  T I  + A+D D G NG   +R    +S      F+V+  G+V ++ +++  SD+ H    VIV D  V   S+     V I
Sbjct:  883 SSIEIDQFTGQLSTGSLLDYE----ATRNYKLRVKATDLGIPPRSSNMT----LFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEY---FGIDEKLGNVYTKRS--IDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVP-----AGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSS-----LFVVKSNGDVYLRRQLNA-SDERHQRLSVIVSDQGVPRKSVVCHVPVRI 1136          

HSP 6 Score: 73.559 bits (179), Expect = 8.203e-13
Identity = 137/616 (22.24%), Postives = 244/616 (39.61%), Query Frame = 3
Query:  483 RLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNS--FRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTS------PEVEKHFL--VRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHD-RDSKGLDKVHCESYFLDNDKLNPIIAIG-----TNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD-SFFTIDQQNQILK----SKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDV---NDNPVIITPLINQFYISENKQRSLLGVIKATD---FDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDN-KPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY 2246
            R+ + + ++NDN P +   K      EN  +GS  +   A D+D  +  +     +S  +    F + Q  G  I  T  LD E    + + I A D      +N   +T+ + D+NDN P F+  +++        SP G     ++A  HD    G  T+ +   +S      PE    F+  + P GE               +   V   D+ V  +S S    V I   +  D+ P         + A     ++ENS     IG +S  + R+     +    S     DK   +   G         +EF +    + D E  +    + +C             +I+LD NDN P F    Y+  +K++   G  +  ++  SD+DS  NG+ +  I S  D +  T++     ++    +    D    +  ++ + A DHG     +   V V +K        P  + P+     + +    ++L  I+A++     N  + Y +  + Q K  I+  +G L L+  LD E +    + ++ SD    ++     +VV+  D   P+F   +  ++I  S   G  + ++ A D D G +G+VKY
Sbjct: 1912 RVDVRVNNLNDNVPSFPMSKP-RRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGT-IHLTAPLDFEVLPEHTLTIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPLYQTTVSPATFSP-GQPFAKIEA--HDLDARGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGE--------------RYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDK-PGF-------EKAEFRFEVMENSKIGLQIGNLSGEESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQV----EIDNEMMTSQKVQCKCH------------VIVLDENDNLPVFTSVAYYLSLKDSMAHGQKI-GQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSL-KEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKY 2479          

HSP 7 Score: 61.6178 bits (148), Expect = 4.037e-9
Identity = 45/147 (30.61%), Postives = 75/147 (51.02%), Query Frame = 3
Query:  483 RLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRME--SKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPE---KQVFENSPPGTVI 908
            R SI I D NDNAP+++  +   S + N  IGS     +ATD DIG N ++ Y ++  S   NS      +G+      +L     + +++I++A D+GSP  S+   VT+ ++    + P   D I+  E     + ENS  G+++
Sbjct:  218 RCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLL---PASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPL-DIIWLVESNSAHLMENSTLGSIV 360          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 211.46 bits (537), Expect = 3.570e-55
Identity = 226/755 (29.93%), Postives = 361/755 (47.81%), Query Frame = 3
Query:  246 EIGYVIDYIKPNDQNNLKIFNTNDNGVNC-FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRN-SFRLF----QDNGLYI--ENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPI---IAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI-ESP--GDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQ-FY---ISENK--QRSLLGVIKATDFD---NQTIYYLIDN--KSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD--SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESP-------GFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA----VSLHTIRPIDTNTFLDIEACDQG 2387
            +IGY+ D+   +      I    + GV     ++ +TG++    ++DRE          +      V I L+ +NI    R+ + ++D NDNAP +      + F EN+P   +R+L  A D+D+       Y + S   N +FRL     +D  LY+  + +  LDRE    Y ++I A D G+P     + V + I DVNDN P F  S  R    V EN+  GT +L + A D D   NG   + ++   S + E+ F + P TG + I   +D+++ + H E  V+ +DH  +P  L + A V I + D+ND  PTI     + D++   P I E++     + +ISVHD DSK         Y   N  LN      A+ T + + + ++ +   DRE  S     +  TD  T      K++ + I DVNDNPPEF +  YH  + E    GT +  ++   D+D   N   T S+ E+P     +F ID Q  ++ ++   D E   V +L ++A D G   L+S+  V V I DVNDN     P+ +Q FY   ++EN+   R +L V  A+D D   N  + Y I    K  ++F +   SG + +   LD E + ++   V A+D   L T +  + + + D NDN+P+F    +  K+   ESP          I  +VATD D+GN G V Y +   + +  +F +D  +G++ +     +S+ T +P+     L+I A D G
Sbjct:   95 QIGYIGDFGGIDSGPPYII--VAEAGVETDLAIDRATGEIRTKVKLDRE----------TRASYSLVAIPLSGRNI----RVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQS--RYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQS-DKEQMFRIDPRTGAIYINKALDFETKELH-ELVVVAKDHGEQP--LETTAFVSIRVTDVNDNQPTINVIFLSDDAS---PKISESAQPGEFVARISVHDPDSK-------TEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSV-LQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDN----EPIFDQSFYNVSVAENEPVGRCILKV-SASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTA-MIKMQLTDVNDNRPVF--YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGN-EAGIFRIDRSTGEIFVVRPDMLSVRT-QPMH---MLNISATDGG 803          

HSP 2 Score: 185.267 bits (469), Expect = 6.174e-47
Identity = 202/767 (26.34%), Postives = 352/767 (45.89%), Query Frame = 3
Query:  309 TNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGS-PYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSK-----------------GLDKVHCE-----SYFLDNDKLN--PIIAIGTNEPNEF--------------NIVSNRKFDRETESKLNAE---------IRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDN-RMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQ-NQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFDN--QTIYYL-----IDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKN---------MNKVIKIDASESPGFKICKIVATDAD-HGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNT---FLDIEACDQGQP 2393
            T  N  N F ++SS+G+L   R +DRE+       ++++++  +   +  H NI      +I +ED NDNAP +   K   S  E++P+G+      A D D+G N +++Y + ++ +  F +   +GL I     LDRE +  Y  +++A D G    +S  + V + ++D+NDN P F    +    QV     PG  +L ++A+D D G N E  + ++   S  V   F + P TG +     +  +S K     +V+ +D    P S  S  ++E+ I +     P + F      + T    + ENS + T + Q+     D +                  LD +  E      + LD D+ +   + A+       +              +  S R     + +  N++          R  D    ++   L I + D NDN P+F++  +   + E    GT +     F SD  SN   ++ + ++   D+ F I+   + I+++ +  DRE   ++KLKI+A D G  ++T +  + V I DVNDN     P  N   +SE  +  +++  I A D D      Y L     +D ++ S F+++++SG+L L+  LD E Q+ + + V ASD+ H A T +TV V DENDN P+F           +  + +I  S S  F +  + ATDAD  GNN  V YI++ +      F++   +G   ++V++  ++P  +++   F+ I A D G+P
Sbjct: 1887 TGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDR-GQPKSRQGHCNI------TIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGL-ITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYI--GQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENS-AVSAKFRINPSTGALSASQSLASESGKL-LHLEVVARDKGNPPQS--SLGLIELLIGEAPQGTPVLRF-----QNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI-VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPP-NNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG---FSVHPSNG--VVSVNMSRLQPAVSSSGDYFVRIIAKDAGKP 2626          

HSP 3 Score: 175.252 bits (443), Expect = 7.191e-44
Identity = 216/833 (25.93%), Postives = 362/833 (43.46%), Query Frame = 3
Query:  210 SSNKIYRIKEETEIGYVIDYIKPNDQNNLKIFN------------------TNDNGVNCFELESSTGKLFITRRIDRE-------EICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM--------ESKYRNSFRLFQDNGL--YIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTV----EIIDVNDNPPKF---------TDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKT----HFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQI---SVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNR-KFDRETESKL----------------NAEIRCTDTSD---------HSTVKNLTIIILDVNDNPPEFNKGT-YHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPG-DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDER-LTSSCIVYVHIKDVNDNPVIITPLIN-QFYISENKQRSLLGV----IKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS----LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYIL-KKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIE--ACDQGQPNQCTI 2408
            SS+ ++R++E+  +G+V+  I P ++    + N                  T D     F+++  +G L + R +DRE       EI   +    +N Q   +T+K             I + DVNDNAP W  D   +  +E +P+G+      ATD D G+NG + YR+        ES+   +  LF+ + L   +     LD E    Y +I+ A D  S   +  LQ +V     I+D ND+ P F         T S+F     + + +  G V+  + AVD D G+NG+ T+ +   T    E  F +   TG +E+   +   ++       F   +  +DH  +P    S   + + +Q  ++  P           A    TILEN  + + + Q+   S+H  ++  L      SY +     N +  +         I++ R +FDRE+++                  ++ +R   +SD         H  V  + I + DVNDN PEF  G+ Y   + EN   G +  + +  SD D   N     SI      + F+ID  +  L ++   DREQ S + L+I A D G  +     C + + ++D NDN     P      Y    ++ + LG     I A D D   N  + Y + N++Q +F+I+  SG +     LDRE Q +++  V A+D     + +A+  V + V+D NDN+PIF+    + ++ A   PG  + K+ A DAD G N  + Y L  ++S     F ++  +G L  + SL +    ++   L +E  A D+G P Q ++
Sbjct: 1367 SSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVK-------------IEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQ-EQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNV-TERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLF-----ISDATRIGEVVAHIVAVDEDSGDNGQLTYEI---TGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHG-QPEPKKSSLNLHLIVQGSHNNPPRFL-------QAVYRATILENVPSGSFVLQVTAKSLHGAENANL------SYEIPAGVANDLFHVDWQR----GIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVI--HTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDN----APRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLAS----ESGKLLHLEVVARDKGNPPQSSL 2147          

HSP 4 Score: 173.326 bits (438), Expect = 2.962e-43
Identity = 194/757 (25.63%), Postives = 329/757 (43.46%), Query Frame = 3
Query:  225 YRIKEETEIGYVIDYIKPNDQN-------NLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRM---------SPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEI-DIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETES--KLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFY-IKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI----ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRS-LLGVIKATD-------------FDNQTIYY----LIDNKSQSKFSIEKHSGRLFLQNSLDREEQ-----ETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNG-----LVKYILKKSSYKE---PLFNLDSDSGDLHLAVSL 2327
            Y +KE+   G V+  +     +          I++ + +G   F +E+++G + I + +D E    +  LL       E  +   H  +N      I +EDVNDNAP +      +S  E++ +G+      A D D GS+GQV Y +  +             ++  +Q LD E    + +I+ A D G P  S  L + V++ DVNDNPP F    +     V E+      I+ + A D D GNN   T+R+         +  +S +V +HF + P +G + +++ +D ++ +  ++  V+  D+        +  +V + D  D + +F    +  R          I EN    + +G ++  D D   L +     Y      L PI +     P    I +    DRE      L  E R   T   S    + I + DVNDN PE          ++E +P GT +  R+   D+D   N   T SI    +S G   F+ID  + +++++V  D E+ S+++L + A D G+    +  ++ V + D+NDN    T     F + E+     ++G I   +             F++  + Y    L  +  ++ F I++HSG L +   LDRE Q     E   +  TAS++  +++ TV + V D NDN P +      +++  +   G  I    ATDAD G NG     L++Y  + +  +E    LF +DS +G L L   L
Sbjct:  834 YYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG--YFSIETNSGNIRIAKPLDHE--AKSQVLLNIQATLGEPPV-YGHTQVN------IEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEY--SVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRET-RDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFR----------IEENLRRGSVVGVVTASDLD---LGENAAIRY-----SLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEV-VRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPL 1557          

HSP 5 Score: 162.155 bits (409), Expect = 7.792e-40
Identity = 201/760 (26.45%), Postives = 319/760 (41.97%), Query Frame = 3
Query:  330 CFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAP----IWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLF-QDNGLYIENTQM-LDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKH-FLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNR-------KFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVS----DKDSNNNGKFTLSIESPGDS-FFTIDQQNQ---ILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDRE--EQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVL 2519
             F ++  TG ++I + +D E         K  ++   V      Q +     +SI + DVNDN P    I+ +D A    +E++  G   +     D D  +    +    +     F L  +DN +Y+    + LDRE  + Y + ++A D G+P       + + I DVNDNPP+F   ++     V E + PGT +L + A D D G N   T+ ++   +PE     F + P TG +  +S ID +++    +  V+ +D  V P  LSS A V + I D+ND  P         D +  N ++ EN      I ++S  D D        C      N  +N  I  G     EF + S         + D E  S     +  TD    ST   + + + DVNDN P F    Y   ++E+    +   +   V+    D D  N G+ +  I +  ++  F ID+      +++  +   R Q  +H L I A D G+ R  +  +V++ I D    P I       +Y+ E+  R +++G + A   D    +   Y +        FSIE +SG + +   LD E   Q   +I  T  +      T V + V D NDN P F+     I +  S   G  +    A D D G++G V Y L K S K  LF +D+ SG  HL +S H          L + A D G P+  T  + L      N N P   + + S   S  + +N  ++
Sbjct:  335 MFRIDPRTGAIYINKALDFET--------KELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLY--HANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLA--ETPETHAQWFQIDPQTGLITTRSHIDCETEPVP-QLTVVARDGGVPP--LSSTATVLVTIHDVNDNEPIF-------DQSFYNVSVAENEPVGRCILKVSASDPD--------CGV----NAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQ-PMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKG-LFAIDARSG--HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQII 1056          

HSP 6 Score: 155.606 bits (392), Expect = 1.002e-37
Identity = 145/552 (26.27%), Postives = 249/552 (45.11%), Query Frame = 3
Query:  483 RLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVF---ENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYD-SDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLD---NDKLNPII-----AIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD----HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI----------ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGD---ERLTSSCIVYVHIKDVNDN-PVIITP-----LINQFYISENKQ-RSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSL 2018
            R+ + + D NDN P +   K      EN   GS   +  A+D+D+G N  + Y +     +SF++    G  I   + LDRE + +Y++++ A+D G+P +S  + V + + DVNDN P+  D    P++ V    E  PPGT ++ ++AVD D G N   T+ +      +    F + PT  V I++++  D  +++ +   V   D    P    +  ++ +++ D+ND  PT         S+++   + E+++    +G IS  +R +  + +   E  F D      LNP+      A    + +  N+V  R  DRE +S+   EIR  DT+      S+   + I + DVNDN PE+ +      + E  P+GT++ N    +D D+  NG     +          +    S F +D     L  +   D E V  + L + A+D      ERL +S  V + I D ND+ P  ++P          +IS+  +   ++  I A D D     Q  Y +     + +F I   +G + L  SL
Sbjct: 1138 RVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL-LPINSSFQVHPVTG-EISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIAD----PQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGV-IRTRVVLDHEERSIYRLGVAASDGGNPPR--ETVRMLRVEVLDLNDNRPTFT-------SSSLVFRVREDAALGHVVGSISPIERPAD-VVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHN-FTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSL 1671          

HSP 7 Score: 154.836 bits (390), Expect = 1.658e-37
Identity = 196/765 (25.62%), Postives = 342/765 (44.71%), Query Frame = 3
Query:  315 DNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNI-NFVQRLSIII--EDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-------------ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD--HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDN-----------RMFVSDKDSNNNGKFTLSIESPG--DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAID--HGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYIS-ENKQRSLLGVI----KATDFDNQT----IYYLID-----NKSQ----SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS-------LHTASXXXXXXXXDENDNKPIFKNMN------KVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF-------LDIEACDQGQP 2393
            ++G   F +++ +G L +++ +D E           ++Q+  + +  T   + +    L+I++  +DVNDN P++  D+  V+ +E+  I ++     A+D+D G+N ++ YR+              S     F +F ++G +I     LDRE ++ Y++ ++A DNG+P    + +V V ++D NDN PKF  S +  E ++ EN   G+V+ ++ A D D G N    + + P     +   F V P TGE+  +  +D +  +  ++  V  +D        S+   V I + D+ND  P IA    +P    +  ++ E     T + ++   DRD      +   +Y +   + +    + + +P    I +    D E  S     +  +D  +    TV+ L + +LD+NDN P F   +  F ++E+  +G ++ +           R  V +   +    +TL+  +    ++ F ID+ +  L      DRE  S  +L+I A+D    +   +S+  V + + DVNDN     P   Q  I  +  + + +G I     ATD D  T     Y LI      N+SQ    S F ++  +G L LQ  LD E  + + + V A D        L T S TV + ++D ND+ P F + N        + I  +   G  +  IVA D D G+NG + Y +   +  E  F ++S +G + L  SL    P  T          L I A D GQP
Sbjct:  973 ESGKGLFAIDARSGHLILSQHLDYE-----------SSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSG-WIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKY--EFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP-----INSSFQVHPVTGEISTREPLDREL-RELYDLVVEARDQGTP--VRSARVPVRIHVSDVNDNAPEIA----DPQEDVV--SVREEQPPGTEVVRVRAVDRDHGQNASI---TYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDN----APEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQT-SVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN-GEGRFRINSQTGIIELVKSL----PPATEDVEKGGRFNLIIGAKDHGQP 1696          

HSP 8 Score: 130.568 bits (327), Expect = 4.672e-30
Identity = 166/684 (24.27%), Postives = 297/684 (43.42%), Query Frame = 3
Query:  486 LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIY---RMESKYRNSFRLFQDNG-LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPE---KQVFENSPPGTVILLLKAVDHDF------------GNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETE--SKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSF-----FTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRS-------LLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFL--QNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNM--NKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPID----TNTFLDIEACDQGQP 2393
            ++I I+DVNDN PI+   +   +  EN+ +G+      A+D D   NG V Y   R +S     FR+    G +YI   + LD E K ++E++++A+D+G         V++ + DVNDN P   + IF  +    ++ E++ PG  +  +   D D             G +G F      N+   V  H  +    + EI S         ++   V+  D    P  L +   + + I D+ND  P         +    +  ++E +   T + Q+  HDRD +GL+     S     +       I   +P    I +    D ETE   +L    R       S+   + + I DVNDN P F++  Y+  + ENEP+G  +  ++  SD D   N     +I   G+ F     F +   +  +      D E+ S ++  +LA D G   L+++ ++ + + DVNDN  +  P   +  + E+ + S       ++ V+ ATD D     Q  Y ++       F I++ +G +F+   + L    Q  H + ++A+D  +    A   V + ++D     PIF+    N  +K D     G  +  ++A   D  +   V+Y +  S   +  F+++++SG++ +A      +P+D    +   L+I+A   G+P
Sbjct:  272 VNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYI--NKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTI-NVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPL----DREIVS---------NYTLSVVATDKGTPP--LHASKSIFLRITDVNDNPPEF-------EQDLYHANVMEVADPGTSVLQVLAHDRD-EGLNSALTYSLAETPETHAQWFQI---DPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCI-LKVSASDPDCGVNAMVNYTI---GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVV-ATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPR--GTVVGSVIAASGDVAHRSPVRYSI-YSGDPDGYFSIETNSGNIRIA------KPLDHEAKSQVLLNIQAT-LGEP 909          

HSP 9 Score: 119.398 bits (298), Expect = 1.211e-26
Identity = 166/674 (24.63%), Postives = 304/674 (45.10%), Query Frame = 3
Query:  420 SNNQQCEVTIKLTHQNINF-----VQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKH---FLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSA-TMNPTILENSSTMT---PIGQISVHDRDSKGLDKVHCESYFLDNDKLNPII-----AIGTNEPNEFNIVSNRKFDRETESKLNAEIR-CTDTSDHSTVKNLTIIILDVNDNP---PEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLK-ILAIDHG-----DERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISE-NKQRSLLGVIKATDFD------NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREE-QETHHITVTASDSLHT----ASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILK-----KSSYKEPLFNLDSDSG 2303
            +N+Q  E+ + L  +  +         L I +ED NDN+P ++  + + + +E +  G+  +   A D D GSN ++ Y + +  + N+F +       +    +LDRE +++Y++ IIA D G P  +    + V+I+DVNDN P F  +       V E +  G VI  + A D D       T+R+   ++ ++E      L R +G++ +K ++DY+  +  +E  VI  D A E     +  V+ + + D ND  P   F  + P +   + P I E S +++    +  ++  D DS+G           +N K+  II         +  N    V+  +      S  +  +R     +    +K+ T++ +  NDN     +F +  Y   I E  P+G++    +    +D+ +     ++     +S F + Q   I+  K   DRE+  ++KL+ +L+  HG         +S   V + I D NDN P+       +  ISE    R  +  ++A D D      ++ +Y +     +  F+I+  +G LF+ N LD +   +++ + + A DS H     +     + + DENDN+P F     V  +  +E  G  + +  A+D D G  G + Y +      +SS+K  +F +DS+SG
Sbjct: 2281 TNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL---VTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQ-EYELDVIASDAAHE-----ARTVLTVRVNDENDNAPV--FLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEG-----------NNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSV----VLQLGQDALDQSLAIIAGNE--ESAFELLQSKAIVLVK-PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWK--MFRVDSESG 2921          

HSP 10 Score: 99.3673 bits (246), Expect = 1.385e-20
Identity = 129/515 (25.05%), Postives = 219/515 (42.52%), Query Frame = 3
Query: 1011 RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNE----FNIVSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI---ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFY--------ISENKQRS-LLGVIKATDFDNQTIYYLID---NKSQSKFSIEKHSGRLFL---QNSLDREEQETHHITVTASDS----LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEP-LFNLDSDSGDLHLAVSLHTIRP-IDTNT----FLDIEACDQGQPNQCTIFSGLEIQWTTNRNEP 2453
            R TGE+  K K+D ++  ++    + +    +          V + ++D ND  PT   +P+     +M+    EN+        +   D D   L+  + + Y + +  +N    + ++   +     ++  +   DRET    +  I   D  T        + I I DVNDN P FN+  Y   + EN  +GT +  +++ SD D++ NG    +I   +S  +  F ID +   +      D E   +H+L ++A DHG++ L ++  V + + DVNDN     P IN  +        ISE+ Q    +  I   D D++T Y  ++   N     F++      ++L      LDRE    + ++V A+D     LH AS ++ + + D NDN P F+       +     PG  + +++A D D G N  + Y L ++       F +D  +G       L T R  ID  T     L + A D G P   +  + L      N NEP
Sbjct:  127 RATGEIRTKVKLDRETRASYSLVAIPLSGRNIR---------VLVTVKDENDNAPT---FPQT----SMHIEFPENTPREVKRTLLPARDLD---LEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSV-LQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDN----QPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLH-ASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTG-------LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEP 609          

HSP 11 Score: 94.3597 bits (233), Expect = 4.990e-19
Identity = 163/654 (24.92%), Postives = 265/654 (40.52%), Query Frame = 3
Query:  216 NKIYRIKEETEIGYVIDYIKPNDQNN-------LKIFNTND-NGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDK---------AIVSFNENSPIGSRRSLPEATDIDI-GSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDR--EKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLK--AVDHDF---GNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEP-----YSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNI-------VSNRKFDRETESK-LNAEIRCTDTSDHSTVKNLTIIIL---DVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI-ESPGD----SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN---KQRSLLGVIKATDF----DNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSL 2018
            N +  + E TE+G VI  I  ND +        L   +T D   ++ F L+  +GKL + RR+D E             Q+ E+ +  +         L++ + D NDNAP++   +         AI   +E+  +        ATD D  G+N +VIY +E   +  F +   NG+   N   L         Y + IIA+D G P   +   + V+  D      +F  + +R   Q+ E +P G+V+L L   A+D        N E  F +      + +   LV+P            D ++       +V  H   P      + SS   V I I D ND FP    + R   SA     I E +     I Q+   D D +             N ++   I  G +E + F I         N + D ++ +K     IR  D+     + +L    L   D NDN P+F    Y  ++ ENEP+G+ +  R   SD D    G+   SI  +P D      F +D ++ ++ S   FD EQ   + +++LA D G ++  +S  V V I+  ++     T    +F +       Q  ++G + ATD     D + +Y L  +   S F + + SG + ++  L
Sbjct: 2431 NNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYEL-----------QQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA-QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYR--AQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELL-----QSKAIVLVKP-----------LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP---IFDR---SAKYEAEISELAPLRYSIAQLQAIDADQEN----------TPNSEVVYDITSGNDE-HMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSV-FRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKK--ASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL--SAPHSHFKVNRSSGAVLIKRKL 3032          

HSP 12 Score: 86.6557 bits (213), Expect = 1.114e-16
Identity = 97/379 (25.59%), Postives = 169/379 (44.59%), Query Frame = 3
Query:  477 VQRLSIIIEDVNDNAPIWTTDKAI-VSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESK-YRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSP-YKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAV-VEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD--HSTVKNLTIIILDVNDNPP--EFNKGTYHFYIKENEPIGTML 1586
            V  + I + DVNDN+P +       +S  ENS  G   ++  A+D+D G N  +IY +      N F +   +G    + + LDRE+ + Y + I A D G P  +     +T+ + D NDN P+F  S +    Q  E++P GT ++ + AVD D G N    + ++     E +  F +   +G +    K+D +  +  + F V+  D     Y + S  V V+I++ DIND  P    YP         P +++   T+    ++   D D       + E  +  N + + + A     P+   + +++    E+   L+ E+   D  +   S++  + ++I +     P   F   TY   +KEN P GT L
Sbjct: 1830 VATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTV-VASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL--SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQ--EDAPLGTSVVQISAVDADLGVNARLVYSLAN----ETQWQFAIDGQSGLITTVGKLDREL-QASYNFMVLATDGGR--YEVRSATVPVQINVLDINDNRPIFERYPY----IGQVPALIQPGQTLL---KVQALDADLGA----NAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRL 2185          

HSP 13 Score: 85.1149 bits (209), Expect = 3.228e-16
Identity = 87/316 (27.53%), Postives = 148/316 (46.84%), Query Frame = 3
Query:  258 VIDYIKPNDQNNLKIFN-TNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLT---HQN-INFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM------ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDK------THFEFKVIVQDHAVEPYSLSSEAVVEIDI 1151
             ID  + N  N+  +++ T+ N  + F ++  TG LF+  R+D +          S  +  E+ I+     HQ  +  +Q   + + D NDN P +   + +    EN P+GS      A+D+D G  GQ+ Y +      ES ++  FR+  ++GL + +  + D E++  Y++ ++A D G   K   + V VEI   ++  P+FT+  +R         P G V+  + A D D G +G   +++S   S     HF V R +G V IK K+  D D          +  +++   +    SLSS AVVEI +
Sbjct: 2777 AIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYD----------SGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWK-MFRVDSESGL-VTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHS-----HFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVVEIAL 3073          

HSP 14 Score: 83.9593 bits (206), Expect = 6.903e-16
Identity = 147/631 (23.30%), Postives = 261/631 (41.36%), Query Frame = 3
Query:  717 LDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSD-KTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPI--IAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEF--NKGTYHFYI-----KENEPIGTMLDNRMF-VSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHK-----LKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIK---ATDFDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTAS---------DSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESP-GFKICKIVATDADHGN--NGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQW-TTNRNEPASRESDKSKKSSYDQFLNEN 2513
            L   + N   ++++A+   +P+ ++  ++ +E+ D NDN PKF+   F     V E +  GT +  + A D D G+N    + +        +  F++ P     +++ I  D + +  ++ K+I  D  V    ++  A + + I D+ND  PT  F P N        T+ E +     I  IS +D     +D     +Y L  +    I  ++I   +     +V  R+ D E + +   ++  +D + H     LT+ + D NDN P F   +   +F I     + +E +    D      +D DS  N    + I  P    F++   N ++   V   R Q +V       ++I+A D G   L SS ++ V     NDN    +  +   Y ++  + + LG +      D  +Q++  +  N+ +S F + + S  + L   LDRE  + + + +  S             ++  +V + ++D NDN PIF    K     +  +P  + I ++ A DAD  N  N  V Y +  S   E +F +D  +G L +   L       +   + I ACD              ++    N NEP      K   + Y  FL EN
Sbjct: 2280 LTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQF--VATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNH---DNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVP--QMTGTATIRVQIVDVNDNQPT--FPPNN------LVTVSEATELGAVITSISAND-----VDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA-HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVV--SVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQ---ANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNE-ESAFELLQ-SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDI-TSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELI-IRACDSHHQRPLCSLQPFRLELHDENDNEP------KFPLTEYVHFLAEN 2874          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 211.46 bits (537), Expect = 3.570e-55
Identity = 226/755 (29.93%), Postives = 361/755 (47.81%), Query Frame = 3
Query:  246 EIGYVIDYIKPNDQNNLKIFNTNDNGVNC-FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRN-SFRLF----QDNGLYI--ENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPI---IAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI-ESP--GDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQ-FY---ISENK--QRSLLGVIKATDFD---NQTIYYLIDN--KSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD--SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESP-------GFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA----VSLHTIRPIDTNTFLDIEACDQG 2387
            +IGY+ D+   +      I    + GV     ++ +TG++    ++DRE          +      V I L+ +NI    R+ + ++D NDNAP +      + F EN+P   +R+L  A D+D+       Y + S   N +FRL     +D  LY+  + +  LDRE    Y ++I A D G+P     + V + I DVNDN P F  S  R    V EN+  GT +L + A D D   NG   + ++   S + E+ F + P TG + I   +D+++ + H E  V+ +DH  +P  L + A V I + D+ND  PTI     + D++   P I E++     + +ISVHD DSK         Y   N  LN      A+ T + + + ++ +   DRE  S     +  TD  T      K++ + I DVNDNPPEF +  YH  + E    GT +  ++   D+D   N   T S+ E+P     +F ID Q  ++ ++   D E   V +L ++A D G   L+S+  V V I DVNDN     P+ +Q FY   ++EN+   R +L V  A+D D   N  + Y I    K  ++F +   SG + +   LD E + ++   V A+D   L T +  + + + D NDN+P+F    +  K+   ESP          I  +VATD D+GN G V Y +   + +  +F +D  +G++ +     +S+ T +P+     L+I A D G
Sbjct:   95 QIGYIGDFGGIDSGPPYII--VAEAGVETDLAIDRATGEIRTKVKLDRE----------TRASYSLVAIPLSGRNI----RVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQS--RYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQS-DKEQMFRIDPRTGAIYINKALDFETKELH-ELVVVAKDHGEQP--LETTAFVSIRVTDVNDNQPTINVIFLSDDAS---PKISESAQPGEFVARISVHDPDSK-------TEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSV-LQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDN----EPIFDQSFYNVSVAENEPVGRCILKV-SASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTA-MIKMQLTDVNDNRPVF--YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGN-EAGIFRIDRSTGEIFVVRPDMLSVRT-QPMH---MLNISATDGG 803          

HSP 2 Score: 185.267 bits (469), Expect = 6.174e-47
Identity = 202/767 (26.34%), Postives = 352/767 (45.89%), Query Frame = 3
Query:  309 TNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGS-PYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSK-----------------GLDKVHCE-----SYFLDNDKLN--PIIAIGTNEPNEF--------------NIVSNRKFDRETESKLNAE---------IRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDN-RMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQ-NQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFDN--QTIYYL-----IDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKN---------MNKVIKIDASESPGFKICKIVATDAD-HGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNT---FLDIEACDQGQP 2393
            T  N  N F ++SS+G+L   R +DRE+       ++++++  +   +  H NI      +I +ED NDNAP +   K   S  E++P+G+      A D D+G N +++Y + ++ +  F +   +GL I     LDRE +  Y  +++A D G    +S  + V + ++D+NDN P F    +    QV     PG  +L ++A+D D G N E  + ++   S  V   F + P TG +     +  +S K     +V+ +D    P S  S  ++E+ I +     P + F      + T    + ENS + T + Q+     D +                  LD +  E      + LD D+ +   + A+       +              +  S R     + +  N++          R  D    ++   L I + D NDN P+F++  +   + E    GT +     F SD  SN   ++ + ++   D+ F I+   + I+++ +  DRE   ++KLKI+A D G  ++T +  + V I DVNDN     P  N   +SE  +  +++  I A D D      Y L     +D ++ S F+++++SG+L L+  LD E Q+ + + V ASD+ H A T +TV V DENDN P+F           +  + +I  S S  F +  + ATDAD  GNN  V YI++ +      F++   +G   ++V++  ++P  +++   F+ I A D G+P
Sbjct: 1887 TGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDR-GQPKSRQGHCNI------TIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGL-ITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYI--GQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENS-AVSAKFRINPSTGALSASQSLASESGKL-LHLEVVARDKGNPPQS--SLGLIELLIGEAPQGTPVLRF-----QNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI-VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPP-NNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG---FSVHPSNG--VVSVNMSRLQPAVSSSGDYFVRIIAKDAGKP 2626          

HSP 3 Score: 175.252 bits (443), Expect = 7.191e-44
Identity = 216/833 (25.93%), Postives = 362/833 (43.46%), Query Frame = 3
Query:  210 SSNKIYRIKEETEIGYVIDYIKPNDQNNLKIFN------------------TNDNGVNCFELESSTGKLFITRRIDRE-------EICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM--------ESKYRNSFRLFQDNGL--YIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTV----EIIDVNDNPPKF---------TDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKT----HFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQI---SVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNR-KFDRETESKL----------------NAEIRCTDTSD---------HSTVKNLTIIILDVNDNPPEFNKGT-YHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPG-DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDER-LTSSCIVYVHIKDVNDNPVIITPLIN-QFYISENKQRSLLGV----IKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS----LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYIL-KKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIE--ACDQGQPNQCTI 2408
            SS+ ++R++E+  +G+V+  I P ++    + N                  T D     F+++  +G L + R +DRE       EI   +    +N Q   +T+K             I + DVNDNAP W  D   +  +E +P+G+      ATD D G+NG + YR+        ES+   +  LF+ + L   +     LD E    Y +I+ A D  S   +  LQ +V     I+D ND+ P F         T S+F     + + +  G V+  + AVD D G+NG+ T+ +   T    E  F +   TG +E+   +   ++       F   +  +DH  +P    S   + + +Q  ++  P           A    TILEN  + + + Q+   S+H  ++  L      SY +     N +  +         I++ R +FDRE+++                  ++ +R   +SD         H  V  + I + DVNDN PEF  G+ Y   + EN   G +  + +  SD D   N     SI      + F+ID  +  L ++   DREQ S + L+I A D G  +     C + + ++D NDN     P      Y    ++ + LG     I A D D   N  + Y + N++Q +F+I+  SG +     LDRE Q +++  V A+D     + +A+  V + V+D NDN+PIF+    + ++ A   PG  + K+ A DAD G N  + Y L  ++S     F ++  +G L  + SL +    ++   L +E  A D+G P Q ++
Sbjct: 1367 SSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVK-------------IEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQ-EQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNV-TERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLF-----ISDATRIGEVVAHIVAVDEDSGDNGQLTYEI---TGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHG-QPEPKKSSLNLHLIVQGSHNNPPRFL-------QAVYRATILENVPSGSFVLQVTAKSLHGAENANL------SYEIPAGVANDLFHVDWQR----GIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVI--HTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDN----APRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLAS----ESGKLLHLEVVARDKGNPPQSSL 2147          

HSP 4 Score: 173.326 bits (438), Expect = 2.962e-43
Identity = 194/757 (25.63%), Postives = 329/757 (43.46%), Query Frame = 3
Query:  225 YRIKEETEIGYVIDYIKPNDQN-------NLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRM---------SPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEI-DIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETES--KLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFY-IKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI----ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRS-LLGVIKATD-------------FDNQTIYY----LIDNKSQSKFSIEKHSGRLFLQNSLDREEQ-----ETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNG-----LVKYILKKSSYKE---PLFNLDSDSGDLHLAVSL 2327
            Y +KE+   G V+  +     +          I++ + +G   F +E+++G + I + +D E    +  LL       E  +   H  +N      I +EDVNDNAP +      +S  E++ +G+      A D D GS+GQV Y +  +             ++  +Q LD E    + +I+ A D G P  S  L + V++ DVNDNPP F    +     V E+      I+ + A D D GNN   T+R+         +  +S +V +HF + P +G + +++ +D ++ +  ++  V+  D+        +  +V + D  D + +F    +  R          I EN    + +G ++  D D   L +     Y      L PI +     P    I +    DRE      L  E R   T   S    + I + DVNDN PE          ++E +P GT +  R+   D+D   N   T SI    +S G   F+ID  + +++++V  D E+ S+++L + A D G+    +  ++ V + D+NDN    T     F + E+     ++G I   +             F++  + Y    L  +  ++ F I++HSG L +   LDRE Q     E   +  TAS++  +++ TV + V D NDN P +      +++  +   G  I    ATDAD G NG     L++Y  + +  +E    LF +DS +G L L   L
Sbjct:  834 YYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG--YFSIETNSGNIRIAKPLDHE--AKSQVLLNIQATLGEPPV-YGHTQVN------IEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEY--SVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRET-RDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFR----------IEENLRRGSVVGVVTASDLD---LGENAAIRY-----SLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEV-VRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPL 1557          

HSP 5 Score: 162.155 bits (409), Expect = 7.792e-40
Identity = 201/760 (26.45%), Postives = 319/760 (41.97%), Query Frame = 3
Query:  330 CFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAP----IWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLF-QDNGLYIENTQM-LDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKH-FLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNR-------KFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVS----DKDSNNNGKFTLSIESPGDS-FFTIDQQNQ---ILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDRE--EQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVL 2519
             F ++  TG ++I + +D E         K  ++   V      Q +     +SI + DVNDN P    I+ +D A    +E++  G   +     D D  +    +    +     F L  +DN +Y+    + LDRE  + Y + ++A D G+P       + + I DVNDNPP+F   ++     V E + PGT +L + A D D G N   T+ ++   +PE     F + P TG +  +S ID +++    +  V+ +D  V P  LSS A V + I D+ND  P         D +  N ++ EN      I ++S  D D        C      N  +N  I  G     EF + S         + D E  S     +  TD    ST   + + + DVNDN P F    Y   ++E+    +   +   V+    D D  N G+ +  I +  ++  F ID+      +++  +   R Q  +H L I A D G+ R  +  +V++ I D    P I       +Y+ E+  R +++G + A   D    +   Y +        FSIE +SG + +   LD E   Q   +I  T  +      T V + V D NDN P F+     I +  S   G  +    A D D G++G V Y L K S K  LF +D+ SG  HL +S H          L + A D G P+  T  + L      N N P   + + S   S  + +N  ++
Sbjct:  335 MFRIDPRTGAIYINKALDFET--------KELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLY--HANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLA--ETPETHAQWFQIDPQTGLITTRSHIDCETEPVP-QLTVVARDGGVPP--LSSTATVLVTIHDVNDNEPIF-------DQSFYNVSVAENEPVGRCILKVSASDPD--------CGV----NAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQ-PMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKG-LFAIDARSG--HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQII 1056          

HSP 6 Score: 155.606 bits (392), Expect = 1.002e-37
Identity = 145/552 (26.27%), Postives = 249/552 (45.11%), Query Frame = 3
Query:  483 RLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVF---ENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYD-SDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLD---NDKLNPII-----AIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD----HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI----------ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGD---ERLTSSCIVYVHIKDVNDN-PVIITP-----LINQFYISENKQ-RSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSL 2018
            R+ + + D NDN P +   K      EN   GS   +  A+D+D+G N  + Y +     +SF++    G  I   + LDRE + +Y++++ A+D G+P +S  + V + + DVNDN P+  D    P++ V    E  PPGT ++ ++AVD D G N   T+ +      +    F + PT  V I++++  D  +++ +   V   D    P    +  ++ +++ D+ND  PT         S+++   + E+++    +G IS  +R +  + +   E  F D      LNP+      A    + +  N+V  R  DRE +S+   EIR  DT+      S+   + I + DVNDN PE+ +      + E  P+GT++ N    +D D+  NG     +          +    S F +D     L  +   D E V  + L + A+D      ERL +S  V + I D ND+ P  ++P          +IS+  +   ++  I A D D     Q  Y +     + +F I   +G + L  SL
Sbjct: 1138 RVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL-LPINSSFQVHPVTG-EISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIAD----PQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGV-IRTRVVLDHEERSIYRLGVAASDGGNPPR--ETVRMLRVEVLDLNDNRPTFT-------SSSLVFRVREDAALGHVVGSISPIERPAD-VVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHN-FTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSL 1671          

HSP 7 Score: 154.836 bits (390), Expect = 1.658e-37
Identity = 196/765 (25.62%), Postives = 342/765 (44.71%), Query Frame = 3
Query:  315 DNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNI-NFVQRLSIII--EDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-------------ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD--HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDN-----------RMFVSDKDSNNNGKFTLSIESPG--DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAID--HGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYIS-ENKQRSLLGVI----KATDFDNQT----IYYLID-----NKSQ----SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS-------LHTASXXXXXXXXDENDNKPIFKNMN------KVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF-------LDIEACDQGQP 2393
            ++G   F +++ +G L +++ +D E           ++Q+  + +  T   + +    L+I++  +DVNDN P++  D+  V+ +E+  I ++     A+D+D G+N ++ YR+              S     F +F ++G +I     LDRE ++ Y++ ++A DNG+P    + +V V ++D NDN PKF  S +  E ++ EN   G+V+ ++ A D D G N    + + P     +   F V P TGE+  +  +D +  +  ++  V  +D        S+   V I + D+ND  P IA    +P    +  ++ E     T + ++   DRD      +   +Y +   + +    + + +P    I +    D E  S     +  +D  +    TV+ L + +LD+NDN P F   +  F ++E+  +G ++ +           R  V +   +    +TL+  +    ++ F ID+ +  L      DRE  S  +L+I A+D    +   +S+  V + + DVNDN     P   Q  I  +  + + +G I     ATD D  T     Y LI      N+SQ    S F ++  +G L LQ  LD E  + + + V A D        L T S TV + ++D ND+ P F + N        + I  +   G  +  IVA D D G+NG + Y +   +  E  F ++S +G + L  SL    P  T          L I A D GQP
Sbjct:  973 ESGKGLFAIDARSGHLILSQHLDYE-----------SSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSG-WIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKY--EFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP-----INSSFQVHPVTGEISTREPLDREL-RELYDLVVEARDQGTP--VRSARVPVRIHVSDVNDNAPEIA----DPQEDVV--SVREEQPPGTEVVRVRAVDRDHGQNASI---TYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDN----APEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQT-SVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN-GEGRFRINSQTGIIELVKSL----PPATEDVEKGGRFNLIIGAKDHGQP 1696          

HSP 8 Score: 130.568 bits (327), Expect = 4.672e-30
Identity = 166/684 (24.27%), Postives = 297/684 (43.42%), Query Frame = 3
Query:  486 LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIY---RMESKYRNSFRLFQDNG-LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPE---KQVFENSPPGTVILLLKAVDHDF------------GNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETE--SKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSF-----FTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRS-------LLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFL--QNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNM--NKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPID----TNTFLDIEACDQGQP 2393
            ++I I+DVNDN PI+   +   +  EN+ +G+      A+D D   NG V Y   R +S     FR+    G +YI   + LD E K ++E++++A+D+G         V++ + DVNDN P   + IF  +    ++ E++ PG  +  +   D D             G +G F      N+   V  H  +    + EI S         ++   V+  D    P  L +   + + I D+ND  P         +    +  ++E +   T + Q+  HDRD +GL+     S     +       I   +P    I +    D ETE   +L    R       S+   + + I DVNDN P F++  Y+  + ENEP+G  +  ++  SD D   N     +I   G+ F     F +   +  +      D E+ S ++  +LA D G   L+++ ++ + + DVNDN  +  P   +  + E+ + S       ++ V+ ATD D     Q  Y ++       F I++ +G +F+   + L    Q  H + ++A+D  +    A   V + ++D     PIF+    N  +K D     G  +  ++A   D  +   V+Y +  S   +  F+++++SG++ +A      +P+D    +   L+I+A   G+P
Sbjct:  272 VNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYI--NKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTI-NVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPL----DREIVS---------NYTLSVVATDKGTPP--LHASKSIFLRITDVNDNPPEF-------EQDLYHANVMEVADPGTSVLQVLAHDRD-EGLNSALTYSLAETPETHAQWFQI---DPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCI-LKVSASDPDCGVNAMVNYTI---GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVV-ATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPR--GTVVGSVIAASGDVAHRSPVRYSI-YSGDPDGYFSIETNSGNIRIA------KPLDHEAKSQVLLNIQAT-LGEP 909          

HSP 9 Score: 119.398 bits (298), Expect = 1.211e-26
Identity = 166/674 (24.63%), Postives = 304/674 (45.10%), Query Frame = 3
Query:  420 SNNQQCEVTIKLTHQNINF-----VQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKH---FLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSA-TMNPTILENSSTMT---PIGQISVHDRDSKGLDKVHCESYFLDNDKLNPII-----AIGTNEPNEFNIVSNRKFDRETESKLNAEIR-CTDTSDHSTVKNLTIIILDVNDNP---PEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLK-ILAIDHG-----DERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISE-NKQRSLLGVIKATDFD------NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREE-QETHHITVTASDSLHT----ASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILK-----KSSYKEPLFNLDSDSG 2303
            +N+Q  E+ + L  +  +         L I +ED NDN+P ++  + + + +E +  G+  +   A D D GSN ++ Y + +  + N+F +       +    +LDRE +++Y++ IIA D G P  +    + V+I+DVNDN P F  +       V E +  G VI  + A D D       T+R+   ++ ++E      L R +G++ +K ++DY+  +  +E  VI  D A E     +  V+ + + D ND  P   F  + P +   + P I E S +++    +  ++  D DS+G           +N K+  II         +  N    V+  +      S  +  +R     +    +K+ T++ +  NDN     +F +  Y   I E  P+G++    +    +D+ +     ++     +S F + Q   I+  K   DRE+  ++KL+ +L+  HG         +S   V + I D NDN P+       +  ISE    R  +  ++A D D      ++ +Y +     +  F+I+  +G LF+ N LD +   +++ + + A DS H     +     + + DENDN+P F     V  +  +E  G  + +  A+D D G  G + Y +      +SS+K  +F +DS+SG
Sbjct: 2281 TNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL---VTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQ-EYELDVIASDAAHE-----ARTVLTVRVNDENDNAPV--FLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEG-----------NNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSV----VLQLGQDALDQSLAIIAGNE--ESAFELLQSKAIVLVK-PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWK--MFRVDSESG 2921          

HSP 10 Score: 99.3673 bits (246), Expect = 1.385e-20
Identity = 129/515 (25.05%), Postives = 219/515 (42.52%), Query Frame = 3
Query: 1011 RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNE----FNIVSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI---ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFY--------ISENKQRS-LLGVIKATDFDNQTIYYLID---NKSQSKFSIEKHSGRLFL---QNSLDREEQETHHITVTASDS----LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEP-LFNLDSDSGDLHLAVSLHTIRP-IDTNT----FLDIEACDQGQPNQCTIFSGLEIQWTTNRNEP 2453
            R TGE+  K K+D ++  ++    + +    +          V + ++D ND  PT   +P+     +M+    EN+        +   D D   L+  + + Y + +  +N    + ++   +     ++  +   DRET    +  I   D  T        + I I DVNDN P FN+  Y   + EN  +GT +  +++ SD D++ NG    +I   +S  +  F ID +   +      D E   +H+L ++A DHG++ L ++  V + + DVNDN     P IN  +        ISE+ Q    +  I   D D++T Y  ++   N     F++      ++L      LDRE    + ++V A+D     LH AS ++ + + D NDN P F+       +     PG  + +++A D D G N  + Y L ++       F +D  +G       L T R  ID  T     L + A D G P   +  + L      N NEP
Sbjct:  127 RATGEIRTKVKLDRETRASYSLVAIPLSGRNIR---------VLVTVKDENDNAPT---FPQT----SMHIEFPENTPREVKRTLLPARDLD---LEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSV-LQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDN----QPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLH-ASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTG-------LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEP 609          

HSP 11 Score: 94.3597 bits (233), Expect = 4.990e-19
Identity = 163/654 (24.92%), Postives = 265/654 (40.52%), Query Frame = 3
Query:  216 NKIYRIKEETEIGYVIDYIKPNDQNN-------LKIFNTND-NGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDK---------AIVSFNENSPIGSRRSLPEATDIDI-GSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDR--EKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLK--AVDHDF---GNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEP-----YSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNI-------VSNRKFDRETESK-LNAEIRCTDTSDHSTVKNLTIIIL---DVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI-ESPGD----SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN---KQRSLLGVIKATDF----DNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSL 2018
            N +  + E TE+G VI  I  ND +        L   +T D   ++ F L+  +GKL + RR+D E             Q+ E+ +  +         L++ + D NDNAP++   +         AI   +E+  +        ATD D  G+N +VIY +E   +  F +   NG+   N   L         Y + IIA+D G P   +   + V+  D      +F  + +R   Q+ E +P G+V+L L   A+D        N E  F +      + +   LV+P            D ++       +V  H   P      + SS   V I I D ND FP    + R   SA     I E +     I Q+   D D +             N ++   I  G +E + F I         N + D ++ +K     IR  D+     + +L    L   D NDN P+F    Y  ++ ENEP+G+ +  R   SD D    G+   SI  +P D      F +D ++ ++ S   FD EQ   + +++LA D G ++  +S  V V I+  ++     T    +F +       Q  ++G + ATD     D + +Y L  +   S F + + SG + ++  L
Sbjct: 2431 NNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYEL-----------QQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA-QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYR--AQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELL-----QSKAIVLVKP-----------LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP---IFDR---SAKYEAEISELAPLRYSIAQLQAIDADQEN----------TPNSEVVYDITSGNDE-HMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSV-FRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKK--ASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL--SAPHSHFKVNRSSGAVLIKRKL 3032          

HSP 12 Score: 86.6557 bits (213), Expect = 1.114e-16
Identity = 97/379 (25.59%), Postives = 169/379 (44.59%), Query Frame = 3
Query:  477 VQRLSIIIEDVNDNAPIWTTDKAI-VSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESK-YRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSP-YKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAV-VEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD--HSTVKNLTIIILDVNDNPP--EFNKGTYHFYIKENEPIGTML 1586
            V  + I + DVNDN+P +       +S  ENS  G   ++  A+D+D G N  +IY +      N F +   +G    + + LDRE+ + Y + I A D G P  +     +T+ + D NDN P+F  S +    Q  E++P GT ++ + AVD D G N    + ++     E +  F +   +G +    K+D +  +  + F V+  D     Y + S  V V+I++ DIND  P    YP         P +++   T+    ++   D D       + E  +  N + + + A     P+   + +++    E+   L+ E+   D  +   S++  + ++I +     P   F   TY   +KEN P GT L
Sbjct: 1830 VATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTV-VASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL--SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQ--EDAPLGTSVVQISAVDADLGVNARLVYSLAN----ETQWQFAIDGQSGLITTVGKLDREL-QASYNFMVLATDGGR--YEVRSATVPVQINVLDINDNRPIFERYPY----IGQVPALIQPGQTLL---KVQALDADLGA----NAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRL 2185          

HSP 13 Score: 85.1149 bits (209), Expect = 3.228e-16
Identity = 87/316 (27.53%), Postives = 148/316 (46.84%), Query Frame = 3
Query:  258 VIDYIKPNDQNNLKIFN-TNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLT---HQN-INFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM------ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDK------THFEFKVIVQDHAVEPYSLSSEAVVEIDI 1151
             ID  + N  N+  +++ T+ N  + F ++  TG LF+  R+D +          S  +  E+ I+     HQ  +  +Q   + + D NDN P +   + +    EN P+GS      A+D+D G  GQ+ Y +      ES ++  FR+  ++GL + +  + D E++  Y++ ++A D G   K   + V VEI   ++  P+FT+  +R         P G V+  + A D D G +G   +++S   S     HF V R +G V IK K+  D D          +  +++   +    SLSS AVVEI +
Sbjct: 2777 AIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYD----------SGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWK-MFRVDSESGL-VTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHS-----HFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVVEIAL 3073          

HSP 14 Score: 83.9593 bits (206), Expect = 6.903e-16
Identity = 147/631 (23.30%), Postives = 261/631 (41.36%), Query Frame = 3
Query:  717 LDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSD-KTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPI--IAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEF--NKGTYHFYI-----KENEPIGTMLDNRMF-VSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHK-----LKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIK---ATDFDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTAS---------DSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESP-GFKICKIVATDADHGN--NGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQW-TTNRNEPASRESDKSKKSSYDQFLNEN 2513
            L   + N   ++++A+   +P+ ++  ++ +E+ D NDN PKF+   F     V E +  GT +  + A D D G+N    + +        +  F++ P     +++ I  D + +  ++ K+I  D  V    ++  A + + I D+ND  PT  F P N        T+ E +     I  IS +D     +D     +Y L  +    I  ++I   +     +V  R+ D E + +   ++  +D + H     LT+ + D NDN P F   +   +F I     + +E +    D      +D DS  N    + I  P    F++   N ++   V   R Q +V       ++I+A D G   L SS ++ V     NDN    +  +   Y ++  + + LG +      D  +Q++  +  N+ +S F + + S  + L   LDRE  + + + +  S             ++  +V + ++D NDN PIF    K     +  +P  + I ++ A DAD  N  N  V Y +  S   E +F +D  +G L +   L       +   + I ACD              ++    N NEP      K   + Y  FL EN
Sbjct: 2280 LTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQF--VATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNH---DNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVP--QMTGTATIRVQIVDVNDNQPT--FPPNN------LVTVSEATELGAVITSISAND-----VDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA-HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVV--SVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQ---ANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNE-ESAFELLQ-SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDI-TSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELI-IRACDSHHQRPLCSLQPFRLELHDENDNEP------KFPLTEYVHFLAEN 2874          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 190.274 bits (482), Expect = 1.841e-48
Identity = 203/732 (27.73%), Postives = 340/732 (46.45%), Query Frame = 3
Query:  318 NGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESK-YRNSFRLFQDNG-LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVE--KHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEP--YSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSK--GLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNP-------PEF-NKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPG-----DSFFTIDQQNQILKSKVTFDREQV-SVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNP--VIITPLINQFYISENKQ-RSLLGVIKATDFDN-QTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL------HTIRPIDTNTFLDIEACDQGQPNQCTIFS 2414
            N    F L+S+TG+L + RR+DRE     + ++ + +        L H  ++    ++I++ D NDNAP +T   + VS  E SP G+      A+D D G N QV++ + +   R++F +    G LY+   + LD E    Y + I A D G+P  S  +   V ++D NDNPP F  +     +Q+ E  P  T I+ + A D D G NG+ ++ +S    P++   +HF +   TG +    +ID +S  T F   V+  D A +P    LS+E +V + ++DIND  P       + ++A + P    +  + T + Q+   D DS   GL      S   +  KL     I T  P         +F +E   +L   ++ TD +  S  ++  + I  +           P+F  +      + ENEPIGT +      +   S     F  ++ + G     D  F ID +  IL +    DRE     +++++ AI  G +  TS   V V + D ND+P   + TP +  + +SE+ Q    +  ++A D D   ++ +L+ +    KF +E  +G+L L ++LDRE +  + + +  SD +       T+ V D NDN P+F++      I  +   G+++ +IVA DAD G N  + Y +  S +   +F+L+  +G L L   L      H I        L ++A D GQP+  T  +
Sbjct: 1321 NEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDA------ALKHP-LSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLH--KPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIV--RQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAIS-KQEPQLPQGRHFGINTETGVIHTLREIDRESIDT-FRLTVVATDRA-QPSERQLSTEKLVTVIVEDINDNAPVFV----SMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGP-------QFKQEVRYQLT--LKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSI--LTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFV--YNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGV-VSDWANDVFSLNPQTGMLTLTARLDYEEVQHYI--------LIVQAQDNGQPSLSTTIT 2012          

HSP 2 Score: 186.808 bits (473), Expect = 2.556e-47
Identity = 187/653 (28.64%), Postives = 300/653 (45.94%), Query Frame = 3
Query:  498 IEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNT---SPEVEKHFL--VRPTGEVEIKSKIDYDSDKT-------------HFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVS-------NRKFDRETESKLNAEIRCTDTS-DH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDS--FFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVII--TPLINQFYISEN-KQRSLLGVIKATDFD---NQTIYYLIDNKS----QSK-FSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXX------XDENDNKPIFKNMNKVI---KIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSG 2303
            I DVND+ P++       S  E + + +R     ATDID+G NG++ Y + E      F +F D  L++     LDRE+++ Y + +  +D G P +S+ + V + +ID NDN P+FT+S F     + EN+P  T +  L AVD D G N E +F +S  T   + +    F+  +RP  + E   K+  +++ +             +   +  V D+ +    L  +  V++ + D+ND  P     P        + TI E +S  T I  +   D D +GL+    + Y+         +A G NE  +FN+ S        R+ DRE++   +  +   D +  H  S+  ++TI++LD NDN PEF + +    + E  P GT L  R   SD D   N +   SI S G+    F ID     L      D E ++ + L I A D G   L+++ +  V + D NDNP I   T ++ Q  I E    ++ +  + A D D   N  + Y I  +     Q + F I   +G +     +DRE  +T  +TV A+D    +   ++          D NDN P+F +MN  I   K   S+     + ++ A DAD  +NGLV Y +   S  + LF L  ++G
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAP--LDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTF--TFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPF-DREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIP--RLQDKVKVKVIVTDVNDNAPEFLRAP-------YHVTISEGASEGTHITHVFTQDAD-EGLNG---DVYY--------SLAKG-NEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTEL-MRFRASDADQGVNSQVVFSI-SAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQ--IKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEI--VSGPQELFKLQRNTG 1658          

HSP 3 Score: 183.726 bits (465), Expect = 1.806e-46
Identity = 187/656 (28.51%), Postives = 305/656 (46.49%), Query Frame = 3
Query:  486 LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRME---SKYRNSFRLFQDNG-------LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKID--------YDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIA--FYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVS-NRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD-SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENK-QRSLLGVIKATDFD---NQTIYYLIDNKSQS----KFSIEKHSGRLFLQNSLDREEQETHHITVTASD----SLHTASXXXXXXXXDENDNKPIFKNMNKV---------IKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHL 2315
            + I + DVNDN+P +      +SF+E++  G+R  L  ATD D+G NG V  + E       N FRL            L++E T  LDRE +  Y++ I A+D GSP +   LQV V I+DVNDNPP F  S +     + E + PGT ++ + A D+D G+N + T+ ++     E E  F V P TG +    +++          + +    F V  +DH   P        V +++ D ND  P I+  F+P     AT++    EN+   T +  ++V D DS GL+          N+    +      E  + +IV  N   DRE   K N  +   D  T   +T  +L I + DVND+ P F K  Y   + E  P G+ + + +  +D+D+  N +    I S  +  +F++D    ++ +    DRE     +L I A D G     +   + V I D ND     +       + E+   ++++ ++ ATD D   N ++ + +    +     +F+++  +G+L  +  LDRE+   + I+V A D    +  +A+ TV + V D NDN P F   + +         IK+         +  + A+D D G+N L++Y L+  S  E LF LD+ SG + L
Sbjct:  142 VRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENG-VTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDY--NVSLNETALPGTPVVTVMASDNDLGDNSKITYYLA-----ETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHG-SPRQ-DGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVD----ENAVNGTVVAAVAVKDSDS-GLNGRTSVRIVSGNE----LGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVAS-ITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLE--SGGEGLFQLDARSGAISL 775          

HSP 4 Score: 170.244 bits (430), Expect = 3.348e-42
Identity = 198/735 (26.94%), Postives = 336/735 (45.71%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDK---AIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNG-LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKL--NAEIRCTDTSDHSTVKN----------------------LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSF-FTIDQQNQILKSKVTFDREQVSVHKLKILAIDHG-DERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSL-LGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD----SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPL---FNLDSDSGDLHLAVSLHTIRPID---TNTF-LDIEACDQGQPNQ 2399
            F +++ +G++   R +DREE       + +++         +      +  ++II  D+NDNAP++  D+     +S  EN+ +G    L    D D G N ++ Y + +     FR+    G LY++  + +  E  ++  + ++A D GSP  S++L ++V I DVND+ P F  + +  E  + E +   T    L A D D G+NG  ++ +    +   E+ F V P G + +++ +D + ++ ++   V  +D A +P S SS   V I + D ND  P          ++T   +I EN+   T +G+++  DRD   + +    S+ L +   +  I    +  N F I + R FDRE   K+  NAE    D S   ++                        + +I+ DVNDN PEF +  YH  I E    GT +   +F  D D   NG    S+    ++  F +D     L      DRE   +H L ++A D      L+S+  + + + D NDN    T   ++  + E       L   +A+D D    +Q ++ +     +  F I+  +G L+L   LD E+  ++ + +TASD    SL T +    V+VVD+NDN PIF +   V +I         I  + A D D G NG V Y + K   + P    F +++++G       +HT+R ID    +TF L + A D+ QP++
Sbjct:  879 FRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAII--DLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQ--RPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSY--ETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNT---ERMFGVFPDGYLFVRAPLDRE-ERDYYALTVSCRD-AGQP-SRSSVVPVVIHVIDENDNAPQFT-------NSTFTFSIPENAPADTFVGKLTAVDRD---IGRNAELSFTLSSQTQDFTI----DTRNGF-IKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHI-THVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLST-TVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETG------VIHTLREIDRESIDTFRLTVVATDRAQPSE 1578          

HSP 5 Score: 154.066 bits (388), Expect = 3.039e-37
Identity = 205/770 (26.62%), Postives = 338/770 (43.90%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPND----QNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQR--LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDI-GSNGQVIYRME------SKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVD-HDFGNN----GEFTFRMSPNTSPEVEKH----FLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDIND-EFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEF-------NIVSNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNG--KFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVND-NPVIITPLINQFYISENKQ-RSLLGVIKATDFD---NQTIYYLIDNKSQSK-FSIEKHSGRLFLQNSLDREEQETHHITVTASD-----SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDAD-HGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF-LDIEACDQGQPNQ 2399
            + E  EIG  +  +  +D     N    ++ ++N    F +E  +G + +   +DRE             QQ E  +K+   +  +     ++I I+D NDNAP +       SF E     +      ATD D  G N  + Y ++      S    +  +F    +  +++Q + R  +N+Y + ++A DNG P   +E  V + I+D ++NPPKF  + +     + +++  G  I+ + A D  D G N       TF +S   S  V +H     LV+P   +++          T +E  V   D  V P S  +  V+ +  ++++   F   ++    P++  +  TIL   +T          D D+              N  L   I+ G NE  +F        IV  ++ D +   + +  I   D   H  S+V  LTII+ DVNDNPP FN   YH YI EN+P+GT +  +   +DKDS  N    +      P   FF ++Q N  + S V+FD E+  ++ L+I A  + D  + S   +YVH+  VN+  P  + P+ + F +SE     + +G ++ATD D   +  +YYL+   S  K F I+ ++G +++   LDRE Q    +TV A +        T    V + + D ND  P F        I  +   G K+  + A D D    N    Y +   + K+  F +D  +G++  A  L      +T+T+ L I A D G P Q
Sbjct: 2921 VTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDRE-------------QQDEYILKVVASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYV-RSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYL--APLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFS--VGRHDGWITLVKP---IQVPPN-------TRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGAT----------DDDTG------------PNGMLRYSIS-GGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFV-FQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKA-KNPDSSMESYANLYVHVLGVNEFYPQFLQPVFH-FDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQS-FKIDVQTGEISTASRLDR---EETSTYNLVIGAIDTGLPPQ 3631          

HSP 6 Score: 144.436 bits (363), Expect = 2.726e-34
Identity = 187/753 (24.83%), Postives = 329/753 (43.69%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTT-DKAIVSFNENSPIGSRRSLPE--ATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNP-----PKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEF--TFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESP-GDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFD---NQTIYYLID-NKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---------------------------------------TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKS-----SYKEPL-FNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCT 2405
            F + + TG +   R IDRE I  T RL      + + +     + ++  + +++I+ED+NDNAP++ + + AI+    ++  GS  ++ +  A D D  SNG V Y + S  +  F+L ++ G+ I  T     +++  Y++ + + D     +    +V + II           P+F +   +    V+EN P GT IL + A  H      E+  T   +  +  +V++ F +    G +   +++D ++    +E +V       +P +  S   V + + D ND  P     P           + E+      I  +  HD D+ G         FL  D  +    +   EP+   ++ N   DRET+SK    IR +D   + T    TI + D NDNPP F    Y F I EN   G  +  ++   D D   N + +  + S   +  F+++ Q  +L      D E+V  + L + A D+G   L+++  VY ++ D+NDN  I  P+     + EN    + +  + A D D   N  I Y I      S+F I+ + G +  + +LDRE + T+ +TVTA D                                          +++  VT+++ D ND  P+F + N+   I  + +    +  + A D D G NG + Y++K++        +PL F+L+   G L +  +L   R + ++  L+I A D+G+P Q T
Sbjct: 1541 FGINTETGVIHTLREIDRESI-DTFRLTVVATDRAQPS----ERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGI-ITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQF-EQRSKLSGSVYENEPIGTSILTVTA--HLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRT--SRTKVRVTVLDKNDSPPQFLDTP-------FVYNVSEDLQIGHTISTLRAHDPDTLG------SVTFLLMDGHDGKFLL---EPSTGKLILNDTLDRETKSKYELRIRVSDGVQY-TEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQV-GQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSN-GTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANET-AIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALD--RELRSSYLLNITARDRGEPPQST 2260          

HSP 7 Score: 142.124 bits (357), Expect = 1.217e-33
Identity = 158/567 (27.87%), Postives = 248/567 (43.74%), Query Frame = 3
Query:  426 NQQCEVTIKLTHQNI---NFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESK-YRNSFRL-FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEP-YSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPT----ILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSN-------RKFDRETESKL--------NAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPG-DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENK--QRSLLGVIKATDFD-----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDRE 2027
            N + E+ ++ T + +   +   R+ I++   N + P ++ +   V   EN P+GS      ATD D G NG + Y +     R  F +  +  G+ I+  Q LD +    Y + I  QD G    S+   +T+ + DVNDNPP F    +     + EN P GT +    A D D   N    +   P+     ++HF +       I S + +D ++        +Q  A  P  S+ S A + + +  +N+      FYP+      + P     + E S+  T +G +   D+DS    +V+   Y L          +G++    F I +N       R  DRET++++           IR  DT +   +    I I D ND PPEF K  Y   I E  P+GT +     +       N +F+ SI +      F ID Q   + +    DRE+ S + L I AID G    T S  V++ ++DVNDN    TP     YISEN+    S++ +I A+D D         Y LI  K +S  S++++SG +    S DRE
Sbjct: 3192 NTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQ--QQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEY--HCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGP---DRHFFIMNQSNGTISSAVSFDYEERRI---YTLQIKAKNPDSSMESYANLYVHVLGVNE------FYPQ-----FLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVY---YLL----------VGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVI----ISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLI-ASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDRE 3718          

HSP 8 Score: 142.124 bits (357), Expect = 1.347e-33
Identity = 176/653 (26.95%), Postives = 285/653 (43.64%), Query Frame = 3
Query:  459 HQNINFVQRLSIIIEDVNDNAPIWTT--DKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRN--------SFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVE-PYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIG----QISVHDRDSKGLDKVHCESYFL---DNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGT-MLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHG-DERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSG----RLFLQNSLDREEQETHHITVTASDSLHT--ASXXXXXXXXDENDNKPIFKNM-NKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA 2318
             Q ++   +++I+I+DVND  P++ +  + AI+   EN  I +     +A D D G NG + Y M+              F L   +G  +     LDRE ++ Y + I A+D G P +S E Q+ + I+D NDN P F    +     V EN+  G ++L + A D D G NG    R S     +     +   TG V +   ++Y+   + +   V  +D A+E P   ++E  + I+I DIND  PT        DS  +   ++EN  T+ P G     ++ +D D+  L+      YFL   D+D      + G       +I   +  DRE +S+    +   DT          + + + D+NDN P F   +YH  ++EN P GT +L  R   +DKD   N K   ++       F ID +   + +  T DRE+ SV+ L ++A D    E   SS  + + + DVNDN P   +   N        +   +   +A D D   N  ++Y I  + Q  F I   +G    +L L+      +  T+ I ++A D      +S     V++   +  P F  M N    +     PG  I K+ AT    G  G ++Y +      + L  +D +SG L + 
Sbjct: 2144 QQRLSSTVKVTILIKDVNDEVPVFISANETAIM---ENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDG-QLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQY--SASVAENASIGAMVLQVSATDVDEGANGR--IRYSIVLGDQNHDFSISEDTGVVRVAKNLNYER-LSRYSLTVRAEDCALENPAGDTAE--LTINILDINDNRPTFL------DSPYL-ARVMEN--TVPPNGGYVLTVNAYDADTPPLNSQ--VRYFLKEGDSDLFRINASSG-------DIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPR--ATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSL-RVDPNSGLLSVG 2764          

HSP 9 Score: 134.42 bits (337), Expect = 3.418e-31
Identity = 166/672 (24.70%), Postives = 284/672 (42.26%), Query Frame = 3
Query:  327 NCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESK-----YRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYK---SNELQVTVEIIDVNDNPPKFTD---SIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEP--------NEFNIVSNR-KFDRET---ESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSL-LGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD----SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY 2246
            + F ++S TG L++ + +D E+I  T+  L      C         +++     ++++ D NDN PI+ +   +    E  P+ +      A D D G NG+V Y +  +         F +  + G+ I   + +DRE  + + + ++A D   P +   S E  VTV + D+NDN P F     +I  P+    + S   T ++ + A D D  +NG  T+ +    S   E   L R TG +       +  +   ++  +   D AV+    SSE  + I          ++   P+    + ++ ++ EN    T I  ++ H      L     E YF+ N     + A G+            +  I+S   + DRE    E ++            ++   + + +LD ND+PP+F    + + + E+  IG  +     +   D +  G  T  +    D  F ++     L    T DRE  S ++L+I      D    +     + + D NDNP +    +  F I EN QR   +G I A D D     Q  Y ++ + +   FS+   +G L L   LD EE + + + V A D    SL T + TV   V+D NDN PIF  M+   ++  +     ++  + A D D GNNGL++Y
Sbjct: 1430 DTFHIDSITGSLYLHKPLDYEDI--TSYTLNITASDCGTP------SLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGV-IHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGS--STAVMQVHAKDADSSSNGLVTYEI---VSGPQELFKLQRNTGIITFTPGPQFKQE-VRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSV---PQFEQRSKLSGSVYENEPIGTSILTVTAH------LASAEIE-YFVTN-----VTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTIST---LRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRV---SDGVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLST-TITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEY 2064          

HSP 10 Score: 130.568 bits (327), Expect = 5.116e-30
Identity = 155/639 (24.26%), Postives = 286/639 (44.76%), Query Frame = 3
Query:  477 VQRLSIIIEDVNDNAPIWTTDKAIVS---FNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQM-LDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTI--AFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNR----KFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPG-DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFD---NQTIYYLIDNKSQSK-FSIEKHSGRLFLQNSLDREEQETHHITVTASD-SLHTASXXXXXX--XXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
            V  +++ + D NDNAP+   ++ I +     E SP     ++ +A+D D G NG VIYR+++ +  +F + +   +Y   T+M LDRE+   Y  ++ A D G P+ +    V + ++D NDNPPKFT  +F     V EN+  G+ ++ + + D D G N   ++  S N      + F + P +G + +   +D +  +  +  KV+  D A       +E  + I IQD ND  P    +FY         + +  E   ++  +GQI   DRD +G + V   SY L   + +P+ +I       F+  + R    ++ R  E+     +  TD           + I I+D ++NPP+F +  Y   + ++   G  +  R+  +DK      +   S+ +    S F++ + +  +           + ++L + A D G    +    V + +   N +    +    Q  + EN+   S +  + ATD D   N  + Y I   ++ + FS+++ +G + +Q  LD +  + +H+ +T  D   H  S+   +   + D NDN P+F +      I  ++  G  + +  A D D   N ++ Y    S      F ++  +G +  AVS 
Sbjct: 2793 VTLITLNVTDANDNAPVM--EQLIYNAEVLEEESPP-QLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESGEIY---TRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFT-RLF--SLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPG----EKFRIEPQSGNITVAGHLDREQ-QDEYILKVVASDGA-----WRAETPITITIQDQNDNAPEFEHSFY---------SFSFPELQQSIALVGQIIATDRDKQGPNSVI--SYSL--QQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRI-VRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSF 3398          

HSP 11 Score: 122.865 bits (307), Expect = 1.170e-27
Identity = 152/592 (25.68%), Postives = 262/592 (44.26%), Query Frame = 3
Query:  600 ATDIDIGSNGQVIYRMESK-YRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESY-FLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNN-NGKFTLSIESPGDSFFTIDQQNQILKSK--VTFDREQV-----SVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQF-YISENKQRSLLG--VIKATDFDNQTI------YYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSL---HTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDL 2309
            AT    G  G++ Y +      +S R+  ++GL       LD E  ++YEI I A D  +P   +   +T+ + D NDN P     I+  E  V E   P  +I ++KA D D G+NG   +R+      + +  F +  +GE+  + ++D + +   + F V   D  V P+ ++  A V + + D ND  P          +   +  + EN+   + + +++  D D   L      SY F +N      I     EP   NI      DRE + +   ++  +D +  +    +TI I D NDN PEF    Y F   E +     L  ++  +D+D    N   + S++ P    F+ID     + SK  V F   Q      +++ L +LA D+G   L S C+V ++I D ++NP    P   Q  Y++   Q ++ G  +++    D Q +      Y L+     S FS+ +H G + L   +       + + V A+D      +  T V +VV  EN + P F   +  + +  +E  G  I  + ATD D G NG+++Y +   + ++  F++D  +G +
Sbjct: 2728 ATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAE--VLEEESPPQLIAVVKASDRDSGDNGNVIYRL----QNDFDGTFEITESGEIYTRMRLDRE-EIGDYAFVVEAVDQGV-PH-MTGTASVLLHLLDKNDNPPKF--------TRLFSLNVTENAEIGSFVIRVTSSDLD---LGANANASYSFSENPGEKFRI-----EPQSGNITVAGHLDREQQDEYILKVVASDGAWRAETP-ITITIQDQNDNAPEFEHSFYSFSFPELQQ-SIALVGQIIATDRDKQGPNSVISYSLQQP-SPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNP----PKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQD-FSVDERTGGI 3286          

HSP 12 Score: 111.309 bits (277), Expect = 3.638e-24
Identity = 179/720 (24.86%), Postives = 286/720 (39.72%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNI--------NFVQRLS------IIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNG--SPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEP--NEFNIVSN-RKFDRETESKLNAEIRCTDTSDH-----STVKNLTIIILDVNDNPPEF---NKGTY--HFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITP-----------------LINQFYISENKQRSLLGVIKATDFDNQTIYYLIDNKSQSK--------FSIEKHSGRLFLQNSLDR----EEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHL 2315
            F +++  G +   R  DRE +   +R  +++ +   +   +    +        N + RL       +I+ DVNDNAP +      V+ +E +  G+  +     D D G NG V Y + +      F L    G  +   + LDRE + ++ +I++A+D     P  SN   +T+ ++D NDN P+FT S    E  V E SP GT ++  +A D D G N +  F +S       +   +   TG + +   +DY+ D T +   +   D      SLS+  +  + + D ND  P        P +A +   I E     TPI  ++  D DS    KV   SY +   K  P +  G +     E  ++   R+ DRE+       +  TD +       ST K +T+I+ D+NDN P F   N       F   +      M   ++   D DS++NG  T  I S     F + +   I+        +Q   ++L + + D   +    S  VY+          IITP                 L    Y +E    S+L V       +  I Y + N + +         F I+   G L     LDR    EE E     +       T+ T V V V+D+ND+ P F +   V  +      G  I  + A D D    G V ++L      +  F L+  +G L L
Sbjct: 1199 FTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATG-QLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNA-SITIVVLDENDNAPEFTQS--SSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGN--RRDTFHIDSITGSLYLHKPLDYE-DITSYTLNITASDCGTP--SLSTTVLYNVLVVDDNDNPPIF------PSTAIVR-QIKEGIPLKTPIVTVTADDPDSGLNGKV---SYAI--SKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVM---QVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYI---------TIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTV--TAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPD--TLGSVTFLLMDG--HDGKFLLEPSTGKLIL 1879          

HSP 13 Score: 108.227 bits (269), Expect = 3.393e-23
Identity = 180/726 (24.79%), Postives = 307/726 (42.29%), Query Frame = 3
Query:  303 FNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKN---VYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVF---ENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNR-KFDRETESKLNAEIRCTDTS-DHST-VKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKD--SNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATDFDNQ----TIYYLIDNKSQSKFSIEKHSGRLFLQNSLD-------REEQETHHITVTASDSLHT---ASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATD-ADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQ 2399
            FN     ++ F ++S TG++     +DREE    +  L + +        +T    + V  L+I + DVNDN P + +    V+  E    G       A D+D G N  V Y +  + ++ F +    G+     ++  + K +    Y I+I A D G    S++ ++TV +      PP+   +        F   E+  PG +I  + A     G  G+  + ++      +     V P   +    +   D + TH  +++ ++    +  SL S  ++ +++ D ND  P +       +    N  +LE  S    I  +   DRDS     V    Y L ND        GT E  E   +  R + DRE        +   D    H T   ++ + +LD NDNPP+F +  +   + EN  IG+ +  R+  SD D  +N N  ++ S E+PG+  F I+ Q+  +      DREQ   + LK++A D G  R  +   + + I+D NDN          F   E +Q  +L+G I ATD D Q     I Y +   S   FSI+  +G +F + ++        R  +  + +TV A+D+      +   V + +VD ++N P F+    +  +      G +I ++ A D  D G N +  Y L   +    +F++    G + L   +    P +T   L + A D+G P Q
Sbjct: 2528 FNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDS------SITEPRASSVN-LTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVIL-----RPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGI---MGDSLRVDPNSGLLSVGQDGLDYELTHL-YEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVM-------EQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNV---IYRLQND------FDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTR-LFSLNVTENAEIGSFV-IRVTSSDLDLGANANASYSFS-ENPGEK-FRIEPQSGNITVAGHLDREQQDEYILKVVASD-GAWR--AETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPS-PMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEM-DYSLMTFNLSS-IFSVGRHDGWITLVKPIQV--PPNTRYELVVRATDRGVPPQ 3209          

HSP 14 Score: 53.1434 bits (126), Expect = 2.122e-6
Identity = 68/270 (25.19%), Postives = 120/270 (44.44%), Query Frame = 3
Query: 1548 FYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVH-KLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGVIKATDFD---NQTI--YYLIDNKSQSKFSI------EKHSGRLFLQNS--LDREEQETHHITVTASDSLHT---ASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSG 2303
            F + E +P GT +    F+  K      KF+     P   F T+D     +K+ V  DRE +  H  L +L+      + T    V + + DVNDN P    P I   +       + L +  ATD D   N     Y ++     +KF +         +  L L+ +  LDRE + ++ + ++A D           V V ++D NDN PIF + +  + ++ +  PG  +  ++A+D D G+N  + Y L ++ ++   F ++ ++G
Sbjct:   71 FEVLEGQPRGTTVG---FIPTKP-----KFSYRFNEPPREF-TLDPVTGEVKTNVVLDREGMRDHYDLVVLS-----SQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQ---FTVNPETG 323          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0346077)

HSP 1 Score: 188.348 bits (477), Expect = 7.640e-48
Identity = 210/750 (28.00%), Postives = 332/750 (44.27%), Query Frame = 3
Query:  345 SSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIE--DVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDN--GLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHS--TVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSL-LGVIKATDFD---NQTIYYLI-DNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASES--PGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF----LDIEACDQGQPNQC-TIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVLIAAI 2531
            S +G+L + + +DRE+    N ++ +      V          F     ++I+  D NDN P +       S  ENS          ATD D G NG + Y +ES   N   +F  +    +I     LDRE ++ Y   +IA DNG P    ++ VT++I+D NDN P F   I      VFEN+ PGTV++ L  +D D     E  F +    S + +  F +  +GE+ I   +D +     +   +I  D        +++A VEID++DIND  P     PR   S        E+ S  T + ++   D D +   + +      D+       +IG  E     + S    DRET  K        D  D +      + I + D+NDN P F+   Y   + E+  + T++  ++   DKD   N +   S+      +F I +   I++   + DRE +S+  L + A D G  +L S   V V+I D+NDNP   +       I EN      +  + AT  D   N  I+Y I     Q KF ++  +G L L  +LD E  + + +T+ A D      + +  V + ++D NDN P F  +  + +I+ +E    G KI  + ATD D   NGLV Y +++       F++D  +G + ++      RP+D  T     L+I+ACDQG P +C ++   + I   TN N P    S+      Y   L EN L+  +
Sbjct: 2807 SDSGELILQQTLDREQQESHNLIVVAETSTVPV----------FFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPI--EGLSVFENALPGTVLINLLLIDPDI-EKQEMDFFI---VSGDKQAQFQIGKSGELFIAKPLDREQ-LMFYNLSIIATDG-----KFTAKANVEIDVKDINDNTP-YCLKPRYHISTN------ESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADD------FSIG-KESGILKVAS--ALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLI-TKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTF--LQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGD-NIGQFSIDPKNGTISVS------RPLDRETISHYTLEIQACDQGDPQRCNSVPININI-LDTNDNAPIFSSSN------YSVVLQENRLLGYV 3501          

HSP 2 Score: 163.31 bits (412), Expect = 4.096e-40
Identity = 198/751 (26.36%), Postives = 341/751 (45.41%), Query Frame = 3
Query:  225 YRIKEETEIGYVIDYIKPNDQN-NLKIFNTNDNGVNC--FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLS-IIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM--ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDN--PPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGN-NGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIV---SNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMF---VSDKDSNNNGKFTLSIES-PGDSFFTIDQQNQILKSKVTFDRE-QVSVHKLKILAIDHGDERLTSSC----IVYVHIKDVNDNPVIITPLI-NQFYISEN-KQRSLLGVIKATDFDNQTIYYLIDNKSQ-SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQ 2399
            +R+ E   IG V+  +   D +  +    T    V C  F + ++TG L + + +DRE         K +N    +T K     +   + L  ++++DVNDNAP++   + I    E+ P G+  ++ EA D DIG N ++ + +  E++    FR+ +  G  I     LD E K V+ +I+ A D G P  ++++ + + IIDVN+N   P+F D ++  E +V EN P GT ++ + A D D  + N + T+ ++      +   F V   G +   S++D ++ K  +   +  QD A+ P  LS+   V I +++ ND  P         D       + E S     I  +   D D   +D     +Y + +  L     +G  E +    V   + RK DRE +++   E+  +D      S+   + + +LD+NDN PEF++  Y   +    P    ++  +F     D DS  NG+ T SI+S  G + F ID Q   +      D + +  +H   I A D+G  + + +     +V     +  + P+I+     N   ++EN K   L+  I A D DN  ++Y I N +  + F I + +G + L   LD E Q+++++T++ +D   TA T + V V+D NDN P F      + I  +      I ++ ATD D            +      LF +DS SG++ +   L   +       L +   DQG P +
Sbjct:  884 FRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDRE---------KQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGA-IRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVY--EGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGI---FAVNDQGSITSLSQLDAET-KNFYWLTLCAQDCAIVP--LSNCVEVYIQVENENDNIPLT-------DKPVYYVNVTEASVENVEIITLKAFDPD---IDPTQTITYNIVSGNL-----VGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQV----PSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIH---IKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKT--AQHILIVFVKDQGAPGK 1592          

HSP 3 Score: 152.14 bits (383), Expect = 1.211e-36
Identity = 176/662 (26.59%), Postives = 294/662 (44.41%), Query Frame = 3
Query:  126 LFFERLSIANMNSLLWWSIFALIDIEGLSSNKIYRIK--------EETEIGYVIDYIKPND---QNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLL------KSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEF-TFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPL---INQFYISENKQRSLLGVIKATDFD-----NQTIYYLIDNKSQSK--FSIEKHSGRLFLQNSLD 2021
            L F  LSI   +          ID++ ++ N  Y +K        E   IG  +  +K  D   Q+ L+ F  +  G + F +   +G L +   +DRE   P  +L+      K   Q+C   I +T             + D+NDN PI++  +  VS  E++ + +  +   A D D G N Q+ Y +  +  + F++ +  G+ I   + LDRE  +++ + + A+D G P   +   V V I+D+NDNPP+F  S+ +   ++ EN+  GT +  + A   D G N +   F MS N   E  K  +   TG++ + + +DY+  K +F   +   D    P  LS+ A V I I DIND  PT   + +N     +N  I   S  +    + +  D D  GL   + E    DN      I   + +P    I  +R  DRET S    EI+  D  D     +  + I ILD NDN P F+   Y   ++EN  +G +          ++ N   +T  I S  +      +Q+  L++   F+        +++   D+G   L S   V V I + +  P I+TPL   IN F   ++   + +G + A+D D     N ++    D+  QS   F+I  ++G+++  ++LD
Sbjct: 3033 LMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLR-FYLSGKGADDFSIGKESGILKVASALDRE-TTPKYKLVAHVQDGKDFTQECFSEIIIT-------------VNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGI-IRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEF--SMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGN---EQGKFKMDSTTGDLVLNATLDYEMSKFYF-LTIQAIDGGTPP--LSNNAYVNISILDINDNSPT---FLQNLYRINVNEDIFVGSKILDV--KATDEDSDVNGLVTYNIERG--DN------IGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSF--EDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLD 3655          

HSP 4 Score: 151.754 bits (382), Expect = 1.659e-36
Identity = 180/650 (27.69%), Postives = 297/650 (45.69%), Query Frame = 3
Query:  549 VSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPP--KFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF----------YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIIL--DVNDN--PPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNN---NGKFTLSIESP-GDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGVIKATDFD---NQTIYY-LIDNKSQSKFSIEKHSGRL-FLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDT-NTF-LDIEACDQGQPNQ 2399
            +S NE+  +G   +  EA D D+G NG++++ + +  Y + FR+  D G  ++    LDRE++N Y + I   D G+P KS    + + I+DVNDN P  + T + FR    + E++  GTV+  L A D D G N + T+ +S   S      F V   TG + +   +D +  + ++   +  +D    P  LSSEA+V + + D+ND  P               PR     T+   I      + P  +I    +     ++   E  F  +     I   G               D E +   N  +   D  D S   +++I+I+  DVN+N   PEF+   Y   +KEN+P GT +   M V+ +D +    N K T SI    G   F ++ Q  I  S    D E  + + L + A D     L++   VY+ +++ NDN P+   P+        + +   +  +KA D D    QTI Y ++       F I+  +G +   +  LDRE Q  H + V  SD+   + ++++ + V V+D NDN P F      +++ +S +    I ++ A D+D G NG + Y +K    K   F +DS  G +H+A      +P+D+ N F + I+A D G P +
Sbjct:  779 LSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRG-ELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFR----LTESARIGTVVHCLHATDADSGINAQVTYALSVECS-----DFTVNATTGCLRLNKPLDREK-QDNYALHITAKDGG-SPV-LSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPR----GTVLAVIEAVDEDIGPNAEIQFSLK-----EETQDEELFRIDKHTGAIRTQG-------------YLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFV---MNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSI-TSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNK-FRIDSQRGHIHIA------KPLDSDNEFEIHIKAEDNGIPKK 1382          

HSP 5 Score: 147.902 bits (372), Expect = 2.009e-35
Identity = 179/691 (25.90%), Postives = 311/691 (45.01%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREK-KNVYEIIIIAQDNGSPY-KSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGN---------NGEFTFRMSPNT-----SPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVV-------EIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTP--IGQ-------------ISVHDRDSKGLDKVHCESYFLD---NDKLNPIIAIGTNEP--------NEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFT--LSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATDFD---NQTIYYLIDNKSQSK--FSIEKHSGRLFLQNSLDREEQETHHITVTA---SDSLHTASXXXXXXXXDENDNK--PIFKNMNKVIKIDASESPGFKICKIVATDAD 2219
            F +   +G L+  +++D E+       + + +Q    + K +        ++ I ++D+NDN PI+     ++S NEN+  GS      A D D G N  + Y + +     F +   +G+ ++ T +LD E  K  YE+II A D G PY +  E+++++ + D+NDN P+F         +V +++P GT + +  A+D D G+         N +  F + P +     S +++K  L     +V         +D THF   +I+  H + P  L  ++ +       E     +              +  + +P++  + S +TP   GQ             +S+++    G      E+   D   N KL   I+ G  +          E  I+     +R+ E  LN  +        ST K L I ILDVNDN P   K    F + E+  IGT++ + +  +D DS  N + T  LS+E    S FT++     L+     DRE+   + L I A D G   L+S  +VYV + DVNDN  +       F + E+  R ++L VI+A D D   N  I + +  ++Q +  F I+KH+G +  Q  LD E ++ H++ V+A    D   T+  ++ ++++D N+N+  P F +     K+  ++  G  +  + A D D
Sbjct:  448 FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSA------KVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGI-VKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFER--VNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSA-------TDGTHFSDDLIINVHLM-PEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLS-LTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVV-HCLHATDADSGINAQVTYALSVEC---SDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMD 1116          

HSP 6 Score: 142.51 bits (358), Expect = 1.160e-33
Identity = 183/694 (26.37%), Postives = 305/694 (43.95%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPNDQ----NNLKIFNTNDNGVN-CFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTI-KLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFT--DSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPE----VEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS--DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIK----ENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILK-SKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYI--SENKQRSLLGV--IKATDFDNQTIYYLI-DNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITV------TASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADH 2222
            I E  ++G  + +I+  D+    N   +F  +D   +  F ++   G+L I   +DRE         + N     +T+  L +   +  + L I I DVNDN P+     A     E++ IG+      ATD D G N QV Y +  +  + F +    G    N + LDREK++ Y + I A+D GSP  S+E  V V + DVNDN P F   + IF+    V E+ P GTV+ +++AVD D G N E  F +   T  E    ++KH     TG +  +  +DY++ + H    +IV        SL+S+  + I I D+N+      F P   D       + EN    T +  ++  D D+  L+     S     D L  I A+     ++ +I S  + D ET++     +   D +    S    + I + + NDN P  +K  Y+  +     EN  I T+   + F  D D      + + +      +F ID +  ++K ++   DRE  + H L++   D+G   L+S+  + V + D+NDN       + +  +  S    +S+  V  I +   +N  I Y I   K ++KF I+   G + +   LD + +   HI          S +       V V    +N    + K    V+ +  ++ PGF + +I+A D D+
Sbjct:  781 INESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRE---------RQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSD-FTVNATTGCLRLN-KPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFK----VREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKH-----TGAIRTQGYLDYENKQVH---NLIVSAIDGGDPSLTSDMSIVIMIIDVNEN----RFAPEF-DDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYS-ITGGDGLG-IFAVN----DQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITL---KAFDPDIDPTQTITYNI-VSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDN 1436          

HSP 7 Score: 132.88 bits (333), Expect = 9.109e-31
Identity = 137/546 (25.09%), Postives = 240/546 (43.96%), Query Frame = 3
Query:  714 MLDREKKNVYEIIIIAQ-----DNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRN-PDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDT-SDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDS----FFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSG 2303
            + DRE K++Y + + A+        S  +     + + ++DVNDN P F +  +     +  + P GT+I+ +KA+D D   NGE  + +        E   L R +GE+ IK  ++      ++E  V   D A+ P   SSEA +++ + D +       FY  +  +   M   +  +    +P+G+  ++   S+       +S+ +D               N  +I    + D E  S  +  IR TD+ S       L++ I+DVND  PE     Y+  I EN   GT +  ++  +D DS  N K +  IES         F ID  +  L  K   D EQ+  H + +   DHG   L+S   V++ +KD+NDN P  + P           +   + + KA D D    +   Y ++       +SI+K +G + LQN L+  ++ +  + ++ SD +HTA   + + ++ EN   P+F       ++  +   G  I  + A+D D G    + Y +     K+ +F +D  +G
Sbjct: 2092 IFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSI--DDPKGTIIMQVKAIDLDSAENGEVRYELKKGNG---ELFKLDRKSGELSIKQHVE--GHNRNYELTVAAYDGAITP--CSSEAPLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSES------QSFEIDY--------------NTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQI-LKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKK-IFLIDQTTG 2606          

HSP 8 Score: 122.479 bits (306), Expect = 1.394e-27
Identity = 171/685 (24.96%), Postives = 300/685 (43.80%), Query Frame = 3
Query:  327 NCFELESSTGKLFITRRIDREEICPTN-RLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPP--GTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS--DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK---FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ---RSLLGVIKATDFD---NQTIYYLIDNKSQ-SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA 2318
            N F+++  +G + +   +DRE     N +++ ++N   +   K+          ++I I D NDNAP++      +S  EN+  G+        D DI       + +    +  F++ +   L+I   + LDRE+   Y + IIA D     K+N   V +++ D+NDN P       +P   +  N     GT ++ +KA+D DF    +  F +S   + +     + + +G +++ S +D +   T  ++K++      + ++    + + I + DIND  P  +        A    ++ E++   T I ++   D+D  G+++    S   +N    K++    I         I  ++  DRET S  N  ++  D       ++  + + ILD+NDNPPEF+   Y   I EN   GT +  +++ +  D   N     F +S    G   F +D     L    T D E    + L I AID G   L+++  V + I D+NDN    T L N + I+ N+     S +  +KATD D   N  + Y I+      +FSI+  +G + +   LDRE    + + + A D        S  + + ++D NDN PIF + N  + +  +   G+       +DAD   N        +S  +  LF L+ D G L  A
Sbjct: 2908 NIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVP---------VTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELFI--AKPLDREQLMFYNLSIIATDGKFTAKAN---VEIDVKDINDNTPY----CLKPRYHISTNESISIGTTLVEVKAIDFDF--QSKLRFYLSGKGADDFS---IGKESGILKVASALDRE---TTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSM-------AQYRVSVPEDAQLNTLITKVHAMDKDF-GVNRQIKYSLMGENHDYFKISKSTGI---------IRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEV-CKVYATSIDIGVNADIHYFIMSGNEQGK--FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSP--TFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQD-GSLRTA 3543          

HSP 9 Score: 119.783 bits (299), Expect = 9.377e-27
Identity = 157/650 (24.15%), Postives = 281/650 (43.23%), Query Frame = 3
Query:  210 SSNKIYRIKEETEIGYVIDYIKPNDQNNLKIFN--TNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNS----FRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPT-GEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHC---ESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDN---------RMFVSDKDSNNNGKFTLSI-ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN---PVIITPLINQFYISENKQRSLLGVIKATDFDNQTIYY-LIDNKSQSKFSIEKHSGRLFLQN--SLDREEQETHHITVTASDSLHTA 2081
            +S  +  + E  + G+++  I   D +N +++   +N N  N F +    G + +++ +D E             Q   +TI +T         L + + D+NDN P +  D   V+ +EN    S      ATD D   + ++ Y + +    S    FR+   +G  I  TQ LD EK   + +I+  +D G+P K N  ++ V + D ND+ P+FT  I   + +V E++  G+ +  ++A+D D G+N E  + +    +  V   F + PT G + +   ++ +  +  +  +V   D    P  LSS+  V I +    ++ P    +P N     +   I EN    T + Q++     S   + +     ES+     ++NP   +         IV N   D E+    N  ++ T+ +  S+ +N+ I ILD NDN P F +  Y   + E+  IG+ +            + V D D   NG     I +    +FF ID     ++     D E  + +   +   D G  +L S+   +V I+ +N N   PV     +N        +   +  + A D DN T+ + ++D  +   F IEK++G +  +N   L+ E    + + V ASD + +A
Sbjct: 1409 TSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYE-----------TQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRD--EDKKLFYHLHATQDPSSLALFRIDSISGNVIV-TQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKII--QSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSI---ITGNVGSVFEIDPTFGIITLAGNLNINKIQ-EYMLQVKAVDLGNPP--LSSQIPVHIIVTMSENDPPK---FPTN----NIAIEIFENLPIGTFVTQVTARSSSSIFFNIISGNINESF-----RINPSTGV---------IVINGNIDYESIKVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASDGIFSA 2015          

HSP 10 Score: 119.398 bits (298), Expect = 1.219e-26
Identity = 181/711 (25.46%), Postives = 319/711 (44.87%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMES-KYRNSFRLF----QDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKEN-EPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQ-----ILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFDN-QTIYYLIDNKSQSKFSI---EKH-----SGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYK-EPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQP 2393
            FE++ +TG +F+   +D E+I   +  +++ +    V  ++          LS+ I DVND  P   +D   ++  EN+  G++     ATD D G+N ++ Y +ES   +N+  LF     D  LY++    LD E+   + I++  +D+GSP  S+   V + + D+NDN P F +  +  +  V   +  G  + L KA D D  +     +++      E++ + + + TG + +++ +++ +DK+     + V D     Y     A ++I +       P   + P   D +T    + EN      I  +   D D      ++   Y + ++++  I  I   +     I S   FDRE + +    ++ +D        +L +I++DVNDN P F    Y   +    E   T+L  +    D   N +  F +  +S   +   + + N+     + KSK   +   V+ ++  + A D G+ +  S   V + I + + N       I  F     K   LL +I++T      T  ++I N +  KFSI   + H     SG L LQ +LDRE+QE+H++ V A  S   +  A   V + V DENDN P F N      +  +      + K+ ATDAD G NG ++Y L+  +   + +F++D  SG + L  SL   R + +     + A D G P
Sbjct: 2285 FEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVV---------LSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTP--LDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSV--AAVRGQFVALPKAYDKDISDTDSLEYKIVYGN--ELQTYSIDKLTGVISLQNMLNF-TDKSSTVLNISVSDGVHTAY-----ARLKISL------LPENVYSPLF-DQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLY---YEIVSEEMKKIFLI---DQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKA--ESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDAN-------IPTF----EKSSVLLKIIESTPPGTVLTKLHMIGNYT-FKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLD--REVQSEYNFKVIAADNGHP 2945          

HSP 11 Score: 105.916 bits (263), Expect = 1.415e-22
Identity = 188/737 (25.51%), Postives = 309/737 (41.93%), Query Frame = 3
Query:  243 TEIGYVIDYIKPNDQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQR--LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGL--YIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMT---------PIGQISVHDRDSKGLDKVHCESYFLDNDK-LNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD---HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFY---ISENKQRSL-LGVIKATDFD---NQTIYYLIDNKS---QSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHT---ASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFL 2363
             ++ Y I+ I  N QNN ++F           ++ + G L++   +D E+I               V +K  H + +   R  + I ++D+NDNAP +         +  +  G   +LP+A D DI     + Y++   Y N  + +  + L   I    ML+   K+   ++ I+  +G       L+++  ++  N   P F  S +  E QV EN   G  I+ +KA D DFG      + +    S E++K FL+  T  V I SK+ +D +K                     E VV + + D   +F   +      D     P  L     M           I  +   D D      VH +     NDK +  +I I  NE    +IV   K +    +     +R +D  +   HS V  ++I I++ + N P F K +    I E+ P GT+L     +       N  F  SI +  D F   D    IL+   T DREQ   H L ++A         +   V + ++D NDN        N FY   ++EN ++ + L  + ATD D   N  I Y +++ +   Q+ F I+ +SG + L  SLDRE Q  ++  V A+D+ H    A   VT+ +VD NDN P+FK   + + +  +  PG  +  ++  D D     +  +I+  S  K+  F +   SG+L +A      +P+D    +
Sbjct: 2374 AKLSYYIESI--NGQNNSELF----------YIDVTDGNLYLKTPLDYEQI---------KYHHIVVNVK-DHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKI--VYGNELQTYSIDKLTGVISLQNMLNFTDKS-STVLNISVSDGVHTAYARLKIS--LLPENVYSPLFDQSTY--EAQVPENLLHGHNIITVKASDGDFGTYANLYYEI---VSEEMKKIFLIDQTTGV-ITSKVTFDREK-------------------KDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEI--NEKTG-DIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVP-VSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIG------NYTFKFSIAADQDHFMISDSGELILQQ--TLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDN---YPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIV--SGDKQAQFQI-GKSGELFIA------KPLDREQLM 3034          

HSP 12 Score: 102.834 bits (255), Expect = 1.286e-21
Identity = 137/547 (25.05%), Postives = 235/547 (42.96%), Query Frame = 3
Query:  492 IIIEDVNDNAPIWTTDKAI--VSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESK-YRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTM---TPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEF-------NIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTL-SIESPGD-SFFTID--QQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFDN----QTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            I +E+ NDN P+  TDK +  V+  E S         +A D DI     + Y + S      F +    G+     + LDRE +  + + +   DNGSP  S+  ++ V ++D+NDN P+F   +++   QV  ++     I  + A+D D G NG  T+ +                      K+K   DS + H         H  +P  L S+   EI I+  ++  P  +   R            +N+  +   T    + + + D  G       +   DND+L   I+ G N+ N F       NI+ ++  D ET+   N  I  TD +  +   NL + ++D+NDNPP+F K  YH  I EN    +++  ++  +D+D +    + L + + P   + F ID    N I+  ++ F  E+ + H L +   D G     +   + V++ D ND+    T  I Q  + E+    S L  ++A D D+    +  Y +I     S F I+   G + L  +L+  + + + + V A D
Sbjct: 1181 IQVENENDNIPL--TDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYK--VQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKG-----------------KNKFRIDSQRGHI--------HIAKP--LDSDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNG-NDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGT-FTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVI-MQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDF--EKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVD 1691          

HSP 13 Score: 97.8265 bits (242), Expect = 4.078e-20
Identity = 159/635 (25.04%), Postives = 273/635 (42.99%), Query Frame = 3
Query:  483 RLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGT-VILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV--RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNE---PNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDV---NDNPPEFNKGTYHFYIKEN-EPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD---SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKAT------DFDNQTI-YYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
            RL I +   N  +P++          EN   G      +A+D D G+   + Y + S+      L       I +    DREKK+ Y +++   D G  +    L+V V   DVNDN P F   + +  K V   +      IL +KA D D  +NG   F++   ++ +  K  +     TG++  KSK +       ++F V   D   EP    SE  V I+I + +   PT        + +++   I+E+    TP G +         L K+H     + N      IA   +     +   ++  +  DRE +   N  I   +TS          +++DV   NDN P+F+   Y   + EN E + +++  ++  +D D+  NG     +ES  +   + F ID  +  +    + DRE  S +  K++A D+G  +  +   V + I D NDN  +    I    + EN   +L G +         D + Q + ++++    Q++F I K SG LF+   LDRE+   +++++ A+D   TA   V + V D NDN P        I  + S S G  + ++ A D D  +   +++ L      +  F++  +SG L +A +L
Sbjct: 2536 RLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVV--DVNDNVPYF---LLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAE-SYGVNSYQFFVRASDRG-EP-QFHSEVPVSIEIIETDANIPTF-------EKSSVLLKIIES----TPPGTV---------LTKLH----MIGNYTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNL-IVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLV--KVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFEN---ALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGK-SGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSK--LRFYLSGKGADD--FSIGKESGILKVASAL 3127          

HSP 14 Score: 97.8265 bits (242), Expect = 5.211e-20
Identity = 173/724 (23.90%), Postives = 309/724 (42.68%), Query Frame = 3
Query:  318 NGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQCEVTIKLTHQN-----INFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMES-KYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDV---NDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDS-KGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDV---NDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPG-DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIK-DVNDNPVIITPLINQFYISENKQRSLLGVIKATDFDNQTIYY-LIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD-SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKI----------VATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNT----FLDIEACDQGQP 2393
            N V  FE++S TG +  T R++DRE              Q E  +++   +     ++   R+ + + D+NDN+P +      V    ++ +        A D D G NG++ Y ++S K +N FR+    G +I   + LD +  N +EI I A+DNG P KS   +V + ++ V   + N P            + EN  PG ++  + AVD D   N +  + +S          ++ +  G + +   +DY++ ++ +   + V D     ++      + + + DIND  P  A      D   +N  I EN    + I Q+   DRD  K L       Y L   +    +A+   +    N++  ++ D E  ++    +   D       +N   II++V   ND+ PEF        + E+  IG+ L     + D+DS +N +   SI +    S F ID    I+      +  ++  + L++ A+D G+  L+S   V++ +    ND P   T  I    I EN       V + T   + +I++ +I       F I   +G + +  ++D E  +  ++TV  ++ +  ++   + + ++D NDN P F     V  +  S + G  + K+             DAD G NG+V+Y +     K   F +DS +G + L      +R +D  T      D+   D G+P
Sbjct: 1236 NLVGYFEIDSKTGVIKTTERKLDRE-------------NQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRG-HIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNT--FYIGQDNGNILLSKYLDYETQQS-YNLTISVTDGTFTAFT-----NLLVQVIDINDNPPQFA-----KDVYHVN--ISENIEEESVIMQLHATDRDEDKKL------FYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGK-RNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAI-DRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNI-AIEIFENLPIGTF-VTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKN-FFKIDSTTGAIEL------LRQLDYETNAGYTFDVTVSDMGKP 1908          

HSP 15 Score: 92.4337 bits (228), Expect = 2.162e-18
Identity = 163/654 (24.92%), Postives = 281/654 (42.97%), Query Frame = 3
Query:  486 LSIIIEDVNDN--APIWTTDKAIVSFNENSPIGSRRSLPEATDID-IGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEI-KSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEI-DIQDINDEFPTIAFYPRNPDSATMNPTILEN---SSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD-NQTIYYLI----DNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTAS---XXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQP 2393
            + I+I DVN+N  AP +          EN P G+      A D+D +  N ++ Y +            D G  I +   LD E KN Y + + AQD      SN ++V +++ + NDN P     ++     V E S     I+ LKA D D       T+ +    S  +  +F +   TG ++  + K+D ++   H   +V + D+     S +S  VV + DI D + EF    +  + P SAT+N +I +     S     G+I+   +  KG +K     + +D+ + +  IA   +  NEF I    + +   +    A +       +   +N  +I+   ++N  +         + EN+  G ++   + V D   N+   + +S  +  ++F+       IL SK   D E    + L I   D      T+   + V + D+NDNP      +    ISEN ++ S++  + ATD D ++ ++Y +    D  S + F I+  SG + +   LD E+   H + V   D           + V V D ND+ P F       K+  S + G K+ ++ A D D G+N  ++Y +   +    +F +D   G + LA +L+ I  I     L ++A D G P
Sbjct: 1072 IVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQG-SITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYY--VNVTEASVENVEIITLKAFDPDIDPTQTITYNI---VSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHI-LEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNK-----FRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVD---------LTENDKPGFLVTQILAVDD--DNDQLWYNISNGNDDNTFYIGQDNGNILLSKY-LDYETQQSYNLTISVTDG---TFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGS-VFEIDPTFGIITLAGNLN-INKIQ-EYMLQVKAVDLGNP 1695          

HSP 16 Score: 73.1738 bits (178), Expect = 1.361e-12
Identity = 79/270 (29.26%), Postives = 122/270 (45.19%), Query Frame = 3
Query: 1614 DSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGV-IKATDFD---NQTIYY-LIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD-----SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQP 2393
            D N +G F L      D ++   + NQ          +Q  ++ L +LA D G  R  +   V + IK  + N  I T  I +  I E    ++  + +K +D D   N  +Y  ++      +F I   SG L+    LD E++ ++ +TV+A D     S   +S  V + V D NDN PIF+N+NKVI I+ +   G  + K+ A D D G N  + Y +  ++     F +D  SG +    SL     +  N  L I A D G P
Sbjct:  331 DGNPDGTFLLKAAETKDEYYI--ELNQFAHLN-----QQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSI--ANLNAVPFEIDHFSGIVK-TTSLLDFETMKRNYELIIRASDWGLP 590          

HSP 17 Score: 73.1738 bits (178), Expect = 1.625e-12
Identity = 183/780 (23.46%), Postives = 310/780 (39.74%), Query Frame = 3
Query:  186 ALIDIEGLSSNKIYRIKEETEIGYVIDYIKPNDQNNLKI-FNTNDNGVNCFELESSTGKLFITRRIDRE---------EICPTNRLLKSNNQQCEVTIK-------LTHQNINFVQ-RLSIIIEDVNDNAP-IWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLF------QDNGLYIENTQMLDREKKN-VYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFN--IVSNRKFDRETESKLNAE--IRCTDTS---DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVS---DKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHI--KDVNDNPVIITPLINQFYISENK-QRSLLGVIKATDFDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCT 2405
            A I I+ L  N +  +   T+   VI    P  Q+ LK+  +  D G+N        G+++ +  +D E         EI    +L  + N   E+T+        + HQN    + ++SI ++ VN  AP I+T   + V+   N  I     +    D D G NG  I R+E    N    F        +  YIE  Q     +++ +Y + ++A+D G+P +     V ++I   + N P FT  I+  E  + E +P    ++ LK  D D G N      +      +    F + P +G +    ++D +  K+ +   V   D A       S A V+I +QD+ND  P         ++     +I EN+   + + +++  DRDS     +   SY + N    P       E + F+  + +    D ET  K N E  IR +D        T   L+I++ D+NDN P+F +   +  + ++ P+GT     +FV+   D D+ +   + LS +   D  F +D  +  L       +  ++   LK+ A D      +   I+ VH+  +D+  +  I+      F   E    R L   +   + +N      + + S S FS         L  +  R  Q  H                           +P F N  + + I+ S   G  +  I A D D G NG + + +    Y + +F +D D G+L +   L   R       L+I   D G P + T
Sbjct:  167 ANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGIN--------GEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLI---YGIVRVNDKDTGINGN-IGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIY--EVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGD---EFRINPDSGMLYTAKQLDAEK-KSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIF-------ENVNKVISINENNLAGSFVVKLTAKDRDSGENSYI---SYSIANLNAVPF------EIDHFSGIVKTTSLLDFET-MKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGT----EVFVTSAIDFDAGDIISYRLS-DGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATD--GTHFSDDLIINVHLMPEDLGGDSSILHGF-GSFECRETGVARRLAETLSLAEKNN------VKSASPSVFSD--------LSLTPSRYGQNVH---------------------------RPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDY-DSVFRIDPDRGELQIIGYLD--RERQNEYVLNITVYDLGNPTKST 859          

HSP 18 Score: 62.3882 bits (150), Expect = 2.515e-9
Identity = 156/668 (23.35%), Postives = 299/668 (44.76%), Query Frame = 3
Query:  477 VQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNG-LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLD--NDKLNP-IIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVS-----DKDSNNNGKFTLSIESPGD-SFFTIDQQNQI--LKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQ-FYISENKQRSLLG----VIKATDFDNQT---IYYLIDNKSQSK-FSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIK--IDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYK--EPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQP 2393
            V  + I + DVNDN P++       + + + P G+     +A D+D   NG+V Y ++      F+L + +G L I+  Q ++   +N YE+ + A D      S+E  + V++ID   + P F       EKQ +  S    V  +  A+             +    S E +   +   TG + + +++DY+   +H +  +   D     Y   +E V+ + I D+ND +P I       +S   N TI EN+S  T I +I+  D DS    K+   SY+++  N + N  +  I   + N + + +   +++     +   ++   +   S+  N+ I + D+NDN P F + +Y   +      G       FV+     DKD ++       I    +   ++ID+   +  L++ + F  +  +V     L I   D   T+   + + +   N    + +PL +Q  Y ++  +  L G     +KA+D D  T   +YY I ++   K F I++ +G +  + + DRE+++ + + +  SD       AS  V VV V++N    + K    V+   ++A+++    I  + A D D  +NG V + I++KS+ K  + +  ++  +GD+       +   +++  F  + A D+G+P
Sbjct: 2123 VTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKSGELSIK--QHVEGHNRN-YELTVAAYDGAITPCSSEAPLQVKVID--RSMPVF-------EKQFYTVSVKEDV-EMYSALSVSIEAESPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSH-DVSIRATDSLSGVY---AEVVLSVSIMDVNDCYPEI-------ESDIYNLTIPENASFGTQILKINATDNDSGANAKL---SYYIESINGQNNSELFYIDVTDGNLY-LKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRG------QFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTV-----LNISVSDGVHTAYARLKISLLPEN----VYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQT----ILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAES-YGVNSYQFF-VRASDRGEP 2741          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332721)

HSP 1 Score: 188.348 bits (477), Expect = 7.640e-48
Identity = 210/750 (28.00%), Postives = 332/750 (44.27%), Query Frame = 3
Query:  345 SSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIE--DVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDN--GLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHS--TVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSL-LGVIKATDFD---NQTIYYLI-DNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASES--PGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF----LDIEACDQGQPNQC-TIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVLIAAI 2531
            S +G+L + + +DRE+    N ++ +      V          F     ++I+  D NDN P +       S  ENS          ATD D G NG + Y +ES   N   +F  +    +I     LDRE ++ Y   +IA DNG P    ++ VT++I+D NDN P F   I      VFEN+ PGTV++ L  +D D     E  F +    S + +  F +  +GE+ I   +D +     +   +I  D        +++A VEID++DIND  P     PR   S        E+ S  T + ++   D D +   + +      D+       +IG  E     + S    DRET  K        D  D +      + I + D+NDN P F+   Y   + E+  + T++  ++   DKD   N +   S+      +F I +   I++   + DRE +S+  L + A D G  +L S   V V+I D+NDNP   +       I EN      +  + AT  D   N  I+Y I     Q KF ++  +G L L  +LD E  + + +T+ A D      + +  V + ++D NDN P F  +  + +I+ +E    G KI  + ATD D   NGLV Y +++       F++D  +G + ++      RP+D  T     L+I+ACDQG P +C ++   + I   TN N P    S+      Y   L EN L+  +
Sbjct: 2807 SDSGELILQQTLDREQQESHNLIVVAETSTVPV----------FFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPI--EGLSVFENALPGTVLINLLLIDPDI-EKQEMDFFI---VSGDKQAQFQIGKSGELFIAKPLDREQ-LMFYNLSIIATDG-----KFTAKANVEIDVKDINDNTP-YCLKPRYHISTN------ESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADD------FSIG-KESGILKVAS--ALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLI-TKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTF--LQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGD-NIGQFSIDPKNGTISVS------RPLDRETISHYTLEIQACDQGDPQRCNSVPININI-LDTNDNAPIFSSSN------YSVVLQENRLLGYV 3501          

HSP 2 Score: 163.31 bits (412), Expect = 4.096e-40
Identity = 198/751 (26.36%), Postives = 341/751 (45.41%), Query Frame = 3
Query:  225 YRIKEETEIGYVIDYIKPNDQN-NLKIFNTNDNGVNC--FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLS-IIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM--ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDN--PPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGN-NGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIV---SNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMF---VSDKDSNNNGKFTLSIES-PGDSFFTIDQQNQILKSKVTFDRE-QVSVHKLKILAIDHGDERLTSSC----IVYVHIKDVNDNPVIITPLI-NQFYISEN-KQRSLLGVIKATDFDNQTIYYLIDNKSQ-SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQ 2399
            +R+ E   IG V+  +   D +  +    T    V C  F + ++TG L + + +DRE         K +N    +T K     +   + L  ++++DVNDNAP++   + I    E+ P G+  ++ EA D DIG N ++ + +  E++    FR+ +  G  I     LD E K V+ +I+ A D G P  ++++ + + IIDVN+N   P+F D ++  E +V EN P GT ++ + A D D  + N + T+ ++      +   F V   G +   S++D ++ K  +   +  QD A+ P  LS+   V I +++ ND  P         D       + E S     I  +   D D   +D     +Y + +  L     +G  E +    V   + RK DRE +++   E+  +D      S+   + + +LD+NDN PEF++  Y   +    P    ++  +F     D DS  NG+ T SI+S  G + F ID Q   +      D + +  +H   I A D+G  + + +     +V     +  + P+I+     N   ++EN K   L+  I A D DN  ++Y I N +  + F I + +G + L   LD E Q+++++T++ +D   TA T + V V+D NDN P F      + I  +      I ++ ATD D            +      LF +DS SG++ +   L   +       L +   DQG P +
Sbjct:  884 FRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDRE---------KQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGA-IRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVY--EGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGI---FAVNDQGSITSLSQLDAET-KNFYWLTLCAQDCAIVP--LSNCVEVYIQVENENDNIPLT-------DKPVYYVNVTEASVENVEIITLKAFDPD---IDPTQTITYNIVSGNL-----VGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQV----PSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIH---IKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKT--AQHILIVFVKDQGAPGK 1592          

HSP 3 Score: 152.14 bits (383), Expect = 1.211e-36
Identity = 176/662 (26.59%), Postives = 294/662 (44.41%), Query Frame = 3
Query:  126 LFFERLSIANMNSLLWWSIFALIDIEGLSSNKIYRIK--------EETEIGYVIDYIKPND---QNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLL------KSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEF-TFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPL---INQFYISENKQRSLLGVIKATDFD-----NQTIYYLIDNKSQSK--FSIEKHSGRLFLQNSLD 2021
            L F  LSI   +          ID++ ++ N  Y +K        E   IG  +  +K  D   Q+ L+ F  +  G + F +   +G L +   +DRE   P  +L+      K   Q+C   I +T             + D+NDN PI++  +  VS  E++ + +  +   A D D G N Q+ Y +  +  + F++ +  G+ I   + LDRE  +++ + + A+D G P   +   V V I+D+NDNPP+F  S+ +   ++ EN+  GT +  + A   D G N +   F MS N   E  K  +   TG++ + + +DY+  K +F   +   D    P  LS+ A V I I DIND  PT   + +N     +N  I   S  +    + +  D D  GL   + E    DN      I   + +P    I  +R  DRET S    EI+  D  D     +  + I ILD NDN P F+   Y   ++EN  +G +          ++ N   +T  I S  +      +Q+  L++   F+        +++   D+G   L S   V V I + +  P I+TPL   IN F   ++   + +G + A+D D     N ++    D+  QS   F+I  ++G+++  ++LD
Sbjct: 3033 LMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLR-FYLSGKGADDFSIGKESGILKVASALDRE-TTPKYKLVAHVQDGKDFTQECFSEIIIT-------------VNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGI-IRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEF--SMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGN---EQGKFKMDSTTGDLVLNATLDYEMSKFYF-LTIQAIDGGTPP--LSNNAYVNISILDINDNSPT---FLQNLYRINVNEDIFVGSKILDV--KATDEDSDVNGLVTYNIERG--DN------IGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSF--EDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLD 3655          

HSP 4 Score: 151.754 bits (382), Expect = 1.659e-36
Identity = 180/650 (27.69%), Postives = 297/650 (45.69%), Query Frame = 3
Query:  549 VSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPP--KFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF----------YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIIL--DVNDN--PPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNN---NGKFTLSIESP-GDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGVIKATDFD---NQTIYY-LIDNKSQSKFSIEKHSGRL-FLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDT-NTF-LDIEACDQGQPNQ 2399
            +S NE+  +G   +  EA D D+G NG++++ + +  Y + FR+  D G  ++    LDRE++N Y + I   D G+P KS    + + I+DVNDN P  + T + FR    + E++  GTV+  L A D D G N + T+ +S   S      F V   TG + +   +D +  + ++   +  +D    P  LSSEA+V + + D+ND  P               PR     T+   I      + P  +I    +     ++   E  F  +     I   G               D E +   N  +   D  D S   +++I+I+  DVN+N   PEF+   Y   +KEN+P GT +   M V+ +D +    N K T SI    G   F ++ Q  I  S    D E  + + L + A D     L++   VY+ +++ NDN P+   P+        + +   +  +KA D D    QTI Y ++       F I+  +G +   +  LDRE Q  H + V  SD+   + ++++ + V V+D NDN P F      +++ +S +    I ++ A D+D G NG + Y +K    K   F +DS  G +H+A      +P+D+ N F + I+A D G P +
Sbjct:  779 LSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRG-ELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFR----LTESARIGTVVHCLHATDADSGINAQVTYALSVECS-----DFTVNATTGCLRLNKPLDREK-QDNYALHITAKDGG-SPV-LSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPR----GTVLAVIEAVDEDIGPNAEIQFSLK-----EETQDEELFRIDKHTGAIRTQG-------------YLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFV---MNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSI-TSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNK-FRIDSQRGHIHIA------KPLDSDNEFEIHIKAEDNGIPKK 1382          

HSP 5 Score: 147.902 bits (372), Expect = 2.009e-35
Identity = 179/691 (25.90%), Postives = 311/691 (45.01%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREK-KNVYEIIIIAQDNGSPY-KSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGN---------NGEFTFRMSPNT-----SPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVV-------EIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTP--IGQ-------------ISVHDRDSKGLDKVHCESYFLD---NDKLNPIIAIGTNEP--------NEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFT--LSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATDFD---NQTIYYLIDNKSQSK--FSIEKHSGRLFLQNSLDREEQETHHITVTA---SDSLHTASXXXXXXXXDENDNK--PIFKNMNKVIKIDASESPGFKICKIVATDAD 2219
            F +   +G L+  +++D E+       + + +Q    + K +        ++ I ++D+NDN PI+     ++S NEN+  GS      A D D G N  + Y + +     F +   +G+ ++ T +LD E  K  YE+II A D G PY +  E+++++ + D+NDN P+F         +V +++P GT + +  A+D D G+         N +  F + P +     S +++K  L     +V         +D THF   +I+  H + P  L  ++ +       E     +              +  + +P++  + S +TP   GQ             +S+++    G      E+   D   N KL   I+ G  +          E  I+     +R+ E  LN  +        ST K L I ILDVNDN P   K    F + E+  IGT++ + +  +D DS  N + T  LS+E    S FT++     L+     DRE+   + L I A D G   L+S  +VYV + DVNDN  +       F + E+  R ++L VI+A D D   N  I + +  ++Q +  F I+KH+G +  Q  LD E ++ H++ V+A    D   T+  ++ ++++D N+N+  P F +     K+  ++  G  +  + A D D
Sbjct:  448 FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSA------KVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGI-VKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFER--VNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSA-------TDGTHFSDDLIINVHLM-PEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLS-LTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVV-HCLHATDADSGINAQVTYALSVEC---SDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMD 1116          

HSP 6 Score: 142.51 bits (358), Expect = 1.160e-33
Identity = 183/694 (26.37%), Postives = 305/694 (43.95%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPNDQ----NNLKIFNTNDNGVN-CFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTI-KLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFT--DSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPE----VEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS--DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIK----ENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILK-SKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYI--SENKQRSLLGV--IKATDFDNQTIYYLI-DNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITV------TASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADH 2222
            I E  ++G  + +I+  D+    N   +F  +D   +  F ++   G+L I   +DRE         + N     +T+  L +   +  + L I I DVNDN P+     A     E++ IG+      ATD D G N QV Y +  +  + F +    G    N + LDREK++ Y + I A+D GSP  S+E  V V + DVNDN P F   + IF+    V E+ P GTV+ +++AVD D G N E  F +   T  E    ++KH     TG +  +  +DY++ + H    +IV        SL+S+  + I I D+N+      F P   D       + EN    T +  ++  D D+  L+     S     D L  I A+     ++ +I S  + D ET++     +   D +    S    + I + + NDN P  +K  Y+  +     EN  I T+   + F  D D      + + +      +F ID +  ++K ++   DRE  + H L++   D+G   L+S+  + V + D+NDN       + +  +  S    +S+  V  I +   +N  I Y I   K ++KF I+   G + +   LD + +   HI          S +       V V    +N    + K    V+ +  ++ PGF + +I+A D D+
Sbjct:  781 INESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRE---------RQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSD-FTVNATTGCLRLN-KPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFK----VREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKH-----TGAIRTQGYLDYENKQVH---NLIVSAIDGGDPSLTSDMSIVIMIIDVNEN----RFAPEF-DDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYS-ITGGDGLG-IFAVN----DQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITL---KAFDPDIDPTQTITYNI-VSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDN 1436          

HSP 7 Score: 132.88 bits (333), Expect = 9.109e-31
Identity = 137/546 (25.09%), Postives = 240/546 (43.96%), Query Frame = 3
Query:  714 MLDREKKNVYEIIIIAQ-----DNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRN-PDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDT-SDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDS----FFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSG 2303
            + DRE K++Y + + A+        S  +     + + ++DVNDN P F +  +     +  + P GT+I+ +KA+D D   NGE  + +        E   L R +GE+ IK  ++      ++E  V   D A+ P   SSEA +++ + D +       FY  +  +   M   +  +    +P+G+  ++   S+       +S+ +D               N  +I    + D E  S  +  IR TD+ S       L++ I+DVND  PE     Y+  I EN   GT +  ++  +D DS  N K +  IES         F ID  +  L  K   D EQ+  H + +   DHG   L+S   V++ +KD+NDN P  + P           +   + + KA D D    +   Y ++       +SI+K +G + LQN L+  ++ +  + ++ SD +HTA   + + ++ EN   P+F       ++  +   G  I  + A+D D G    + Y +     K+ +F +D  +G
Sbjct: 2092 IFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSI--DDPKGTIIMQVKAIDLDSAENGEVRYELKKGNG---ELFKLDRKSGELSIKQHVE--GHNRNYELTVAAYDGAITP--CSSEAPLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSES------QSFEIDY--------------NTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQI-LKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKK-IFLIDQTTG 2606          

HSP 8 Score: 122.479 bits (306), Expect = 1.394e-27
Identity = 171/685 (24.96%), Postives = 300/685 (43.80%), Query Frame = 3
Query:  327 NCFELESSTGKLFITRRIDREEICPTN-RLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPP--GTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS--DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK---FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ---RSLLGVIKATDFD---NQTIYYLIDNKSQ-SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA 2318
            N F+++  +G + +   +DRE     N +++ ++N   +   K+          ++I I D NDNAP++      +S  EN+  G+        D DI       + +    +  F++ +   L+I   + LDRE+   Y + IIA D     K+N   V +++ D+NDN P       +P   +  N     GT ++ +KA+D DF    +  F +S   + +     + + +G +++ S +D +   T  ++K++      + ++    + + I + DIND  P  +        A    ++ E++   T I ++   D+D  G+++    S   +N    K++    I         I  ++  DRET S  N  ++  D       ++  + + ILD+NDNPPEF+   Y   I EN   GT +  +++ +  D   N     F +S    G   F +D     L    T D E    + L I AID G   L+++  V + I D+NDN    T L N + I+ N+     S +  +KATD D   N  + Y I+      +FSI+  +G + +   LDRE    + + + A D        S  + + ++D NDN PIF + N  + +  +   G+       +DAD   N        +S  +  LF L+ D G L  A
Sbjct: 2908 NIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVP---------VTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELFI--AKPLDREQLMFYNLSIIATDGKFTAKAN---VEIDVKDINDNTPY----CLKPRYHISTNESISIGTTLVEVKAIDFDF--QSKLRFYLSGKGADDFS---IGKESGILKVASALDRE---TTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSM-------AQYRVSVPEDAQLNTLITKVHAMDKDF-GVNRQIKYSLMGENHDYFKISKSTGI---------IRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEV-CKVYATSIDIGVNADIHYFIMSGNEQGK--FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSP--TFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQD-GSLRTA 3543          

HSP 9 Score: 119.783 bits (299), Expect = 9.377e-27
Identity = 157/650 (24.15%), Postives = 281/650 (43.23%), Query Frame = 3
Query:  210 SSNKIYRIKEETEIGYVIDYIKPNDQNNLKIFN--TNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNS----FRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPT-GEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHC---ESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDN---------RMFVSDKDSNNNGKFTLSI-ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN---PVIITPLINQFYISENKQRSLLGVIKATDFDNQTIYY-LIDNKSQSKFSIEKHSGRLFLQN--SLDREEQETHHITVTASDSLHTA 2081
            +S  +  + E  + G+++  I   D +N +++   +N N  N F +    G + +++ +D E             Q   +TI +T         L + + D+NDN P +  D   V+ +EN    S      ATD D   + ++ Y + +    S    FR+   +G  I  TQ LD EK   + +I+  +D G+P K N  ++ V + D ND+ P+FT  I   + +V E++  G+ +  ++A+D D G+N E  + +    +  V   F + PT G + +   ++ +  +  +  +V   D    P  LSS+  V I +    ++ P    +P N     +   I EN    T + Q++     S   + +     ES+     ++NP   +         IV N   D E+    N  ++ T+ +  S+ +N+ I ILD NDN P F +  Y   + E+  IG+ +            + V D D   NG     I +    +FF ID     ++     D E  + +   +   D G  +L S+   +V I+ +N N   PV     +N        +   +  + A D DN T+ + ++D  +   F IEK++G +  +N   L+ E    + + V ASD + +A
Sbjct: 1409 TSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYE-----------TQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRD--EDKKLFYHLHATQDPSSLALFRIDSISGNVIV-TQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKII--QSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSI---ITGNVGSVFEIDPTFGIITLAGNLNINKIQ-EYMLQVKAVDLGNPP--LSSQIPVHIIVTMSENDPPK---FPTN----NIAIEIFENLPIGTFVTQVTARSSSSIFFNIISGNINESF-----RINPSTGV---------IVINGNIDYESIKVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASDGIFSA 2015          

HSP 10 Score: 119.398 bits (298), Expect = 1.219e-26
Identity = 181/711 (25.46%), Postives = 319/711 (44.87%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMES-KYRNSFRLF----QDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKEN-EPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQ-----ILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFDN-QTIYYLIDNKSQSKFSI---EKH-----SGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYK-EPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQP 2393
            FE++ +TG +F+   +D E+I   +  +++ +    V  ++          LS+ I DVND  P   +D   ++  EN+  G++     ATD D G+N ++ Y +ES   +N+  LF     D  LY++    LD E+   + I++  +D+GSP  S+   V + + D+NDN P F +  +  +  V   +  G  + L KA D D  +     +++      E++ + + + TG + +++ +++ +DK+     + V D     Y     A ++I +       P   + P   D +T    + EN      I  +   D D      ++   Y + ++++  I  I   +     I S   FDRE + +    ++ +D        +L +I++DVNDN P F    Y   +    E   T+L  +    D   N +  F +  +S   +   + + N+     + KSK   +   V+ ++  + A D G+ +  S   V + I + + N       I  F     K   LL +I++T      T  ++I N +  KFSI   + H     SG L LQ +LDRE+QE+H++ V A  S   +  A   V + V DENDN P F N      +  +      + K+ ATDAD G NG ++Y L+  +   + +F++D  SG + L  SL   R + +     + A D G P
Sbjct: 2285 FEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVV---------LSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTP--LDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSV--AAVRGQFVALPKAYDKDISDTDSLEYKIVYGN--ELQTYSIDKLTGVISLQNMLNF-TDKSSTVLNISVSDGVHTAY-----ARLKISL------LPENVYSPLF-DQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLY---YEIVSEEMKKIFLI---DQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKA--ESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDAN-------IPTF----EKSSVLLKIIESTPPGTVLTKLHMIGNYT-FKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLD--REVQSEYNFKVIAADNGHP 2945          

HSP 11 Score: 105.916 bits (263), Expect = 1.415e-22
Identity = 188/737 (25.51%), Postives = 309/737 (41.93%), Query Frame = 3
Query:  243 TEIGYVIDYIKPNDQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQR--LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGL--YIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMT---------PIGQISVHDRDSKGLDKVHCESYFLDNDK-LNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD---HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFY---ISENKQRSL-LGVIKATDFD---NQTIYYLIDNKS---QSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHT---ASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFL 2363
             ++ Y I+ I  N QNN ++F           ++ + G L++   +D E+I               V +K  H + +   R  + I ++D+NDNAP +         +  +  G   +LP+A D DI     + Y++   Y N  + +  + L   I    ML+   K+   ++ I+  +G       L+++  ++  N   P F  S +  E QV EN   G  I+ +KA D DFG      + +    S E++K FL+  T  V I SK+ +D +K                     E VV + + D   +F   +      D     P  L     M           I  +   D D      VH +     NDK +  +I I  NE    +IV   K +    +     +R +D  +   HS V  ++I I++ + N P F K +    I E+ P GT+L     +       N  F  SI +  D F   D    IL+   T DREQ   H L ++A         +   V + ++D NDN        N FY   ++EN ++ + L  + ATD D   N  I Y +++ +   Q+ F I+ +SG + L  SLDRE Q  ++  V A+D+ H    A   VT+ +VD NDN P+FK   + + +  +  PG  +  ++  D D     +  +I+  S  K+  F +   SG+L +A      +P+D    +
Sbjct: 2374 AKLSYYIESI--NGQNNSELF----------YIDVTDGNLYLKTPLDYEQI---------KYHHIVVNVK-DHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKI--VYGNELQTYSIDKLTGVISLQNMLNFTDKS-STVLNISVSDGVHTAYARLKIS--LLPENVYSPLFDQSTY--EAQVPENLLHGHNIITVKASDGDFGTYANLYYEI---VSEEMKKIFLIDQTTGV-ITSKVTFDREK-------------------KDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEI--NEKTG-DIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVP-VSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIG------NYTFKFSIAADQDHFMISDSGELILQQ--TLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDN---YPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIV--SGDKQAQFQI-GKSGELFIA------KPLDREQLM 3034          

HSP 12 Score: 102.834 bits (255), Expect = 1.286e-21
Identity = 137/547 (25.05%), Postives = 235/547 (42.96%), Query Frame = 3
Query:  492 IIIEDVNDNAPIWTTDKAI--VSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESK-YRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTM---TPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEF-------NIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTL-SIESPGD-SFFTID--QQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFDN----QTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            I +E+ NDN P+  TDK +  V+  E S         +A D DI     + Y + S      F +    G+     + LDRE +  + + +   DNGSP  S+  ++ V ++D+NDN P+F   +++   QV  ++     I  + A+D D G NG  T+ +                      K+K   DS + H         H  +P  L S+   EI I+  ++  P  +   R            +N+  +   T    + + + D  G       +   DND+L   I+ G N+ N F       NI+ ++  D ET+   N  I  TD +  +   NL + ++D+NDNPP+F K  YH  I EN    +++  ++  +D+D +    + L + + P   + F ID    N I+  ++ F  E+ + H L +   D G     +   + V++ D ND+    T  I Q  + E+    S L  ++A D D+    +  Y +I     S F I+   G + L  +L+  + + + + V A D
Sbjct: 1181 IQVENENDNIPL--TDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYK--VQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKG-----------------KNKFRIDSQRGHI--------HIAKP--LDSDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNG-NDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGT-FTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVI-MQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDF--EKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVD 1691          

HSP 13 Score: 97.8265 bits (242), Expect = 4.078e-20
Identity = 159/635 (25.04%), Postives = 273/635 (42.99%), Query Frame = 3
Query:  483 RLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGT-VILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV--RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNE---PNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDV---NDNPPEFNKGTYHFYIKEN-EPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD---SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKAT------DFDNQTI-YYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
            RL I +   N  +P++          EN   G      +A+D D G+   + Y + S+      L       I +    DREKK+ Y +++   D G  +    L+V V   DVNDN P F   + +  K V   +      IL +KA D D  +NG   F++   ++ +  K  +     TG++  KSK +       ++F V   D   EP    SE  V I+I + +   PT        + +++   I+E+    TP G +         L K+H     + N      IA   +     +   ++  +  DRE +   N  I   +TS          +++DV   NDN P+F+   Y   + EN E + +++  ++  +D D+  NG     +ES  +   + F ID  +  +    + DRE  S +  K++A D+G  +  +   V + I D NDN  +    I    + EN   +L G +         D + Q + ++++    Q++F I K SG LF+   LDRE+   +++++ A+D   TA   V + V D NDN P        I  + S S G  + ++ A D D  +   +++ L      +  F++  +SG L +A +L
Sbjct: 2536 RLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVV--DVNDNVPYF---LLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAE-SYGVNSYQFFVRASDRG-EP-QFHSEVPVSIEIIETDANIPTF-------EKSSVLLKIIES----TPPGTV---------LTKLH----MIGNYTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNL-IVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLV--KVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFEN---ALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGK-SGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSK--LRFYLSGKGADD--FSIGKESGILKVASAL 3127          

HSP 14 Score: 97.8265 bits (242), Expect = 5.211e-20
Identity = 173/724 (23.90%), Postives = 309/724 (42.68%), Query Frame = 3
Query:  318 NGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQCEVTIKLTHQN-----INFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMES-KYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDV---NDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDS-KGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDV---NDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPG-DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIK-DVNDNPVIITPLINQFYISENKQRSLLGVIKATDFDNQTIYY-LIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD-SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKI----------VATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNT----FLDIEACDQGQP 2393
            N V  FE++S TG +  T R++DRE              Q E  +++   +     ++   R+ + + D+NDN+P +      V    ++ +        A D D G NG++ Y ++S K +N FR+    G +I   + LD +  N +EI I A+DNG P KS   +V + ++ V   + N P            + EN  PG ++  + AVD D   N +  + +S          ++ +  G + +   +DY++ ++ +   + V D     ++      + + + DIND  P  A      D   +N  I EN    + I Q+   DRD  K L       Y L   +    +A+   +    N++  ++ D E  ++    +   D       +N   II++V   ND+ PEF        + E+  IG+ L     + D+DS +N +   SI +    S F ID    I+      +  ++  + L++ A+D G+  L+S   V++ +    ND P   T  I    I EN       V + T   + +I++ +I       F I   +G + +  ++D E  +  ++TV  ++ +  ++   + + ++D NDN P F     V  +  S + G  + K+             DAD G NG+V+Y +     K   F +DS +G + L      +R +D  T      D+   D G+P
Sbjct: 1236 NLVGYFEIDSKTGVIKTTERKLDRE-------------NQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRG-HIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNT--FYIGQDNGNILLSKYLDYETQQS-YNLTISVTDGTFTAFT-----NLLVQVIDINDNPPQFA-----KDVYHVN--ISENIEEESVIMQLHATDRDEDKKL------FYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGK-RNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAI-DRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNI-AIEIFENLPIGTF-VTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKN-FFKIDSTTGAIEL------LRQLDYETNAGYTFDVTVSDMGKP 1908          

HSP 15 Score: 92.4337 bits (228), Expect = 2.162e-18
Identity = 163/654 (24.92%), Postives = 281/654 (42.97%), Query Frame = 3
Query:  486 LSIIIEDVNDN--APIWTTDKAIVSFNENSPIGSRRSLPEATDID-IGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEI-KSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEI-DIQDINDEFPTIAFYPRNPDSATMNPTILEN---SSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD-NQTIYYLI----DNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTAS---XXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQP 2393
            + I+I DVN+N  AP +          EN P G+      A D+D +  N ++ Y +            D G  I +   LD E KN Y + + AQD      SN ++V +++ + NDN P     ++     V E S     I+ LKA D D       T+ +    S  +  +F +   TG ++  + K+D ++   H   +V + D+     S +S  VV + DI D + EF    +  + P SAT+N +I +     S     G+I+   +  KG +K     + +D+ + +  IA   +  NEF I    + +   +    A +       +   +N  +I+   ++N  +         + EN+  G ++   + V D   N+   + +S  +  ++F+       IL SK   D E    + L I   D      T+   + V + D+NDNP      +    ISEN ++ S++  + ATD D ++ ++Y +    D  S + F I+  SG + +   LD E+   H + V   D           + V V D ND+ P F       K+  S + G K+ ++ A D D G+N  ++Y +   +    +F +D   G + LA +L+ I  I     L ++A D G P
Sbjct: 1072 IVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQG-SITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYY--VNVTEASVENVEIITLKAFDPDIDPTQTITYNI---VSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHI-LEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNK-----FRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVD---------LTENDKPGFLVTQILAVDD--DNDQLWYNISNGNDDNTFYIGQDNGNILLSKY-LDYETQQSYNLTISVTDG---TFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGS-VFEIDPTFGIITLAGNLN-INKIQ-EYMLQVKAVDLGNP 1695          

HSP 16 Score: 73.1738 bits (178), Expect = 1.361e-12
Identity = 79/270 (29.26%), Postives = 122/270 (45.19%), Query Frame = 3
Query: 1614 DSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGV-IKATDFD---NQTIYY-LIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD-----SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQP 2393
            D N +G F L      D ++   + NQ          +Q  ++ L +LA D G  R  +   V + IK  + N  I T  I +  I E    ++  + +K +D D   N  +Y  ++      +F I   SG L+    LD E++ ++ +TV+A D     S   +S  V + V D NDN PIF+N+NKVI I+ +   G  + K+ A D D G N  + Y +  ++     F +D  SG +    SL     +  N  L I A D G P
Sbjct:  331 DGNPDGTFLLKAAETKDEYYI--ELNQFAHLN-----QQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSI--ANLNAVPFEIDHFSGIVK-TTSLLDFETMKRNYELIIRASDWGLP 590          

HSP 17 Score: 73.1738 bits (178), Expect = 1.625e-12
Identity = 183/780 (23.46%), Postives = 310/780 (39.74%), Query Frame = 3
Query:  186 ALIDIEGLSSNKIYRIKEETEIGYVIDYIKPNDQNNLKI-FNTNDNGVNCFELESSTGKLFITRRIDRE---------EICPTNRLLKSNNQQCEVTIK-------LTHQNINFVQ-RLSIIIEDVNDNAP-IWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLF------QDNGLYIENTQMLDREKKN-VYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFN--IVSNRKFDRETESKLNAE--IRCTDTS---DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVS---DKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHI--KDVNDNPVIITPLINQFYISENK-QRSLLGVIKATDFDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCT 2405
            A I I+ L  N +  +   T+   VI    P  Q+ LK+  +  D G+N        G+++ +  +D E         EI    +L  + N   E+T+        + HQN    + ++SI ++ VN  AP I+T   + V+   N  I     +    D D G NG  I R+E    N    F        +  YIE  Q     +++ +Y + ++A+D G+P +     V ++I   + N P FT  I+  E  + E +P    ++ LK  D D G N      +      +    F + P +G +    ++D +  K+ +   V   D A       S A V+I +QD+ND  P         ++     +I EN+   + + +++  DRDS     +   SY + N    P       E + F+  + +    D ET  K N E  IR +D        T   L+I++ D+NDN P+F +   +  + ++ P+GT     +FV+   D D+ +   + LS +   D  F +D  +  L       +  ++   LK+ A D      +   I+ VH+  +D+  +  I+      F   E    R L   +   + +N      + + S S FS         L  +  R  Q  H                           +P F N  + + I+ S   G  +  I A D D G NG + + +    Y + +F +D D G+L +   L   R       L+I   D G P + T
Sbjct:  167 ANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGIN--------GEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLI---YGIVRVNDKDTGINGN-IGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIY--EVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGD---EFRINPDSGMLYTAKQLDAEK-KSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIF-------ENVNKVISINENNLAGSFVVKLTAKDRDSGENSYI---SYSIANLNAVPF------EIDHFSGIVKTTSLLDFET-MKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGT----EVFVTSAIDFDAGDIISYRLS-DGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATD--GTHFSDDLIINVHLMPEDLGGDSSILHGF-GSFECRETGVARRLAETLSLAEKNN------VKSASPSVFSD--------LSLTPSRYGQNVH---------------------------RPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDY-DSVFRIDPDRGELQIIGYLD--RERQNEYVLNITVYDLGNPTKST 859          

HSP 18 Score: 62.3882 bits (150), Expect = 2.515e-9
Identity = 156/668 (23.35%), Postives = 299/668 (44.76%), Query Frame = 3
Query:  477 VQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNG-LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLD--NDKLNP-IIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVS-----DKDSNNNGKFTLSIESPGD-SFFTIDQQNQI--LKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQ-FYISENKQRSLLG----VIKATDFDNQT---IYYLIDNKSQSK-FSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIK--IDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYK--EPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQP 2393
            V  + I + DVNDN P++       + + + P G+     +A D+D   NG+V Y ++      F+L + +G L I+  Q ++   +N YE+ + A D      S+E  + V++ID   + P F       EKQ +  S    V  +  A+             +    S E +   +   TG + + +++DY+   +H +  +   D     Y   +E V+ + I D+ND +P I       +S   N TI EN+S  T I +I+  D DS    K+   SY+++  N + N  +  I   + N + + +   +++     +   ++   +   S+  N+ I + D+NDN P F + +Y   +      G       FV+     DKD ++       I    +   ++ID+   +  L++ + F  +  +V     L I   D   T+   + + +   N    + +PL +Q  Y ++  +  L G     +KA+D D  T   +YY I ++   K F I++ +G +  + + DRE+++ + + +  SD       AS  V VV V++N    + K    V+   ++A+++    I  + A D D  +NG V + I++KS+ K  + +  ++  +GD+       +   +++  F  + A D+G+P
Sbjct: 2123 VTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKSGELSIK--QHVEGHNRN-YELTVAAYDGAITPCSSEAPLQVKVID--RSMPVF-------EKQFYTVSVKEDV-EMYSALSVSIEAESPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSH-DVSIRATDSLSGVY---AEVVLSVSIMDVNDCYPEI-------ESDIYNLTIPENASFGTQILKINATDNDSGANAKL---SYYIESINGQNNSELFYIDVTDGNLY-LKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRG------QFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTV-----LNISVSDGVHTAYARLKISLLPEN----VYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQT----ILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAES-YGVNSYQFF-VRASDRGEP 2741          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh1gc6 (protocadherin 1 gamma c 6 [Source:ZFIN;Acc:ZDB-GENE-041118-17])

HSP 1 Score: 243.817 bits (621), Expect = 4.268e-67
Identity = 197/671 (29.36%), Postives = 332/671 (49.48%), Query Frame = 3
Query:  165 LLWWSIFALIDIEGLSSNKIYRIKEETEIGYVIDYIKPN------DQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESK--YRNSFRLFQDNGLYIENT--QMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPT-ILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIG---TNEP---NEFNIVSNRKFDRETESKLNAEIRCTDTSDHS--TVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI------ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISEN------KQRSLLGVIKATDFD---NQTIYY-LIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            L+W ++ AL           Y I EE + G V+  I  +      D  N  +   ++N    F + S  G+L +  RIDRE +CP        +  C V +++  +N   + R+ I I+D+NDNAPI+ T + ++   E+  +G R  L  A D+D+G N    Y + +   +R + +   D     E    + LDREKK+ +++I+ A D G P K+    + + ++D NDN PKF   +++    + E +P G+ ++ +KA D D G+NGE  + +  +T   V K F ++P TGE+ +   IDY+S+K  + F V  +D    P  L   + V+IDI D ND  P I          T +P+ + EN+S  T +  I+V D DS G+           N +++  I+ G   T +P   N +++V++   DRE  ++ N  +  TD+   S  T K + + +LDVNDNPP F++ +Y+ Y++EN   G  L + +  +D D + N   T SI      + P  S+F I+ +N  + S  +FD E++ +  + + A D G   L+S+  V+V I D NDN P +I P  +   +S        K   L+  + A D D   N  ++Y L +    S FS+  H+G +  + ++   +  +  + +   D
Sbjct:   28 LMWSTVGALTR---------YTIPEELQEGSVVGNIAKDLGFVVSDIANRNLRVVSENSGQYFSVGSERGELVVNSRIDRESLCP-------QSASCVVPLQVIIENPLQLHRVEIEIQDINDNAPIFQTSEGVLEIAESITLGDRFPLESAEDLDVGKNSLKSYVLSNDECFRLNVKTLADGRKVPELVIDKPLDREKKSAHKLILTAVDGGDPAKTGTTVIQINVLDSNDNAPKFDLPMYK--SSLREAAPVGSTVITIKATDLDEGDNGELQYFLGVHTPEPVRKMFALKPDTGEIIVLGNIDYESNKL-YRFDVSAKDKG-NP-ELVGHSSVQIDIIDENDNPPEIIL--------TSSPSPVPENASVGTVVALINVKDLDS-GV-----------NGRVSINISPGFPFTLKPSFENHYSLVTDSSLDREIYAEYNILLVATDSGVPSLKTEKTINVKVLDVNDNPPSFSQTSYNVYVQENNLAGVSLFS-VSATDNDQDKNALLTYSILDLGSNQVPASSYFYINSENGTIYSMSSFDYEKMKLISIVVQAKDQGSPSLSSNATVHVFILDRNDNAPAVIYPSTSMGSVSHQRMPRSAKAGHLVTKVTAVDADSGHNAWLFYRLAEATDASLFSVNLHTGEVRTKRAVSEHDDSSQRLVLEIKD 656          

HSP 2 Score: 105.916 bits (263), Expect = 1.002e-22
Identity = 163/629 (25.91%), Postives = 277/629 (44.04%), Query Frame = 3
Query:  798 QVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV--RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD-----HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTID---QQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGV----IKATDFDNQT----IYYLIDNKS-----QSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIF----KNMNKVI--KIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHL--AVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIAFIVF 2582
            +V +EI D+NDN P F  S      ++ E+   G    L  A D D G N   ++ +S +    +    L   R   E+ I   +D +    H   K+I+        + +   V++I++ D ND  P         D      ++ E +   + +  I   D D     ++    YFL      P+  +   +P+   I+     D E+      ++   D  +     HS+V+   I I+D NDNPPE    +    + EN  +GT++   + V D DS  NG+ +++I SPG  F T+    + +  L +  + DRE  + + + ++A D G   L +   + V + DVNDNP   +      Y+ EN   +L GV    + ATD D        Y ++D  S      S F I   +G ++  +S D E+ +   I V A D      +++ TV V ++D NDN P       +M  V   ++  S   G  + K+ A DAD G+N  + Y L +++    LF+++  +G++    AVS H     D++  L +E  D G+P Q T  + ++I      +EP S   +K+ + S  +   +  L   IS   V ++ +M  FI+ 
Sbjct:  124 RVEIEIQDINDNAPIFQTS--EGVLEIAESITLGDRFPLESAEDLDVGKNSLKSYVLSNDECFRLNVKTLADGRKVPELVIDKPLDREKKSAH---KLILTAVDGGDPAKTGTTVIQINVLDSNDNAPKF-------DLPMYKSSLREAAPVGSTVITIKATDLDEGDNGELQ---YFLGVHTPEPVRKMFALKPDTGEIIVLGNIDYESNKLYRFDVSAKDKGNPELVGHSSVQ---IDIIDENDNPPEIILTSSPSPVPENASVGTVV-ALINVKDLDSGVNGRVSINI-SPGFPF-TLKPSFENHYSLVTDSSLDREIYAEYNILLVATDSGVPSLKTEKTINVKVLDVNDNPPSFSQTSYNVYVQEN---NLAGVSLFSVSATDNDQDKNALLTYSILDLGSNQVPASSYFYINSENGTIYSMSSFDYEKMKLISIVVQAKDQGSPSLSSNATVHVFILDRNDNAPAVIYPSTSMGSVSHQRMPRSAKAGHLVTKVTAVDADSGHNAWLFYRLAEAT-DASLFSVNLHTGEVRTKRAVSEHD----DSSQRLVLEIKDNGEPIQSTTVT-VDILIEDGFHEPISDYREKTIEPS--KKTGKITLYLIISLASVSLLCLMTFFILL 720          

HSP 3 Score: 87.8113 bits (216), Expect = 3.856e-17
Identity = 129/486 (26.54%), Postives = 211/486 (43.42%), Query Frame = 3
Query: 1020 GEVEIKSKIDYDSDKTHFEFKVIVQDHAVE-PYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLN-PIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIII--LDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNG--KFTLSIESPGD--SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFDNQTIYYLIDNKSQS-----KFSIEKHSGRLFLQNSLDREEQETHHITVTASDS----LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPL---FNLDSDSGDLHLAVSL--HTIRPIDTNTFLDIEACDQGQPN 2396
            GE+ + S+ID +S        V+     +E P  L     VEI+IQDIND  P              +  +LE + ++T   +  +   +   + K   +SY L ND   +LN   +A G   P    +V ++  DRE +S     +   D  D +      I I  LD NDN P+F+   Y   ++E  P+G+ +   +  +D D  +NG  ++ L + +P      F +      +      D E   +++  + A D G+  L     V + I D NDNP  I    +   + EN    +++ +I   D D+     +  N S       K S E H   L   +SLDRE    ++I + A+DS    L T   T+ V V+D NDN P F   +  + +  +   G  +  + ATD D   N L+ Y IL   S + P    F ++S++G ++   S     ++ I     + ++A DQG P+
Sbjct:   88 GELVVNSRIDRESLCPQSASCVVPLQVIIENPLQLHR---VEIEIQDINDNAPIFQ----------TSEGVLEIAESITLGDRFPLESAEDLDVGKNSLKSYVLSNDECFRLNVKTLADGRKVPE---LVIDKPLDREKKSAHKLILTAVDGGDPAKTGTTVIQINVLDSNDNAPKFDLPMYKSSLREAAPVGSTVIT-IKATDLDEGDNGELQYFLGVHTPEPVRKMFALKPDTGEIIVLGNIDYESNKLYRFDVSAKDKGNPELVGHSSVQIDIIDENDNPPEIILTSSPSPVPENASVGTVVALINVKDLDSGVNGRVSINISPGFPFTLKPSFENHYS-LVTDSSLDREIYAEYNILLVATDSGVPSLKT-EKTINVKVLDVNDNPPSFSQTSYNVYVQENNLAGVSLFSVSATDNDQDKNALLTYSILDLGSNQVPASSYFYINSENGTIYSMSSFDYEKMKLIS----IVVQAKDQGSPS 550          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh1g26 (protocadherin 1 gamma 26 [Source:ZFIN;Acc:ZDB-GENE-050609-21])

HSP 1 Score: 244.202 bits (622), Expect = 1.101e-66
Identity = 195/667 (29.24%), Postives = 327/667 (49.03%), Query Frame = 3
Query:  165 LLWWSIFALIDIEGLSSNKIYRIKEETEIGYVIDYIKPN------DQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESK--YRNSFRLFQDNGLYIENT--QMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPT-ILENSSTMTPIGQISVHDRDSK--GLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHS--TVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI------ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISEN------KQRSLLGVIKATDFD---NQTIYY-LIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            L+W ++ AL           Y I EE + G V+  I  +      D  N  +   ++N    F + S  G+L +  RIDRE +CP        +  C V +++  +N   + R+ I I+D+NDNAPI+ T + ++   E+  +G R  L  A D+D+G N    Y + +   +R + +   D     E    + LDREKK+ +++I+ A D G P K+    + + ++D NDN PKF   +++    + E +P G+ ++ +KA D D G+NGE  + +  +T   V K F ++P TGE+ +   IDY+S+K  + F V  +D    P  L   + V+IDI D ND  P I          T +P+ + EN+S  T +  I+V D DS   G   ++    F       P     + E N +++V++   DRE  ++ N  +  TD+   S  T K + + +LDVNDNPP F++ +Y+ Y++EN   G  L + +  +D D + N   T SI      + P  S+F I+ +N  + S  +FD E++ +  + + A D G   L+S+  V+V I D NDN P +I P  +   +S        K   L+  + A D D   N  ++Y L +    S FS+  H+G +  + ++   +  +  + +   D
Sbjct:   28 LMWSTVGALTR---------YTIPEELQEGSVVGNIAKDLGFVVSDIANRNLRVVSENSGQYFSVGSERGELVVNSRIDRESLCP-------QSASCVVPLQVIIENPLQLHRVEIEIQDINDNAPIFQTSEGVLEIAESITLGDRFPLESAEDLDVGKNSLKSYVLSNDECFRLNVKTLADGRKVPELVIDKPLDREKKSAHKLILTAVDGGDPAKTGTTVIQINVLDSNDNAPKFDLPMYK--SSLREAAPVGSTVITIKATDLDEGDNGELQYFLGVHTPEPVRKMFALKPDTGEIIVLGNIDYESNKL-YRFDVSAKDKG-NP-ELVGHSSVQIDIIDENDNPPEIIL--------TSSPSPVPENASVGTVVALINVKDLDSGVNGRVSINISPGF-------PFTLKPSFE-NHYSLVTDSSLDREIYAEYNILLVATDSGVPSLKTEKTINVKVLDVNDNPPSFSQTSYNVYVQENNLAGVSLFS-VSATDNDQDKNALLTYSILDLGSNQVPASSYFYINSENGTIYSMSSFDYEKMKLISIVVQAKDQGSPSLSSNATVHVFILDRNDNAPAVIYPSTSMGSVSHQRMPRSAKAGHLVTKVTAVDADSGHNAWLFYRLAEATDASLFSVNLHTGEVRTKRAVSEHDDSSQRLVLEIKD 656          

HSP 2 Score: 105.916 bits (263), Expect = 1.167e-22
Identity = 163/629 (25.91%), Postives = 277/629 (44.04%), Query Frame = 3
Query:  798 QVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV--RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD-----HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTID---QQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGV----IKATDFDNQT----IYYLIDNKS-----QSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIF----KNMNKVI--KIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHL--AVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIAFIVF 2582
            +V +EI D+NDN P F  S      ++ E+   G    L  A D D G N   ++ +S +    +    L   R   E+ I   +D +    H   K+I+        + +   V++I++ D ND  P         D      ++ E +   + +  I   D D     ++    YFL      P+  +   +P+   I+     D E+      ++   D  +     HS+V+   I I+D NDNPPE    +    + EN  +GT++   + V D DS  NG+ +++I SPG  F T+    + +  L +  + DRE  + + + ++A D G   L +   + V + DVNDNP   +      Y+ EN   +L GV    + ATD D        Y ++D  S      S F I   +G ++  +S D E+ +   I V A D      +++ TV V ++D NDN P       +M  V   ++  S   G  + K+ A DAD G+N  + Y L +++    LF+++  +G++    AVS H     D++  L +E  D G+P Q T  + ++I      +EP S   +K+ + S  +   +  L   IS   V ++ +M  FI+ 
Sbjct:  124 RVEIEIQDINDNAPIFQTS--EGVLEIAESITLGDRFPLESAEDLDVGKNSLKSYVLSNDECFRLNVKTLADGRKVPELVIDKPLDREKKSAH---KLILTAVDGGDPAKTGTTVIQINVLDSNDNAPKF-------DLPMYKSSLREAAPVGSTVITIKATDLDEGDNGELQ---YFLGVHTPEPVRKMFALKPDTGEIIVLGNIDYESNKLYRFDVSAKDKGNPELVGHSSVQ---IDIIDENDNPPEIILTSSPSPVPENASVGTVV-ALINVKDLDSGVNGRVSINI-SPGFPF-TLKPSFENHYSLVTDSSLDREIYAEYNILLVATDSGVPSLKTEKTINVKVLDVNDNPPSFSQTSYNVYVQEN---NLAGVSLFSVSATDNDQDKNALLTYSILDLGSNQVPASSYFYINSENGTIYSMSSFDYEKMKLISIVVQAKDQGSPSLSSNATVHVFILDRNDNAPAVIYPSTSMGSVSHQRMPRSAKAGHLVTKVTAVDADSGHNAWLFYRLAEAT-DASLFSVNLHTGEVRTKRAVSEHD----DSSQRLVLEIKDNGEPIQSTTVT-VDILIEDGFHEPISDYREKTIEPS--KKTGKITLYLIISLASVSLLCLMTFFILL 720          

HSP 3 Score: 89.3521 bits (220), Expect = 1.742e-17
Identity = 129/486 (26.54%), Postives = 211/486 (43.42%), Query Frame = 3
Query: 1020 GEVEIKSKIDYDSDKTHFEFKVIVQDHAVE-PYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLN-PIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIII--LDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNG--KFTLSIESPGD--SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFDNQTIYYLIDNKSQS-----KFSIEKHSGRLFLQNSLDREEQETHHITVTASDS----LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPL---FNLDSDSGDLHLAVSL--HTIRPIDTNTFLDIEACDQGQPN 2396
            GE+ + S+ID +S        V+     +E P  L     VEI+IQDIND  P              +  +LE + ++T   +  +   +   + K   +SY L ND   +LN   +A G   P    +V ++  DRE +S     +   D  D +      I I  LD NDN P+F+   Y   ++E  P+G+ +   +  +D D  +NG  ++ L + +P      F +      +      D E   +++  + A D G+  L     V + I D NDNP  I    +   + EN    +++ +I   D D+     +  N S       K S E H   L   +SLDRE    ++I + A+DS    L T   T+ V V+D NDN P F   +  + +  +   G  +  + ATD D   N L+ Y IL   S + P    F ++S++G ++   S     ++ I     + ++A DQG P+
Sbjct:   88 GELVVNSRIDRESLCPQSASCVVPLQVIIENPLQLHR---VEIEIQDINDNAPIFQ----------TSEGVLEIAESITLGDRFPLESAEDLDVGKNSLKSYVLSNDECFRLNVKTLADGRKVPE---LVIDKPLDREKKSAHKLILTAVDGGDPAKTGTTVIQINVLDSNDNAPKFDLPMYKSSLREAAPVGSTVIT-IKATDLDEGDNGELQYFLGVHTPEPVRKMFALKPDTGEIIVLGNIDYESNKLYRFDVSAKDKGNPELVGHSSVQIDIIDENDNPPEIILTSSPSPVPENASVGTVVALINVKDLDSGVNGRVSINISPGFPFTLKPSFENHYS-LVTDSSLDREIYAEYNILLVATDSGVPSLKT-EKTINVKVLDVNDNPPSFSQTSYNVYVQENNLAGVSLFSVSATDNDQDKNALLTYSILDLGSNQVPASSYFYINSENGTIYSMSSFDYEKMKLIS----IVVQAKDQGSPS 550          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: CR774179.7 (protocadherin gamma-C5-like [Source:NCBI gene;Acc:103911742])

HSP 1 Score: 235.728 bits (600), Expect = 2.753e-64
Identity = 187/668 (27.99%), Postives = 329/668 (49.25%), Query Frame = 3
Query:  168 LWWSIFALIDIEGLSSNKIYRIKEETEIGYVIDYIKPN------DQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQ----DNGLYIENT---QMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPT-ILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND-KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTV--KNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI------ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITP------LINQFYISENKQRSLLGVIKATDFD---NQTIYY-LIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            LW   FA++  +  +  + Y I EE + G V+  +  +      + +N K+   +++G   F +    G+L +   IDRE++C         + +C + +++  ++     R+ + I+D+NDN+P + +D   +  +E +  G+R  L  A D D+GSN    Y +    +N + + Q     +G  +      + LDREK+++  +I++  D G P  S   Q+TV ++DVNDN P F   ++  E +V EN+ PGT+I ++KA+D D G N E  + +  +T   ++  F +   TGE++I   +DY+   T   +K+ ++        +     V++++ D+ND  P I          T +P  + E++   T +  I+V D DS G++         D   KL P  A      N + +V++ K DRE   K + E++ +D+     V  K +T+ ILDVNDNPP F++  Y  YIKEN   G++L + +  SD D+  N K   S+      + P  S+  I+ +N  + S  +FD E++ V  + +LA D G + L+S+  V+V I D NDN P +I P      + NQ      K   L+  + A D D   N  ++Y L +    S FS+  H+G +  + ++   +  +  + +   D
Sbjct:   15 LWLLCFAVLWSDADAQLR-YTIPEELKEGSVVGNVAKDLDLDVSEISNRKLRIASESGKQYFSVNLRNGELLVNELIDREKLC-------GQSARCVLPLQVIIEDPLQFYRVDVDIQDINDNSPSFLSDTKFIDVSETTLTGARFRLEPAQDADVGSNSLRTYALN---KNDYFILQVKNDKDGTKVPEIVLQKALDREKQSIEHLILMGIDGGDPASSGTTQITVRVLDVNDNAPVFEQDLY--EIKVMENAAPGTIIQIVKAIDLDDGLNSEIEYSLGSDTPETLKNLFSINSNTGELKISKSLDYEMSTT---YKIDIRARDKGGPVMEGHCRVQVNVLDVNDNAPEIII--------TSSPKPVREDAPAGTMVALINVKDLDS-GINGNVTLLILSDTPFKLKPTFA------NHYALVTDSKLDREKFPKYDIELKASDSGSPPLVSSKLITVNILDVNDNPPVFSERVYSVYIKENSAPGSILAS-VTASDLDTGENAKIVYSVIDTNTRDVPVSSYVYINAENGSIFSMHSFDYEKIKVFHVIVLAKDQGSQSLSSNATVHVFILDQNDNAPAVIYPSTSMGSVSNQRMPRSAKAGHLVTKVTAVDADSGHNAWLFYRLAEATDASLFSVNLHTGEVRTKRAVSEHDDSSQRLVIEIKD 650          

HSP 2 Score: 134.42 bits (337), Expect = 1.710e-31
Identity = 198/745 (26.58%), Postives = 334/745 (44.83%), Query Frame = 3
Query:  519 APIWTTDKAIVSFN------ENSPIGSRRSLPEATDIDIGSNGQVIYRMESKY-RNSFRLFQDNGLYIENTQMLDREK------KNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKF-TDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVR------PTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCE-SYFLDNDK---LNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD-----HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTID---QQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFDN----QTIYYLIDNKSQ-----SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIF----KNMNKVI--KIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHL--AVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKS-----KKSSYDQFLNENVLIAAISGLLVLMIIIMIAFIV 2579
            A +W+   A + +       E S +G+   + +  D+D+        R+ S+  +  F +   NG  + N +++DREK      + V  + +I +D    Y+     V V+I D+NDN P F +D+ F     V E +  G    L  A D D G+N   T+ ++ N       +F+++       T   EI  +   D +K   E  +++     +P S S    + + + D+ND  P         +       ++EN++  T I  +   D D    D ++ E  Y L +D    L  + +I +N   E  I  ++  D E  +    +IR  D        H  V+   + +LDVNDN PE    +    ++E+ P GTM+   + V D DS  NG  TL I S  D+ F +      +  L +    DRE+   + +++ A D G   L SS ++ V+I DVNDNP + +  +   YI EN    S+L  + A+D D     + +Y +ID  ++     S   I   +G +F  +S D E+ +  H+ V A D      +++ TV V ++D+NDN P       +M  V   ++  S   G  + K+ A DAD G+N  + Y L +++    LF+++  +G++    AVS H     D++  L IE  D G+P Q T  + ++I       EP S  + K+     KKS          LI ++  + VL ++ +   IV
Sbjct:   21 AVLWSDADAQLRYTIPEELKEGSVVGN---VAKDLDLDVSEISNRKLRIASESGKQYFSVNLRNGELLVN-ELIDREKLCGQSARCVLPLQVIIEDPLQFYR-----VDVDIQDINDNSPSFLSDTKF---IDVSETTLTGARFRLEPAQDADVGSNSLRTYALNKN------DYFILQVKNDKDGTKVPEIVLQKALDREKQSIEHLILMGIDGGDPAS-SGTTQITVRVLDVNDNAPVF-------EQDLYEIKVMENAAPGTIIQIVKAIDLD----DGLNSEIEYSLGSDTPETLKNLFSINSNT-GELKI--SKSLDYEMSTTYKIDIRARDKGGPVMEGHCRVQ---VNVLDVNDNAPEIIITSSPKPVREDAPAGTMV-ALINVKDLDSGINGNVTLLILS--DTPFKLKPTFANHYALVTDSKLDREKFPKYDIELKASDSGSPPLVSSKLITVNILDVNDNPPVFSERVYSVYIKENSAPGSILASVTASDLDTGENAKIVYSVIDTNTRDVPVSSYVYINAENGSIFSMHSFDYEKIKVFHVIVLAKDQGSQSLSSNATVHVFILDQNDNAPAVIYPSTSMGSVSNQRMPRSAKAGHLVTKVTAVDADSGHNAWLFYRLAEAT-DASLFSVNLHTGEVRTKRAVSEHD----DSSQRLVIEIKDNGEPVQSTTVT-VDILIEEGVYEPISEYNMKTTENNNKKSGKITLY----LIISLGTVSVLSVLTLFTLIV 716          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh1g3 (protocadherin 1 gamma 3 [Source:ZFIN;Acc:ZDB-GENE-050608-3])

HSP 1 Score: 235.343 bits (599), Expect = 8.598e-64
Identity = 205/675 (30.37%), Postives = 316/675 (46.81%), Query Frame = 3
Query:  162 SLLWWSIFA-------LIDIEGLSSNKIYRIKEETEIGYVIDYIKPNDQNNLKIF-------NTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL-FQD---NGLYIENT--QMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTI--IILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI------ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITP------LINQFYISENKQRSLLGVIKATDFDNQTIYYL----IDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            +L W   FA       L+ I  + ++  Y I EET+  YVI  I  +   ++K         +T D      ++   TG L +   IDREE+C        +   C +  +L  +N   V R+   I+D+NDNAP +  ++      E++  G R  L EA D DIG N    Y +E    N F L   D    G Y E    + LDRE++   ++I+ A D GSP +S    + + ++D NDN P F   +++    + EN+P GT I+ + A D D G NGE T+  S   S +  K F + + TG++ +  KIDY+S+K ++E  +  QD +     L+S A V IDI D+ND  P I          ++N  I ENS     +G I+V D+DS    ++ C        KLNP +       N F++V+ +  DRE ES  N  I  TD        ++TI   + DVNDNPP F +  Y  YI EN  +GT + + +  +D D   NG    S+        P  SF +I+    ++ +  +FD EQ     +K++A D+G   L+S+  V V I D NDN P I+ P      L+ +         SL+  + A D D+    +L    + +     F+I  HSG +  Q  +   +    ++ ++  D
Sbjct:    4 ALFWGRFFACFVAVILLLPIT-VCADLNYNIPEETKSQYVIGNIAKDLGIDVKQLSARKSRIDTEDISKRYCDINMKTGDLIVAETIDREELC-------GSRMSCFLNYELVLENPLDVHRIIFQIQDINDNAPRFPNERINFEITESADKGQRFRLHEAHDSDIGRNAVNGYLLEKN--NHFYLNVHDTAYGGKYAELVLEKELDREQQKEMDLILTATDGGSPQRSGTAVIHITVLDANDNVPVFDQPVYK--VTLAENTPSGTEIIRVSATDADEGPNGEVTYEFS-RISDKASKQFSIDKKTGQILVTEKIDYESEK-NYEIGIHAQDGS----GLASTATVIIDITDVNDNPPRIIL-------KSLNNPIPENSEPGAEVGIINVQDKDSGENRQIRCSVQQNVPFKLNPSVK------NYFSLVTTKALDREKESDYNITITATDGGSPPLSTSMTIHLFVSDVNDNPPVFEQQAYSAYINENNKVGTSVCS-VSANDPDWRQNGTVLYSLVPSEVSGVPVSSFLSINGDTGVIHTVRSFDYEQFRNFSVKVVARDNGSPPLSSNVTVKVFITDENDNSPQILYPVPDGKTLMTEMVPKATLSGSLVSKVIAVDADSGQNAWLSFQILKSTDPGLFTIGLHSGEIKTQRDISESDNMKQNLVISVKD 646          

HSP 2 Score: 107.071 bits (266), Expect = 5.731e-23
Identity = 147/561 (26.20%), Postives = 244/561 (43.49%), Query Frame = 3
Query:  798 QVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPT--GEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVT---FDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD---NQTIYY-LIDNKSQ-----SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIF-------KNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCT 2405
            ++  +I D+NDN P+F +   R   ++ E++  G    L +A D D G N    + +  N    +  H         E+ ++ ++D +  K   E  +I+          S  AV+ I + D ND  P         D      T+ EN+ + T I ++S  D D     +V  E +   +DK +   +I   +     I+   K D E+E      I   D S  ++   + I I DVNDNPP     + +  I EN   G  +   + V DKDS  N +   S++   +  F ++   +   S VT    DRE+ S + + I A D G   L++S  +++ + DVNDNP +        YI+EN K  + +  + A D D   N T+ Y L+ ++       S  SI   +G +    S D E+     + V A D+     +++ TV V + DENDN P         K +   +   A+ S G  + K++A DAD G N  + + + KS+    LF +   SG++     +     +  N  + ++  D GQP+  T
Sbjct:  117 RIIFQIQDINDNAPRFPNE--RINFEITESADKGQRFRLHEAHDSDIGRNAVNGYLLEKNNHFYLNVHDTAYGGKYAELVLEKELDREQQK---EMDLILTATDGGSPQRSGTAVIHITVLDANDNVPVF-------DQPVYKVTLAENTPSGTEIIRVSATDADEGPNGEVTYE-FSRISDKASKQFSI---DKKTGQILVTEKIDYESEKNYEIGIHAQDGSGLASTATVIIDITDVNDNPPRIILKSLNNPIPENSEPGAEV-GIINVQDKDSGENRQIRCSVQQ--NVPFKLNPSVKNYFSLVTTKALDREKESDYNITITATDGGSPPLSTSMTIHLFVSDVNDNPPVFEQQAYSAYINENNKVGTSVCSVSANDPDWRQNGTVLYSLVPSEVSGVPVSSFLSINGDTGVIHTVRSFDYEQFRNFSVKVVARDNGSPPLSSNVTVKVFITDENDNSPQILYPVPDGKTLMTEMVPKATLS-GSLVSKVIAVDADSGQNAWLSFQILKST-DPGLFTIGLHSGEIKTQRDISESDNMKQNLVISVK--DNGQPSLST 654          

HSP 3 Score: 105.531 bits (262), Expect = 1.384e-22
Identity = 134/512 (26.17%), Postives = 220/512 (42.97%), Query Frame = 3
Query:  354 GKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQR-----LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIY---RMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFT-DSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNT----SPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLN--PIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTI--IILDVNDNPPE--FNKGTYHFYIKENEPIGTM---LDNRMFVSDKDSNNNGKFTLSI-ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKD 1820
             +L + + +DRE             QQ E+ + LT  +    QR     + I + D NDN P++      V+  EN+P G+      ATD D G NG+V Y   R+  K    F + +  G  I  T+ +D E +  YEI I AQD GS   S    V ++I DVNDNPP+    S+  P   + ENS PG  + ++   D D G N +    +  N     +P V+ +F +  T  ++ + + DY+         +   D    P  LS+   + + + D+ND  P    + +   SA +N    EN+   T +  +S +D D +    V    Y L   +++  P+ +  +   +   I + R FD E     + ++   D        N+T+   I D NDN P+  +        + E  P  T+   L +++   D DS  N   +  I +S     FTI   +  +K++            L I   D+G   L+++C+V + I D
Sbjct:  191 AELVLEKELDRE-------------QQKEMDLILTATDGGSPQRSGTAVIHITVLDANDNVPVFDQPVYKVTLAENTPSGTEIIRVSATDADEGPNGEVTYEFSRISDKASKQFSIDKKTG-QILVTEKIDYESEKNYEIGIHAQD-GSGLASTA-TVIIDITDVNDNPPRIILKSLNNP---IPENSEPGAEVGIINVQDKDSGENRQIRCSVQQNVPFKLNPSVKNYFSLVTTKALDREKESDYN-------ITITATDGGSPP--LSTSMTIHLFVSDVNDNPPV---FEQQAYSAYIN----ENNKVGTSVCSVSANDPDWRQNGTVL---YSLVPSEVSGVPVSSFLSINGDTGVIHTVRSFDYEQFRNFSVKVVARDNGSPPLSSNVTVKVFITDENDNSPQILYPVPDGKTLMTEMVPKATLSGSLVSKVIAVDADSGQNAWLSFQILKSTDPGLFTIGLHSGEIKTQRDISESDNMKQNLVISVKDNGQPSLSTTCVVNLLISD 664          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh1g33 (protocadherin 1 gamma 33 [Source:ZFIN;Acc:ZDB-GENE-071004-76])

HSP 1 Score: 235.343 bits (599), Expect = 9.718e-64
Identity = 186/667 (27.89%), Postives = 330/667 (49.48%), Query Frame = 3
Query:  168 LWWSIFALIDIEGLSSNKIYRIKEETEIGYVIDYIKPN------DQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQ----DNGLYIEN---TQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND-KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTV--KNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI------ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITP------LINQFYISENKQRSLLGVIKATDFD---NQTIYY-LIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            LW   FA++  +  +  + Y I EE + G V+  +  +      + +N K+   +++G   F +    G+L +   IDRE++C         + +C + +++  ++     R+ + I+D+NDN+P + +D   +  +E +  G+R  L  A D D+GSN    Y +    +N + + Q     +G  +      + LDREK+++  +I++  D G P  S   Q+TV ++DVNDN P F   ++  E +V EN+ PGT+I ++KA+D D G N E  + +  +T   ++  F +   TGE++I   +DY+   T   +K+ ++        +     V++++ D+ND  P I        +++  P + E++   T +  I+V D DS G++         D   KL P  A      N + +V++ K DRE   K + E++ +D+     V  K +T+ ILDVNDNPP F++  Y  YIKEN   G++L + +  SD D+  N K   S+      + P  S+  I+ +N  + S  +FD E++ V  + +LA D G + L+S+  V+V I D NDN P +I P      + NQ      K   L+  + A D D   N  ++Y L +    S FS+  H+G +  + ++   +  +  + +   D
Sbjct:   15 LWLLCFAVLWSDADAQLR-YTIPEELKEGSVVGNVAKDLDLDVSEISNRKLRIASESGKQYFSVNLRNGELLVNELIDREKLC-------GQSARCVLPLQVIIEDPLQFYRVDVDIQDINDNSPSFLSDTKFIDVSETTLTGARFRLEPAQDADVGSNSLRTYALN---KNDYFILQVKNDKDGTKVPEIVLQKALDREKQSIEHLILMGIDGGDPASSGTTQITVRVLDVNDNAPVFEQDLY--EIKVMENAAPGTIIQIVKAIDLDDGLNSEIEYSLGSDTPETLKNLFSINSNTGELKISKSLDYEMSTT---YKIDIRARDKGGPVMEGHCRVQVNVLDVNDNAPEIII------TSSPKP-VREDAPAGTMVALINVKDLDS-GINGNVTLLILSDTPFKLKPTFA------NHYALVTDSKLDREKFPKYDIELKASDSGSPPLVSSKLITVNILDVNDNPPVFSERVYSVYIKENSAPGSILAS-VTASDLDTGENAKIVYSVIDTNTRDVPVSSYVYINAENGSIFSMHSFDYEKIKVFHVIVLAKDQGSQSLSSNATVHVFILDQNDNAPAVIYPSTSMGSVSNQRMPRSAKAGHLVTKVTAVDADSGHNAWLFYRLAEATDASLFSVNLHTGEVRTKRAVSEHDDSSQRLVIEIKD 650          

HSP 2 Score: 133.65 bits (335), Expect = 2.932e-31
Identity = 192/710 (27.04%), Postives = 320/710 (45.07%), Query Frame = 3
Query:  606 DIDIGSNGQVIYRMESKY-RNSFRLFQDNGLYIENTQMLDREK------KNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKF-TDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVR------PTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCE-SYFLDNDK---LNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD-----HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTID---QQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFDN----QTIYYLIDNKSQ-----SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIF----KNMNKVI--KIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHL--AVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKS-----KKSSYDQFLNENVLIAAISGLLVLMIIIMIAFIV 2579
            D+D+        R+ S+  +  F +   NG  + N +++DREK      + V  + +I +D    Y+     V V+I D+NDN P F +D+ F     V E +  G    L  A D D G+N   T+ ++ N       +F+++       T   EI  +   D +K   E  +++     +P S S    + + + D+ND  P         +       ++EN++  T I  +   D D    D ++ E  Y L +D    L  + +I +N   E  I  ++  D E  +    +IR  D        H  V+   + +LDVNDN PE    +    ++E+ P GTM+   + V D DS  NG  TL I S  D+ F +      +  L +    DRE+   + +++ A D G   L SS ++ V+I DVNDNP + +  +   YI EN    S+L  + A+D D     + +Y +ID  ++     S   I   +G +F  +S D E+ +  H+ V A D      +++ TV V ++D+NDN P       +M  V   ++  S   G  + K+ A DAD G+N  + Y L +++    LF+++  +G++    AVS H     D++  L IE  D G+P Q T  + ++I       EP S  + K+     KKS          LI ++  + VL ++ +   IV
Sbjct:   53 DLDVSEISNRKLRIASESGKQYFSVNLRNGELLVN-ELIDREKLCGQSARCVLPLQVIIEDPLQFYR-----VDVDIQDINDNSPSFLSDTKF---IDVSETTLTGARFRLEPAQDADVGSNSLRTYALNKN------DYFILQVKNDKDGTKVPEIVLQKALDREKQSIEHLILMGIDGGDPAS-SGTTQITVRVLDVNDNAPVF-------EQDLYEIKVMENAAPGTIIQIVKAIDLD----DGLNSEIEYSLGSDTPETLKNLFSINSNT-GELKI--SKSLDYEMSTTYKIDIRARDKGGPVMEGHCRVQ---VNVLDVNDNAPEIIITSSPKPVREDAPAGTMV-ALINVKDLDSGINGNVTLLILS--DTPFKLKPTFANHYALVTDSKLDREKFPKYDIELKASDSGSPPLVSSKLITVNILDVNDNPPVFSERVYSVYIKENSAPGSILASVTASDLDTGENAKIVYSVIDTNTRDVPVSSYVYINAENGSIFSMHSFDYEKIKVFHVIVLAKDQGSQSLSSNATVHVFILDQNDNAPAVIYPSTSMGSVSNQRMPRSAKAGHLVTKVTAVDADSGHNAWLFYRLAEAT-DASLFSVNLHTGEVRTKRAVSEHD----DSSQRLVIEIKDNGEPVQSTTVT-VDILIEEGVYEPISEYNMKTTENNNKKSGKITLY----LIISLGTVSVLSVLTLFTLIV 716          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: emc7 (ER membrane protein complex subunit 7 [Source:Xenbase;Acc:XB-GENE-945123])

HSP 1 Score: 235.343 bits (599), Expect = 2.673e-63
Identity = 245/897 (27.31%), Postives = 398/897 (44.37%), Query Frame = 3
Query:  225 YRIKEE----TEIGYVIDYIKPNDQNNLKIFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC----EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-----ESKYRNSFRLFQDNGLYIENTQM------------------------------LDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF--YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPI-IAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIIL--DVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTA---SDSLHTASXXXXXXXXDENDNKPI--FKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIF-----------SGLEIQWTTNRNEPASRESDKSKKSSYDQFLNE-NVLIAAISGLLVLMIIIMIAFIVFKQKSIFFARIPSRSNFSHQKKHMNPSVTCYRDNFVTPDYH 2702
            YRI EE      IG V   I     +    F+  ++G + F++++ TG+L  T RRIDRE++     +   N  +C    EV++    Q+   +    ++I D+NDN P + +    ++  EN P+G+   LP ATD D G NG   Y +     ES Y +  R   ++ LY    +M                              LDRE+++ YE+ +  +D G P +S++  + V I DVNDN P+F  S++  E  + ENS PGT IL L+A D+D G NG+  +     T        L   +G + +  +ID + +     F V+ +D    P +   +A V ++I+D ND  P I      R P    M   + E+    TPI  + V DRD      V C        +L P     G     ++ + ++   D E   + N  I   D+   S   N ++I+   D NDNPP F++        EN  +G  +   +  +D DS  N +   S+E   +  F+I      +   +  DREQ   ++ K++A D G   L  +  V V + D NDN       +  FY+ EN Q  S +G++   D D   N  +   I+  S   FSIE  +G ++   S DRE Q ++   V A    D   +A+ TV++ V+DENDN P   F   +    +  S +    +  +VATD+D+G N  + Y I+  + YK  LF +DS SG + L   L T +    +  + ++  D GQP Q TI            +   + +   R+       D +   SYD      +++I  ++G++ +++II++  +        + R  S++ +   KK          ++F TP  H
Sbjct:   32 YRIAEEGPADVRIGNVAKEIGIVKGSGDVTFSL-ESGSDYFKIDNVTGELSTTERRIDREKLPQCQMIFDEN--ECFIDFEVSVIGPAQSWVELFEGRVVILDINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELIQDAGESLYVSGRRGAAESSLYPGKRRMESDSRSSVFELQVADTSDGEKQPQLIVKGPLDREQRDSYELTLRVRDGGEPPRSSQSILRVLITDVNDNNPRFEKSVY--EADLAENSAPGTPILQLRATDYDVGVNGQIEYVFGAATESVRRLLRLDENSGWLSVLHRIDRE-EVNQLRFTVMARDRGQPPKT--DKATVVLNIKDENDNVPLIDIRKIGRIPVKDGM-ANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPANDGEGEQNKKKYFLHTSAPLDYENVKEYNVIIVAVDSGSPSLSSNNSLIVKVGDTNDNPPVFSQAVVEVAFPENNVLGERVAT-VLATDADSGKNAEIAYSLEPSMEGIFSIHPDTGDITVNIILDREQTDRYEFKVIAKDKGIPVLQGTTSVVVQVADRNDNEPRFMQDVFTFYVKENLQPNSPVGMVTVMDADKGRNAEMSLFIEEDSD-IFSIENDTGTIYSTVSFDREHQTSYTFKVKAVDGGDPPRSATATVSLFVMDENDNAPTISFPINSSYAVLSPSSNVRTVVASVVATDSDNGVNADLNYSIVGGNPYK--LFEIDSTSGVVSLVGKL-TSKHYGLHRLV-VQVNDSGQPPQSTIALVHVFVNETISNATVVDYQIARSLHTPLTQDIAGDPSYDMSKQRLSIVIGVVAGIMTVILIILVVVMA------RYCRAKSKNGYEAGKKD--------HEDFFTPQQH 899          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: emc7 (ER membrane protein complex subunit 7 [Source:Xenbase;Acc:XB-GENE-945123])

HSP 1 Score: 235.343 bits (599), Expect = 3.127e-63
Identity = 245/897 (27.31%), Postives = 398/897 (44.37%), Query Frame = 3
Query:  225 YRIKEE----TEIGYVIDYIKPNDQNNLKIFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC----EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-----ESKYRNSFRLFQDNGLYIENTQM------------------------------LDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF--YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPI-IAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIIL--DVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTA---SDSLHTASXXXXXXXXDENDNKPI--FKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIF-----------SGLEIQWTTNRNEPASRESDKSKKSSYDQFLNE-NVLIAAISGLLVLMIIIMIAFIVFKQKSIFFARIPSRSNFSHQKKHMNPSVTCYRDNFVTPDYH 2702
            YRI EE      IG V   I     +    F+  ++G + F++++ TG+L  T RRIDRE++     +   N  +C    EV++    Q+   +    ++I D+NDN P + +    ++  EN P+G+   LP ATD D G NG   Y +     ES Y +  R   ++ LY    +M                              LDRE+++ YE+ +  +D G P +S++  + V I DVNDN P+F  S++  E  + ENS PGT IL L+A D+D G NG+  +     T        L   +G + +  +ID + +     F V+ +D    P +   +A V ++I+D ND  P I      R P    M   + E+    TPI  + V DRD      V C        +L P     G     ++ + ++   D E   + N  I   D+   S   N ++I+   D NDNPP F++        EN  +G  +   +  +D DS  N +   S+E   +  F+I      +   +  DREQ   ++ K++A D G   L  +  V V + D NDN       +  FY+ EN Q  S +G++   D D   N  +   I+  S   FSIE  +G ++   S DRE Q ++   V A    D   +A+ TV++ V+DENDN P   F   +    +  S +    +  +VATD+D+G N  + Y I+  + YK  LF +DS SG + L   L T +    +  + ++  D GQP Q TI            +   + +   R+       D +   SYD      +++I  ++G++ +++II++  +        + R  S++ +   KK          ++F TP  H
Sbjct:   32 YRIAEEGPADVRIGNVAKEIGIVKGSGDVTFSL-ESGSDYFKIDNVTGELSTTERRIDREKLPQCQMIFDEN--ECFIDFEVSVIGPAQSWVELFEGRVVILDINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELIQDAGESLYVSGRRGAAESSLYPGKRRMESDSRSSVFELQVADTSDGEKQPQLIVKGPLDREQRDSYELTLRVRDGGEPPRSSQSILRVLITDVNDNNPRFEKSVY--EADLAENSAPGTPILQLRATDYDVGVNGQIEYVFGAATESVRRLLRLDENSGWLSVLHRIDRE-EVNQLRFTVMARDRGQPPKT--DKATVVLNIKDENDNVPLIDIRKIGRIPVKDGM-ANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPANDGEGEQNKKKYFLHTSAPLDYENVKEYNVIIVAVDSGSPSLSSNNSLIVKVGDTNDNPPVFSQAVVEVAFPENNVLGERVAT-VLATDADSGKNAEIAYSLEPSMEGIFSIHPDTGDITVNIILDREQTDRYEFKVIAKDKGIPVLQGTTSVVVQVADRNDNEPRFMQDVFTFYVKENLQPNSPVGMVTVMDADKGRNAEMSLFIEEDSD-IFSIENDTGTIYSTVSFDREHQTSYTFKVKAVDGGDPPRSATATVSLFVMDENDNAPTISFPINSSYAVLSPSSNVRTVVASVVATDSDNGVNADLNYSIVGGNPYK--LFEIDSTSGVVSLVGKL-TSKHYGLHRLV-VQVNDSGQPPQSTIALVHVFVNETISNATVVDYQIARSLHTPLTQDIAGDPSYDMSKQRLSIVIGVVAGIMTVILIILVVVMA------RYCRAKSKNGYEAGKKD--------HEDFFTPQQH 899          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: emc7 (ER membrane protein complex subunit 7 [Source:Xenbase;Acc:XB-GENE-945123])

HSP 1 Score: 234.958 bits (598), Expect = 3.665e-63
Identity = 245/897 (27.31%), Postives = 398/897 (44.37%), Query Frame = 3
Query:  225 YRIKEE----TEIGYVIDYIKPNDQNNLKIFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC----EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-----ESKYRNSFRLFQDNGLYIENTQM------------------------------LDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF--YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPI-IAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIIL--DVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTA---SDSLHTASXXXXXXXXDENDNKPI--FKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIF-----------SGLEIQWTTNRNEPASRESDKSKKSSYDQFLNE-NVLIAAISGLLVLMIIIMIAFIVFKQKSIFFARIPSRSNFSHQKKHMNPSVTCYRDNFVTPDYH 2702
            YRI EE      IG V   I     +    F+  ++G + F++++ TG+L  T RRIDRE++     +   N  +C    EV++    Q+   +    ++I D+NDN P + +    ++  EN P+G+   LP ATD D G NG   Y +     ES Y +  R   ++ LY    +M                              LDRE+++ YE+ +  +D G P +S++  + V I DVNDN P+F  S++  E  + ENS PGT IL L+A D+D G NG+  +     T        L   +G + +  +ID + +     F V+ +D    P +   +A V ++I+D ND  P I      R P    M   + E+    TPI  + V DRD      V C        +L P     G     ++ + ++   D E   + N  I   D+   S   N ++I+   D NDNPP F++        EN  +G  +   +  +D DS  N +   S+E   +  F+I      +   +  DREQ   ++ K++A D G   L  +  V V + D NDN       +  FY+ EN Q  S +G++   D D   N  +   I+  S   FSIE  +G ++   S DRE Q ++   V A    D   +A+ TV++ V+DENDN P   F   +    +  S +    +  +VATD+D+G N  + Y I+  + YK  LF +DS SG + L   L T +    +  + ++  D GQP Q TI            +   + +   R+       D +   SYD      +++I  ++G++ +++II++  +        + R  S++ +   KK          ++F TP  H
Sbjct:   32 YRIAEEGPADVRIGNVAKEIGIVKGSGDVTFSL-ESGSDYFKIDNVTGELSTTERRIDREKLPQCQMIFDEN--ECFIDFEVSVIGPAQSWVELFEGRVVILDINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELIQDAGESLYVSGRRGAAESSLYPGKRRMESDSRSSVFELQVADTSDGEKQPQLIVKGPLDREQRDSYELTLRVRDGGEPPRSSQSILRVLITDVNDNNPRFEKSVY--EADLAENSAPGTPILQLRATDYDVGVNGQIEYVFGAATESVRRLLRLDENSGWLSVLHRIDRE-EVNQLRFTVMARDRGQPPKT--DKATVVLNIKDENDNVPLIDIRKIGRIPVKDGM-ANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPANDGEGEQNKKKYFLHTSAPLDYENVKEYNVIIVAVDSGSPSLSSNNSLIVKVGDTNDNPPVFSQAVVEVAFPENNVLGERVAT-VLATDADSGKNAEIAYSLEPSMEGIFSIHPDTGDITVNIILDREQTDRYEFKVIAKDKGIPVLQGTTSVVVQVADRNDNEPRFMQDVFTFYVKENLQPNSPVGMVTVMDADKGRNAEMSLFIEEDSD-IFSIENDTGTIYSTVSFDREHQTSYTFKVKAVDGGDPPRSATATVSLFVMDENDNAPTISFPINSSYAVLSPSSNVRTVVASVVATDSDNGVNADLNYSIVGGNPYK--LFEIDSTSGVVSLVGKL-TSKHYGLHRLV-VQVNDSGQPPQSTIALVHVFVNETISNATVVDYQIARSLHTPLTQDIAGDPSYDMSKQRLSIVIGVVAGIMTVILIILVVVMA------RYCRAKSKNGYEAGKKD--------HEDFFTPQQH 899          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: emc7 (ER membrane protein complex subunit 7 [Source:Xenbase;Acc:XB-GENE-945123])

HSP 1 Score: 234.958 bits (598), Expect = 3.964e-63
Identity = 245/897 (27.31%), Postives = 398/897 (44.37%), Query Frame = 3
Query:  225 YRIKEE----TEIGYVIDYIKPNDQNNLKIFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC----EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-----ESKYRNSFRLFQDNGLYIENTQM------------------------------LDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF--YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPI-IAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIIL--DVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTA---SDSLHTASXXXXXXXXDENDNKPI--FKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIF-----------SGLEIQWTTNRNEPASRESDKSKKSSYDQFLNE-NVLIAAISGLLVLMIIIMIAFIVFKQKSIFFARIPSRSNFSHQKKHMNPSVTCYRDNFVTPDYH 2702
            YRI EE      IG V   I     +    F+  ++G + F++++ TG+L  T RRIDRE++     +   N  +C    EV++    Q+   +    ++I D+NDN P + +    ++  EN P+G+   LP ATD D G NG   Y +     ES Y +  R   ++ LY    +M                              LDRE+++ YE+ +  +D G P +S++  + V I DVNDN P+F  S++  E  + ENS PGT IL L+A D+D G NG+  +     T        L   +G + +  +ID + +     F V+ +D    P +   +A V ++I+D ND  P I      R P    M   + E+    TPI  + V DRD      V C        +L P     G     ++ + ++   D E   + N  I   D+   S   N ++I+   D NDNPP F++        EN  +G  +   +  +D DS  N +   S+E   +  F+I      +   +  DREQ   ++ K++A D G   L  +  V V + D NDN       +  FY+ EN Q  S +G++   D D   N  +   I+  S   FSIE  +G ++   S DRE Q ++   V A    D   +A+ TV++ V+DENDN P   F   +    +  S +    +  +VATD+D+G N  + Y I+  + YK  LF +DS SG + L   L T +    +  + ++  D GQP Q TI            +   + +   R+       D +   SYD      +++I  ++G++ +++II++  +        + R  S++ +   KK          ++F TP  H
Sbjct:   32 YRIAEEGPADVRIGNVAKEIGIVKGSGDVTFSL-ESGSDYFKIDNVTGELSTTERRIDREKLPQCQMIFDEN--ECFIDFEVSVIGPAQSWVELFEGRVVILDINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELIQDAGESLYVSGRRGAAESSLYPGKRRMESDSRSSVFELQVADTSDGEKQPQLIVKGPLDREQRDSYELTLRVRDGGEPPRSSQSILRVLITDVNDNNPRFEKSVY--EADLAENSAPGTPILQLRATDYDVGVNGQIEYVFGAATESVRRLLRLDENSGWLSVLHRIDRE-EVNQLRFTVMARDRGQPPKT--DKATVVLNIKDENDNVPLIDIRKIGRIPVKDGM-ANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPANDGEGEQNKKKYFLHTSAPLDYENVKEYNVIIVAVDSGSPSLSSNNSLIVKVGDTNDNPPVFSQAVVEVAFPENNVLGERVAT-VLATDADSGKNAEIAYSLEPSMEGIFSIHPDTGDITVNIILDREQTDRYEFKVIAKDKGIPVLQGTTSVVVQVADRNDNEPRFMQDVFTFYVKENLQPNSPVGMVTVMDADKGRNAEMSLFIEEDSD-IFSIENDTGTIYSTVSFDREHQTSYTFKVKAVDGGDPPRSATATVSLFVMDENDNAPTISFPINSSYAVLSPSSNVRTVVASVVATDSDNGVNADLNYSIVGGNPYK--LFEIDSTSGVVSLVGKL-TSKHYGLHRLV-VQVNDSGQPPQSTIALVHVFVNETISNATVVDYQIARSLHTPLTQDIAGDPSYDMSKQRLSIVIGVVAGIMTVILIILVVVMA------RYCRAKSKNGYEAGKKD--------HEDFFTPQQH 899          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ENSXETT00000029153.1 (protocadherin 8 [Source:NCBI gene;Acc:100485587])

HSP 1 Score: 228.794 bits (582), Expect = 3.227e-61
Identity = 193/667 (28.94%), Postives = 312/667 (46.78%), Query Frame = 3
Query:  156 MNSLLWWSIFALIDIEGLSSNKIYRIKEETEIGYVIDYIKPN----DQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVT---IKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRME--SKYRNSFRLFQDNGLYIENTQM--LDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKF------TLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQ-----FYISENKQRSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS 2069
            M +L    +  L+ +    + + YR  EE E G VI  +  +     +   ++    +N +    +  S G+L I  RIDRE IC         +  C +    + L  +    +  + + + D+NDN+P + + +  V  +E++ +G+R  L  ATD D+G N    +++   S +    +   D   Y +   M  LDRE ++ Y + ++A D GSP +S    V V ++D NDN P F  S    E  + E++P G ++L L AVD D G NGE  +  SP    EV + F + P +G + ++ ++D++S +T +EF V  QD    P + + + +V   + D+ND  P I+  P    SA +   I E ++  + +  IS  DRDS    +VHC  Y  ++ +L           + + IV+    DRE  S+ N  +   D  +    TVK  TI + D NDN P F K  Y   + EN   G  +   +   D D  +NGK       T  + +P  ++ ++D     + +  TF+ E +    L+I A D G  +LTSS I+ V I D NDN PVII P ++         S      L+  IKA D D   N  + Y +    ++ F+I K +G +FL   +         +TV+ SDS
Sbjct:    8 MGALRLLCLGMLVSVCRCKTVR-YRTYEEDEPGTVIGTLAEDLHLEGEGTFRLMKQFNNSL--IHVRESDGQLSIGERIDRERIC-------KQSPHCTLALDVVSLAKEQFKLIH-VEVEVRDINDNSPRFPSAEIPVEVSESATVGTRIPLDIATDEDVGVNSIQSFQISVNSHFSIDVQTRADGVKYADLVLMKELDRESQSAYTLELLAMDGGSPSRSGTAMVNVRVLDFNDNSPVFERSAVTVE--LMEDAPVGYLLLDLNAVDPDEGVNGEIIYGFSPQVPQEVRQLFKIDPKSGRLTLEGQVDFESKQT-YEFDVQAQDMGPNPLAATCKVIVH--VIDVNDNAPVISITPLTSISAGVA-YITEAAARESFVALISTTDRDSGQNGQVHCTLYGHEHFRLQQAYE------DSYMIVTTSALDREKISEYNLTVVAEDLGSPPFKTVKQYTIRVSDENDNAPVFAKPVYEVSVLENNAPGAYI-TTVVARDPDFGHNGKVIYRLVETEVMGAPISTYVSLDPATGAVYALRTFNHEILKQLDLRIQASDGGSPQLTSSAIIKVKIVDQNDNAPVIIQPALSNGSAEVVVPSRAPHGFLVTQIKAKDADEGVNAELSYSLTEDGRNLFTINKVTGEVFLVADVSEAVGHVFRVTVSVSDS 650          

HSP 2 Score: 116.316 bits (290), Expect = 1.154e-25
Identity = 148/549 (26.96%), Postives = 242/549 (44.08%), Query Frame = 3
Query:  873 QVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-----LVRPT-GEVEIKSKIDYD---SDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDIND---EFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGD--SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVI-ITPLI----NQFYISENKQR-SLLGVIKATDFDNQ-------TIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD---SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPL---FNLDSDSGDLHLAVSLH--TIRPIDTNTFLDIEACDQGQPN 2396
            + +E   PGTVI  L     D    GE TFR+         K F      VR + G++ I  +ID +       H    + V   A E + L     VE++++DIND    FP+        +SAT+   I  + +T   +G  S+         ++   S+F  +      +    +     ++V  ++ DRE++S    E+   D  +   S    + + +LD NDN P F +      + E+ P+G +L +   V D D   NG+  +  S + P +    F ID ++  L  +   D E    ++  + A D G   L ++C V VH+ DVNDN PVI ITPL        YI+E   R S + +I  TD D+        T+Y     + Q  +   + S  +   ++LDRE+   +++TV A D            T+ V DENDN P+F      + +  + +PG  I  +VA D D G+NG V Y +++      P+    +LD  +G ++   + +   ++ +D    L I+A D G P 
Sbjct:   31 RTYEEDEPGTVIGTLA---EDLHLEGEGTFRLM--------KQFNNSLIHVRESDGQLSIGERIDRERICKQSPHCTLALDVVSLAKEQFKLIH---VEVEVRDINDNSPRFPSAEIPVEVSESATVGTRIPLDIATDEDVGVNSIQSF------QISVNSHFSID------VQTRADGVKYADLVLMKELDRESQSAYTLELLAMDGGSPSRSGTAMVNVRVLDFNDNSPVFERSAVTVELMEDAPVGYLLLDLNAV-DPDEGVNGEIIYGFSPQVPQEVRQLFKIDPKSGRLTLEGQVDFESKQTYEFDVQAQDMGPNPLAATCKVIVHVIDVNDNAPVISITPLTSISAGVAYITEAAARESFVALISTTDRDSGQNGQVHCTLYGHEHFRLQQAY---EDSYMIVTTSALDREKISEYNLTVVAEDLGSPPFKTVKQYTIRVSDENDNAPVFAKPVYEVSVLENNAPGAYITTVVARDPDFGHNGKVIYRLVETEVMGAPISTYVSLDPATGAVYALRTFNHEILKQLD----LRIQASDGGSPQ 545          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 238.81 bits (608), Expect = 1.158e-64
Identity = 236/811 (29.10%), Postives = 386/811 (47.60%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKID---ASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C    L    + +C  EV + +    I  + ++  +IED+NDNAP++ T    +S  ENS I SR SLP A D DIG NG   Y++  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F +     E  + EN+P G+ +  L A D D G N    F  S   S   ++ F L   TG + +K  +D +   +H +  V+  D    P    + A V +++ DIND  P+I   Y  NP + T+   + EN+   T I  I+V D+DS+   +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      + EN   G  L  ++  +D DS  N +  + L  ++P +  F +DQ+  IL +    DRE+   +   +LA D+G   L S+  V+V + D NDN  I T     FY+ E+  +   +G+I  TD D    +     ++D   Q  F+I+  SG +    S DRE QE++   V A D      +++  VT+ VVD NDNKPIF +       +    S +PG  + K+VA D D G N  V Y +   + K  LF ++  SG++ L        + LH +          ++A D GQP+  ++F+ + + +  N + P +    +  + S D   N+N               +++A ++G + ++++I I  +V
Sbjct:   66 VYKTGD--VPLIRIEEGTGEIFTTGARIDREKLCAGIVL----DARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEI--EVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSH-KLLVLATDGGSTP----ARATVLVNVTDINDNVPSIDIRYIVNPTNGTV--LLSENAPLNTKIALITVMDKDSEHNGRVTC---FTDHEVPFRLRPVFS------NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQL-TKISATDADSGQNAEISYMLGFDAPPE--FNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQ--FTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKG-LFMIEQTSGNITLKEKCMVSDLGLHRVI---------VKANDLGQPD--SLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYVKIMVAIVAGTITVVLVIFITAVV 834          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 238.81 bits (608), Expect = 2.503e-64
Identity = 236/811 (29.10%), Postives = 386/811 (47.60%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKID---ASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C    L    + +C  EV + +    I  + ++  +IED+NDNAP++ T    +S  ENS I SR SLP A D DIG NG   Y++  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F +     E  + EN+P G+ +  L A D D G N    F  S   S   ++ F L   TG + +K  +D +   +H +  V+  D    P    + A V +++ DIND  P+I   Y  NP + T+   + EN+   T I  I+V D+DS+   +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      + EN   G  L  ++  +D DS  N +  + L  ++P +  F +DQ+  IL +    DRE+   +   +LA D+G   L S+  V+V + D NDN  I T     FY+ E+  +   +G+I  TD D    +     ++D   Q  F+I+  SG +    S DRE QE++   V A D      +++  VT+ VVD NDNKPIF +       +    S +PG  + K+VA D D G N  V Y +   + K  LF ++  SG++ L        + LH +          ++A D GQP+  ++F+ + + +  N + P +    +  + S D   N+N               +++A ++G + ++++I I  +V
Sbjct:   66 VYKTGD--VPLIRIEEGTGEIFTTGARIDREKLCAGIVL----DARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEI--EVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSH-KLLVLATDGGSTP----ARATVLVNVTDINDNVPSIDIRYIVNPTNGTV--LLSENAPLNTKIALITVMDKDSEHNGRVTC---FTDHEVPFRLRPVFS------NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQL-TKISATDADSGQNAEISYMLGFDAPPE--FNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQ--FTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKG-LFMIEQTSGNITLKEKCMVSDLGLHRVI---------VKANDLGQPD--SLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYVKIMVAIVAGTITVVLVIFITAVV 834          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 238.039 bits (606), Expect = 8.443e-64
Identity = 236/811 (29.10%), Postives = 386/811 (47.60%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKID---ASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C    L    + +C  EV + +    I  + ++  +IED+NDNAP++ T    +S  ENS I SR SLP A D DIG NG   Y++  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F +     E  + EN+P G+ +  L A D D G N    F  S   S   ++ F L   TG + +K  +D +   +H +  V+  D    P    + A V +++ DIND  P+I   Y  NP + T+   + EN+   T I  I+V D+DS+   +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      + EN   G  L  ++  +D DS  N +  + L  ++P +  F +DQ+  IL +    DRE+   +   +LA D+G   L S+  V+V + D NDN  I T     FY+ E+  +   +G+I  TD D    +     ++D   Q  F+I+  SG +    S DRE QE++   V A D      +++  VT+ VVD NDNKPIF +       +    S +PG  + K+VA D D G N  V Y +   + K  LF ++  SG++ L        + LH +          ++A D GQP+  ++F+ + + +  N + P +    +  + S D   N+N               +++A ++G + ++++I I  +V
Sbjct:   66 VYKTGD--VPLIRIEEGTGEIFTTGARIDREKLCAGIVL----DARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEI--EVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSH-KLLVLATDGGSTP----ARATVLVNVTDINDNVPSIDIRYIVNPTNGTV--LLSENAPLNTKIALITVMDKDSEHNGRVTC---FTDHEVPFRLRPVFS------NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQL-TKISATDADSGQNAEISYMLGFDAPPE--FNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQ--FTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKG-LFMIEQTSGNITLKEKCMVSDLGLHRVI---------VKANDLGQPD--SLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYVKIMVAIVAGTITVVLVIFITAVV 834          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 237.654 bits (605), Expect = 1.260e-63
Identity = 236/811 (29.10%), Postives = 386/811 (47.60%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKID---ASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C    L    + +C  EV + +    I  + ++  +IED+NDNAP++ T    +S  ENS I SR SLP A D DIG NG   Y++  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F +     E  + EN+P G+ +  L A D D G N    F  S   S   ++ F L   TG + +K  +D +   +H +  V+  D    P    + A V +++ DIND  P+I   Y  NP + T+   + EN+   T I  I+V D+DS+   +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      + EN   G  L  ++  +D DS  N +  + L  ++P +  F +DQ+  IL +    DRE+   +   +LA D+G   L S+  V+V + D NDN  I T     FY+ E+  +   +G+I  TD D    +     ++D   Q  F+I+  SG +    S DRE QE++   V A D      +++  VT+ VVD NDNKPIF +       +    S +PG  + K+VA D D G N  V Y +   + K  LF ++  SG++ L        + LH +          ++A D GQP+  ++F+ + + +  N + P +    +  + S D   N+N               +++A ++G + ++++I I  +V
Sbjct:   66 VYKTGD--VPLIRIEEGTGEIFTTGARIDREKLCAGIVL----DARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEI--EVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSH-KLLVLATDGGSTP----ARATVLVNVTDINDNVPSIDIRYIVNPTNGTV--LLSENAPLNTKIALITVMDKDSEHNGRVTC---FTDHEVPFRLRPVFS------NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQL-TKISATDADSGQNAEISYMLGFDAPPE--FNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQ--FTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKG-LFMIEQTSGNITLKEKCMVSDLGLHRVI---------VKANDLGQPD--SLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYVKIMVAIVAGTITVVLVIFITAVV 834          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 237.654 bits (605), Expect = 1.260e-63
Identity = 236/811 (29.10%), Postives = 386/811 (47.60%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKID---ASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C    L    + +C  EV + +    I  + ++  +IED+NDNAP++ T    +S  ENS I SR SLP A D DIG NG   Y++  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F +     E  + EN+P G+ +  L A D D G N    F  S   S   ++ F L   TG + +K  +D +   +H +  V+  D    P    + A V +++ DIND  P+I   Y  NP + T+   + EN+   T I  I+V D+DS+   +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      + EN   G  L  ++  +D DS  N +  + L  ++P +  F +DQ+  IL +    DRE+   +   +LA D+G   L S+  V+V + D NDN  I T     FY+ E+  +   +G+I  TD D    +     ++D   Q  F+I+  SG +    S DRE QE++   V A D      +++  VT+ VVD NDNKPIF +       +    S +PG  + K+VA D D G N  V Y +   + K  LF ++  SG++ L        + LH +          ++A D GQP+  ++F+ + + +  N + P +    +  + S D   N+N               +++A ++G + ++++I I  +V
Sbjct:   66 VYKTGD--VPLIRIEEGTGEIFTTGARIDREKLCAGIVL----DARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEI--EVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSH-KLLVLATDGGSTP----ARATVLVNVTDINDNVPSIDIRYIVNPTNGTV--LLSENAPLNTKIALITVMDKDSEHNGRVTC---FTDHEVPFRLRPVFS------NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQL-TKISATDADSGQNAEISYMLGFDAPPE--FNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQ--FTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKG-LFMIEQTSGNITLKEKCMVSDLGLHRVI---------VKANDLGQPD--SLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYVKIMVAIVAGTITVVLVIFITAVV 834          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 3.150e-61
Identity = 232/811 (28.61%), Postives = 390/811 (48.09%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATD---FDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIF----KNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C         ++ C  EV + +    I  + ++  +IED+NDNAP++      +S  ENS I S+ +LP A D D+G NG   Y +  K +N F L        D    +   + LDREKK+ Y + +  +D G P +S+   + V + D NDN P F ++    E  + EN+P GT +  L A D D G N +  F  S   S    + F L   TG + IK  +D +    H +  V+  D  + P    + A+V +++ D+ND  P+I   Y  NP + T+   + EN    T I  I+V D+D+    +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      I EN   G  L  ++  +D DS  N +  + L  ++P +  F++D++  +L      DRE+   +   ILA D+G   LTS+  V+V I D NDN  + T     FY+ EN  R   +G+I  TD    DN  +   I +++   F+I+  +G +    S DRE+QE++   V A D      ++S  VT+ VVD NDNKP+F     N +  + +  S +PG  + +++A D D G N  V+Y +   + ++ LF +D ++G++ L        + LH +          ++A D GQP+  ++FS + +    N +   +   ++  + S +  +  N               +L+AA++G + ++++I I  +V
Sbjct:   66 VYKTGD--VPLIRIEEDTGEIFTTGARIDREKLCAG----IPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-IKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEI--EVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNH-KLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTV--VLSENIPLNTKIALITVTDKDADHNGRVTC---FTDHEIPFRLRPVFS------NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQL-TKVSATDADSGPNAEINYLLGPDAPPE--FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVL-PSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-LFAIDQETGNITLMEKCDVTDLGLHRVL---------VKANDLGQPD--SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTNDYVKILVAAVAGTITVVVVIFITAVV 834          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 8.003e-61
Identity = 231/811 (28.48%), Postives = 391/811 (48.21%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATD---FDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIF----KNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C         ++ C  EV + +    I  + ++  +IED+NDNAP++      +S  ENS I S+ +LP A D D+G+NG   Y +  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F ++    E  + EN+P GT +  L A D D G N +  F  S   S    + F L   TG + IK  +D +    H +  V+  D  + P    + A+V +++ D+ND  P+I   Y  NP + T+   + EN    T I  I+V D+D+    +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      I EN   G  L  ++  +D DS  N +  + L  ++P +  F++D++  +L      DRE+   +   ILA D+G   LTS+  V+V I D NDN  + T     FY+ EN  R   +G+I  TD    DN  +   I +++   F+I+  +G +    S DRE+QE++   V A D      ++S  VT+ VVD NDNKP+F     N +  + +  S +PG  + +++A D D G N  V+Y +   + ++ LF +D ++G++ L        + LH +          ++A D GQP+  ++FS + +    N +   +   ++  + S +  +  N               +L+AA++G + ++++I I  +V
Sbjct:   66 VYKTGD--VPLIRIEEDTGEIFTTGARIDREKLCAG----IPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEI--EVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNH-KLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTV--VLSENIPLNTKIALITVTDKDADHNGRVTC---FTDHEIPFRLRPVFS------NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQL-TKVSATDADSGPNAEINYLLGPDAPPE--FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVL-PSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRD-LFAIDQETGNITLMEKCDVTDLGLHRVL---------VKANDLGQPD--SLFSVVIVNLFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVV 834          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 9.558e-61
Identity = 231/811 (28.48%), Postives = 391/811 (48.21%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATD---FDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIF----KNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C         ++ C  EV + +    I  + ++  +IED+NDNAP++      +S  ENS I S+ +LP A D D+G+NG   Y +  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F ++    E  + EN+P GT +  L A D D G N +  F  S   S    + F L   TG + IK  +D +    H +  V+  D  + P    + A+V +++ D+ND  P+I   Y  NP + T+   + EN    T I  I+V D+D+    +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      I EN   G  L  ++  +D DS  N +  + L  ++P +  F++D++  +L      DRE+   +   ILA D+G   LTS+  V+V I D NDN  + T     FY+ EN  R   +G+I  TD    DN  +   I +++   F+I+  +G +    S DRE+QE++   V A D      ++S  VT+ VVD NDNKP+F     N +  + +  S +PG  + +++A D D G N  V+Y +   + ++ LF +D ++G++ L        + LH +          ++A D GQP+  ++FS + +    N +   +   ++  + S +  +  N               +L+AA++G + ++++I I  +V
Sbjct:   66 VYKTGD--VPLIRIEEDTGEIFTTGARIDREKLCAG----IPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEI--EVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNH-KLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTV--VLSENIPLNTKIALITVTDKDADHNGRVTC---FTDHEIPFRLRPVFS------NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQL-TKVSATDADSGPNAEINYLLGPDAPPE--FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVL-PSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRD-LFAIDQETGNITLMEKCDVTDLGLHRVL---------VKANDLGQPD--SLFSVVIVNLFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVV 834          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 2.622e-60
Identity = 231/811 (28.48%), Postives = 391/811 (48.21%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATD---FDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIF----KNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C         ++ C  EV + +    I  + ++  +IED+NDNAP++      +S  ENS I S+ +LP A D D+G NG   Y +  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F ++    E  + EN+P GT +  L A D D G N +  F  S   S    + F L   TG + IK  +D +    H +  V+  D  + P    + A+V +++ D+ND  P+I   Y  NP + T+   + EN    T I  I+V D+D+    +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      I EN   G  L  ++  +D DS  N +  + L  ++P +  F++D++  +L      DRE+   +   ILA D+G   LTS+  V+V I D NDN  + T    +FY+ EN  R   +G+I  TD    DN  +   I +++   F+I+  +G +    S DRE+QE++   V A D      ++S  VT+ VVD NDNKP+F     N +  + +  S +PG  + +++A D D G N  V+Y +   + ++ LF +D ++G++ L        + LH +          ++A D GQP+  ++FS + +    N +   +   ++  + S +  +  N               +L+AA++G + ++++I I  +V
Sbjct:   98 VYKTGD--VPLIRIEEDTGEIFTTGARIDREKLCAG----IPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEI--EVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNH-KLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTV--VLSENIPLNTKIALITVTDKDADHNGRVTC---FTDHEIPFRLRPVFS------NQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQL-MKVSATDADSGPNAEINYLLGPDAPPE--FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDEND-DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVL-PSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-LFAIDQETGNITLMEKCDVTDLGLHRVL---------VKANDLGQPD--SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVV 866          

HSP 2 Score: 122.865 bits (307), Expect = 7.692e-27
Identity = 149/572 (26.05%), Postives = 241/572 (42.13%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPNDQN---NLKIFNTNDNGVN-----CFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSII-IEDVNDNAP------IWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIA-----FYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS--DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEP---IGTMLDNRMFVSDKDSNNNGKFTLSIESPGDS--FFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGD-ERLTSSCIVYVHIKDVNDNPVIITPLINQ 1862
            I E   +G  +  +   D +   N KI  +  N V+      F L ++TG + I   +DREE  P ++LL          +  +   +   + + ++ + DVNDN P      I       V  +EN P+ ++ +L   TD D   NG+V    + +     R    N   +EN   LD E    Y I ++A D G P  +    + +++ D NDN P FT S       + EN+ PG  ++ + A D D G N E  + + P+  PE     L R TG + +  K+D + +  +  F ++ +D+ V P  L+S   V + I D ND  P        FY            + EN      +G I+V D D  G +     S   +ND        G   P       N  FDRE +      ++  D      S+   +TI ++DVNDN P F    Y++  +   P    GT++   + V D D+  N +   SI   G++   F IDQ+   +      D   + +H++ + A D G  + L S  IV + + +   N  +I  L+ +
Sbjct:  290 IPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREE-TPNHKLL----------VLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVT--VSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFS---LDRRTGMLTVVKKLDREKEDKYL-FTILAKDNGVPP--LTSNVTVFVSIIDQNDNSPVFTHNEYKFY------------VPENLPRHGTVGLITVTDPD-YGDNSAVTLSILDENDDFTIDSQTGVIRP-------NISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAV-DNDTGMNAEVRYSIVG-GNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRK 820          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 3.310e-60
Identity = 232/811 (28.61%), Postives = 388/811 (47.84%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAF-YPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATD---FDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIF----KNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN---------------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E  TG++F T  RIDRE++C         ++ C  EV + +    I  + ++  +IED+NDNAP++      +S  ENS I S+ +LP A D D+G NG   Y +  K +N F L        D    +   + LDRE+K+ Y + +  +D G P +S+   + V + D NDN P F ++    E  + EN+P GT +  L A D D G N +  F  S   S    + F L   TG + IK  +D +    H +  V+  D  + P    + A+V +++ D+ND  P+I   Y  NP + T+   + EN    T I  I+V D+D+    +V C   F D++   +L P+ +      N+F + +    D E+  +   ++   D       ++  L I + D NDN P F +      I EN   G  L  ++   D DS  N K  + L  ++P +  F++D +  +L      DRE+   +   ILA D+G   LTS+  V+V I D NDN  + T     FY+ EN  R   +G+I  TD    DN  +   I +++   F+I+  +G +    S DRE+QE++   V A D      ++S  VT+ VVD NDNKP+F     N +  + +  S +PG  + +++A D D G N  V+Y +   + ++ LF +D ++G++ L        + LH +          ++A D GQP+  ++FS + +    N +   +   ++  + S +  +  N               +L+AA++G + ++++I I  +V
Sbjct:   66 VYKTGD--VPLIRIEEDTGEIFTTGARIDREKLCAG----IPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEI--EVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNH-KLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTV--VLSENIPLNTKIALITVTDKDADHNGRVTC---FTDHEIPFRLRPVFS------NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQL-TKVSAMDADSGPNAKINYLLGPDAPPE--FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVL-PSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-LFAIDQETGNITLMEKCDVTDLGLHRVL---------VKANDLGQPD--SLFSVVIVNLFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVV 834          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A3R7HBN6 (Protocadherin-11 X-linked (Fragment) OS=Clonorchis sinensis OX=79923 GN=PCDH11X PE=4 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 2.502e-89
Identity = 275/946 (29.07%), Postives = 418/946 (44.19%), Query Frame = 3
Query:  225 YRIKEETEIGYVIDYI-----------------------KPNDQNNL---KIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKS------------------------NNQQCEVTIKLT-----------------HQNINFVQRLSIIIEDVNDNAPIWTT--DKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-----ESKYRNSFRLFQD--NGLYIENTQMLDREKKNVYEIIIIAQDNGSPYK----------SNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPN-----TSPEVEKHFLVRPTGEVEIKSKIDYDSDKT----------------------------------HFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPD-----SATMNPT-------ILENSSTMTPIGQISVHDRDSKGLDKVHCE------SYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFV-------------------SDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSL-LGVIKATDFDNQTI----YYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS-LH------------TASXXXXXXXXDENDNKPIFKNMNKV---IKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------------------VSLHTIRPIDTNT--------FLDIEACDQGQ-PNQ-CTIFSGLEI 2426
            YRI+EE  IG  I  +                       K +D  +L    + N+   GVN  E++   G++ + RRIDRE++C  ++ + S                        ++  C +T+KL+                   N   +  + ++I+D+NDNAP W     +  V F +  PIG RR+LP A D+D G NG++IY +       K   +F L      G+Y+  T+ +DRE++  Y+ I+ A D+ +P            ++ L + V I D+NDN P F   IF P   + E +P GT +L+L A D D G NG F F  S       T    +++F +R  G + ++  +D D DK                                    F F V+V+D AV PYS SSEA V I + D NDE P +       D     +    PT       + EN    T +  +  +D D +G D V C       S    +++ NPI+ +  +    +++ +  + DRE        I C DT+ H T +N ++ +LD NDNPP F   T+H  + EN   GT L     V                   SD  +N +  + L       + F ID +   + + V+FDRE V  + L  LAIDHG   LTS+  V + + DVNDN      +   F+++EN+ R+  +G + ATD D+       Y++ D    + F I+K +G +  + +LDRE+Q  +  TV A D+ +H            T + TVTV++ DENDN P+F N N     + +   E+ G K+  I ATDAD G N L+ Y ++ S     LF LDS +G L+L+                   V+L     +D +          L +EACDQG+ P Q CT+FS L+I
Sbjct:   32 YRIQEELPIGSQIGNLMEDLLLYKSQSLLFGKSQAELQSKKDDWGDLFEFSVLNSGHLGVNSVEVKKD-GRVLVARRIDREQLCLGSQSVGSPLDSVYSVKFVPKLTSQGSHSSMASSSHCIITLKLSVFSRAAQTKITGIKSSKADNPQAILTVRLLIDDINDNAPYWPGHLKRFQVVFRDGDPIGERRTLPPAVDLDSGLNGRLIYELVPTTHSDKNSGTFSLIDHAMEGIYLCATKQVDREEREAYQYILKAIDHSNPDDDQMPSEESRFTSTLVIDVHIEDINDNTPLFVQPIFTPNTPIPETTPVGTTVLILNATDADAGINGAFHFGFSREHAWLPTEIYAKQYFDIRSNGHIVVRRSLDVDRDKGTPEIFRQEQRNGVQGLSSSGATFLSSSLASGTTIKFRFHVVVEDEAVRPYSRSSEATVVITVSDENDEAPIVEIREVREDIEQKANGVSGPTGNFNFLSVTENKPIGTAVATLQAYDPDFEGTDHVECRLKTSNFSLVQTSNQQNPIMMVPGSV--AYHLQTAIELDREVTPVQLVPISCIDTAGHLTERNFSVYVLDENDNPPRFVHNTFHMQVWENMSPGTQLQRMENVQSSVHSNLLYHHPYFTAVDSDTGANADVFYQLIENGMNATTFKIDPKTGTITTTVSFDREAVDHYTLYALAIDHGIPPLTSTSTVKITVLDVNDNAPQFGSVEYTFHLAENQPRATQVGQVTATDLDSDIYGPIHYFVGDESDATNFRIDKMTGVIRCRQALDREKQARYVFTVLAKDTNVHSSNSKSLSSLQLTGTCTVTVLIDDENDNWPVFVNPNSTANTLAVAVDETLGHKLAYIQATDADDGENALITYSIR-SGNTNGLFGLDSTTGLLYLSGLFRGTSTSDHDSLTKNVTVNLAGDTRVDVSPALAGPSFHMLTLEACDQGKHPKQKCTLFSNLKI 973          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: G7Y8R9 (Protocadherin-11 X-linked OS=Clonorchis sinensis OX=79923 GN=CLF_102916 PE=4 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 2.156e-88
Identity = 275/946 (29.07%), Postives = 418/946 (44.19%), Query Frame = 3
Query:  225 YRIKEETEIGYVIDYI-----------------------KPNDQNNL---KIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKS------------------------NNQQCEVTIKLT-----------------HQNINFVQRLSIIIEDVNDNAPIWTT--DKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-----ESKYRNSFRLFQD--NGLYIENTQMLDREKKNVYEIIIIAQDNGSPYK----------SNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPN-----TSPEVEKHFLVRPTGEVEIKSKIDYDSDKT----------------------------------HFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPD-----SATMNPT-------ILENSSTMTPIGQISVHDRDSKGLDKVHCE------SYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFV-------------------SDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSL-LGVIKATDFDNQTI----YYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS-LH------------TASXXXXXXXXDENDNKPIFKNMNKV---IKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------------------VSLHTIRPIDTNT--------FLDIEACDQGQ-PNQ-CTIFSGLEI 2426
            YRI+EE  IG  I  +                       K +D  +L    + N+   GVN  E++   G++ + RRIDRE++C  ++ + S                        ++  C +T+KL+                   N   +  + ++I+D+NDNAP W     +  V F +  PIG RR+LP A D+D G NG++IY +       K   +F L      G+Y+  T+ +DRE++  Y+ I+ A D+ +P            ++ L + V I D+NDN P F   IF P   + E +P GT +L+L A D D G NG F F  S       T    +++F +R  G + ++  +D D DK                                    F F V+V+D AV PYS SSEA V I + D NDE P +       D     +    PT       + EN    T +  +  +D D +G D V C       S    +++ NPI+ +  +    +++ +  + DRE        I C DT+ H T +N ++ +LD NDNPP F   T+H  + EN   GT L     V                   SD  +N +  + L       + F ID +   + + V+FDRE V  + L  LAIDHG   LTS+  V + + DVNDN      +   F+++EN+ R+  +G + ATD D+       Y++ D    + F I+K +G +  + +LDRE+Q  +  TV A D+ +H            T + TVTV++ DENDN P+F N N     + +   E+ G K+  I ATDAD G N L+ Y ++ S     LF LDS +G L+L+                   V+L     +D +          L +EACDQG+ P Q CT+FS L+I
Sbjct:   32 YRIQEELPIGSQIGNLMEDLLLYKSQSLLFGKSQAELQSKKDDWGDLFEFSVLNSGHLGVNSVEVKKD-GRVLVARRIDREQLCLGSQSVGSPLDSVYSVKFVPKLTSQGSHSSMASSSHCIITLKLSVFSRAAQTKITGIKSSKADNPQAILTVRLLIDDINDNAPYWPGHLKRFQVVFRDGDPIGERRTLPPAVDLDSGLNGRLIYELVPTTHSDKNSGTFSLIDHAMEGIYLCATKQVDREEREAYQYILKAIDHSNPDDDQMPSEESRFTSTLVIDVHIEDINDNTPLFVQPIFTPNTPIPETTPVGTTVLILNATDADAGINGAFHFGFSREHAWLPTEIYAKQYFDIRSNGHIVVRRSLDVDRDKGTPEIFRQEQRNGVQGLSSSGATFLSSSLASGTTIKFRFHVVVEDEAVRPYSRSSEATVVITVSDENDEAPIVEIREVREDIEQKANGVSGPTGNFNFLSVTENKPIGTAVATLQAYDPDFEGTDHVECRLKTSNFSLVQTSNQQNPIMMVPGSV--AYHLQTAIELDREVTPVQLVPISCIDTAGHLTERNFSVYVLDENDNPPRFVHNTFHMQVWENMSPGTQLQRMENVQSSVHSNLLYHHPYFTAVDSDTGANADVFYQLIENGMNATTFKIDPKTGTITTTVSFDREAVDHYTLYALAIDHGIPPLTSTSTVKITVLDVNDNAPQFGSVEYTFHLAENQPRATQVGQVTATDLDSDIYGPIHYFVGDESDATNFRIDKMTGVIRCRQALDREKQARYVFTVLAKDTNVHSSNSKSLSSLQLTGTCTVTVLIDDENDNWPVFVNPNSTANTLAVAVDETLGHKLAYIQATDADDGENALITYSIR-SGNTNGLFGLDSTTGLLYLSGLFRGTSTSDHDSLTKNVTVNLAGDTRVDVSPALAGPSFHMLTLEACDQGKHPKQKCTLFSNLKI 973          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A068Y543 (Protocadherin 1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000570400 PE=4 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 7.254e-85
Identity = 267/948 (28.16%), Postives = 412/948 (43.46%), Query Frame = 3
Query:  180 IFALIDIEGLSSNKIYRIK--EETEIGYVIDYIK---------PNDQNNL-KIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRL-----------------------------LKSNNQQCEVTIKLTHQ---------NINFVQRLSIIIEDVNDNAPIWTTD--KAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNS----------FRLFQD---NGLYIENTQMLDREKKNVYEIIIIAQDNGSP-------------YKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTS----PEVEKH-FLVRPTGEVEIKSKIDYDSD----------------------KTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFY--------------PRNPDSATMN-----PTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPII--------------------AIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTML---------DNRMFVSDKDSNNNG--KFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDH--GDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSL-LGVIKATDFDNQT--IYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXX----------XDENDNKPIFKNMNK---VIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL---------------HTIRPIDTNT-----FLDIEACDQGQPNQCTIFSGLEIQWTTNR 2444
            IFA + + G+S  ++  ++  EE   G VI  ++         P  Q  + K   ++D G    ++ +S GKL +  RIDRE++CP   L                             L SN Q C +T+++            +++ +  L I + DVND AP W  +  + +V F +  P+G R+SLP A D+D G N ++ YR+E    +           F+L  D     LY++  + +D E  + Y++++ A D                   ++ L +TV + D+NDN PKFT  +F P++ V E +P G+V+L LKA D D G NG F F  +PN       ++ +H F VRP G V ++  +D D                           F FKV+V D A   Y+ SSEA V I + D NDE P I                 P    S+ ++       + EN+   T +  I V D D  G D+  C    LDN     +                     A+     +++ I++    DRE       +I CTD ++H +V N+T++I D+ND+ P+F +    + + EN P GT+L         ++    +D D   NG  K++    S     F+ID    ++ +++ FDRE+   +   ILA+D   G+  LT +  V V + DVNDNP +       F I+EN  R   +G + A D D+Q    YYL ++     F I++ SG LF +  LDRE+Q  +   V   D                        DENDN P+F   N     + +  S++ G K+  I+A+DAD G+NG + Y +K  +    LF++D  SG L LA SL                T R I  +T      + +EACD G   +CT+   L I     R
Sbjct:   13 IFAFLLVVGVSRTEVIELQMSEELPGGSVIVDLRALISKSGKFPELQMPIFKAVGSDDIGNRLVDV-TSEGKLVVIHRIDREKLCPLYPLSILPGPQSDFAAPPPSTFGFSSQPILTTSLASNGQ-CVITLRVAVTEKGEVSDPLDVSNIYHLRITVLDVNDQAPFWPENLQRHVVEFRDGDPVGKRQSLPLAIDLDQGENARISYRIEQDLVDEPSPEGWDSLPFKLIHDQSDGSLYLQTEREIDHEATSSYKLVLKATDGVDKSLPDSIVAECFLRQHTSTLTLTVVVQDINDNDPKFTQPVFTPDRPVSEATPVGSVVLRLKATDADSGENGAFHFGFAPNVGWRSIDKLAQHLFDVRPNGNVVVRRPLDVDRQWKLVDDLKKSSNSDLFGRDNVKGMEFSFKVVVVDEADSKYARSSEATVNIVVVDENDEAPVIGVMRPTTSGECVRSLGKPTGITSSRLSTQTSYACVFENAPVDTFVATIQVSDMDFCGEDEREC---VLDNKNFTLVAEEHANTRLSANQLTHVFNSQALKGPSVSQYAILTAVALDREATPFQQIQILCTDRANHQSVHNVTVLIGDINDHKPQFAQEVMTYQVPENSPPGTILKPLYVGPTRNSVALATDGDVGKNGMVKYSFIEGSRTAENFSIDSFTGVISTRIRFDREENGKYVFNILAVDQADGENTLTGTGTVEVVVLDVNDNPPVFAQETYTFQIAENLPRGTRVGQVTAFDLDDQGPISYYLSNDYDALVFQIDRTSGELFTRRPLDREDQSNYTFKVLVRDFAALGGGVEKKTYTATATVTVVLEDENDNSPVFILPNATANALTVAVSQTLGHKLAVIIASDADEGDNGRITYKIKAGNSLN-LFSIDPQSGLLFLADSLSRFNEATNTSSADEAATARAIQLSTQPTVHVITLEACDSGVEPRCTVSPNLRIHVQLGR 954          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A4E0S2Q9 (Protocadherin-11 X-linked OS=Fasciola hepatica OX=6192 GN=D915_001230 PE=4 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 7.946e-85
Identity = 277/979 (28.29%), Postives = 416/979 (42.49%), Query Frame = 3
Query:  225 YRIKEETEIGYVIDYI----------------------KPNDQNNL---KIFNTNDNGVNCFELESSTGKLFITRRIDREEICP----------------------------TNRLLKSNNQQCEVTIKLTHQNINFVQRLS------------------------IIIEDVNDNAPIWTT--DKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESK-----YRNSFRLFQD--NGLYIENTQMLDREKKNVYEIIIIAQDN-------------GSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTS--PE---VEKHFLVRPTGEVEIKSKIDYD---------------------------------SDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNP-------------DSATMNPTIL-ENSSTMTPIGQISVHDRDSKGLDKVHCE------SYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDN-------------------------------RMFVSDKDSNNNGKFTLSIESPG--DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSL-LGVIKATDFDNQ----TIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---------------------LHTASXXXXXXXXDENDNKPIFKNMNK---VIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL-HTIRPIDTNTF-----------------------LDIEACDQGQ-PN-QCTIFSGLEI 2426
            YRIKEE  +G ++  +                      KP+   +L   KI N  D GVNCFE++   G L  TRR+DRE++C                             TN+   S++Q C +T+   H  + F + +S                        + +ED+NDN P W     +  V F +  PIG RR+LP A D D+G N ++ Y + S      ++  F L ++  +GLY+   + +DRE++  Y++ +   D              GS   S +L V V I D+NDN P F   IF P   + E +P G  +L+L A D D   NG F F  S   +  P      ++F VRP G V ++  ++ D                                  ++  F F+V+V+D AV PY+ SSEA V I ++D NDE P I   P  P             +S  +   I+ EN    T +  + V+D D  G D V C       +   + D +    +   +    +++ +  + DRET    +  I C+D + H   KN+TI + DVNDN P+F +  + F ++EN P GT L                                  +  +D+DS  N +    +   G   + F +D     + S V FDRE+   + ++ LA+D G  RLT S  V V I DVNDNP         F+++EN+ RS  +G I ATD D++      Y+L  ++    F +++ +G +  +  LDREEQ  +   V A D                        T + T+TV+V D NDN P+F + N     + I   E+ G K+  I A DAD   NGL+ Y + +S   + LF LDS +G L+LA +L  T   + T+ F                       L +EACD GQ P   CT+FS L+I
Sbjct:   30 YRIKEEVPLGTIVGNLVDDVLVRQIELGLLKSSVTVGQKPSHLRSLFTFKILNNADRGVNCFEVKPD-GNLVTTRRVDREQLCANRPTTSSNDVYGVLGHLGDPLLLQSAGNTNKFRDSDSQFCPITL---HCAVQFTEHISANSQSDQHPISAKPDAKHSLIQIRVQVEDINDNPPYWPGHLQRFQVHFRDGDPIGERRTLPPALDNDVGVNARLRYELFSASSTNDHQIPFSLMENPIDGLYLYAIKQIDREEQAAYQLYLKVTDGLTSSDQVTTLGPEGSSQHSAKLMVDVFIEDINDNAPVFVQPIFTPSHPIPETAPVGKTVLVLNATDADADLNGAFHFGFSREHAWLPAERLAREYFEVRPNGHVVVRRPLNVDRSLDRWDVRSGPESLLDLSHSVSTSSLSSSPGLGNEMQFRFRVVVEDEAVRPYTKSSEATVVIVVRDENDEAPVIQVKPHLPGTLAHSIPMGLRLESGRLGYLIVEENQPPGTKVATVQVYDPDFDGTDSVECRLRTVNFTLSRNADTIESGSSSSASGLIVYSLHTAVELDRETTPSQHIPIICSDVAGHYAEKNVTIYVTDVNDNRPQFVQAEFVFEVEENSPPGTPLRRVTTGQTSSVSTSSSTSKSQMATEQSLRNGMWNLLATDQDSGLNAEIHYFLLENGLNSTGFKVDPVTGAITSAVVFDRERTDQYVMQALAVDRGSPRLTGSVAVKVKILDVNDNPPQFIRSEYSFHVAENQPRSTQIGQISATDLDSEIHGPITYFLSTDRDALVFYLDRDTGVVRSRQPLDREEQARYVFRVMARDGNPAARMTGSRSSDRQIPAGAVQLTGTATITVIVDDVNDNWPVFISPNATANTLAIAVDETLGHKLAYIQAEDADQDENGLISYHI-RSGNNQRLFGLDSATGLLYLAGNLGQTTTGLPTDDFSEKNDSSDLVNFSAQFYKPSFHVLTLEACDHGQNPKPHCTLFSNLKI 1003          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A4Z2CNA1 (Protocadherin-11 X-linked OS=Schistosoma japonicum OX=6182 GN=EWB00_009000 PE=4 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.172e-84
Identity = 282/963 (29.28%), Postives = 438/963 (45.48%), Query Frame = 3
Query:  294 LKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNR----------------LLKSNNQQ---------CEVTIKL---THQNINFVQRL---------------SIIIEDVNDNAPIWTT--DKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMES-----KYRNSFRLFQD--NGLYIENTQMLDREKKNVYEIIIIAQD--------------NGSPYK--SNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPN----TSPEVEKHFL-VRPTGEVEIKSKIDYD------------------------------------SDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNP-------------TILENSSTMTPIGQISVHDRDSKGLDKVHC---ESYF----------LDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNR--------------------MFVSDKDSNNNGKFTLSIESPG--DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSL-LGVIKATDFDNQTI----YYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS-----------------LHTASXXXXXXXXDENDNKPIFKNMNKV---IKIDASES-PGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPLFNLDSDSGDLHLA------------------VSLHTIRPID----------TNTFLDIEACDQGQ-PN-QCTIFSGLEIQWTTNRNEPASR-ESDKSKKSSYDQFLNENVLIAAISG 2537
            LKI N  D  VN F+++   GKL + RR+DR++ICP  +                +  S +QQ         C + I++    HQ  + + ++                I +ED+NDNAP W     +  ++F +  P+GSRR++P A D+D+G NG + Y + S     K    F L +D  +GL+I  T+ +DRE+++ Y++I+ A D              N S YK  ++ L + + I DVNDN P+FT  +F     V E +P GT +LLL A D D G NG F F  S +     + ++ +++  +RP G++ +K  ++ D                                     +   F F+ IV+D A  PY+ SSEA V I + D NDE PTI+  P NP+    N              ++ EN    T +  +  +D D  G D+V C   +S F          LD+D+      I  N   E+++++ R  DRE+ S   A I C+D   H T +N+TI I+D NDN P+F   T++F + EN P+GT +                       +  +D D   N + T  +   G   + F ID    I+ +   FDRE    + L  +A+DHG+  LT +  V + I D+NDN  I +     F+I EN+ RS  +G + ATD D+       Y   +++    F+I+K +G +  + SLDREE+  +   V   D+                  +T ++TVTV+V D NDN P+F + N     + I   +   G+K+  I A D D G NGL+ Y IL  ++Y    F LD  SG L+L+                  +S  +  P D          +   L +EACDQG+ P  +CT+++ L+I    N ++     E+ +S  +S+ Q LN   L    SG
Sbjct:   86 LKILNFADPYVNLFDIKLD-GKLIVNRRLDRDQICPKQQHTDSSLISVDSTRIANMYTSTHQQTILQAEKISCSIIIQIGLFIHQKSSLINKIDMEVNNKNQIRLFHIRINVEDINDNAPYWQGHLQRFRITFLDGDPVGSRRNIPPAVDVDVGINGHITYELISANLFDKSNIPFSLLEDSVDGLHIYATKPIDREEQSEYKLILKATDGLYALSASTMSALSNESTYKRFTSTLYIDILIEDVNDNTPQFTQPLFTTSMPVAETTPVGTTVLLLNATDLDSGINGIFHFSFSKDHYWQPAEKIARYYFDIRPNGQIIVKQPLNVDKLDQINGRTNNNKMILSSLREVHQLSYDINENNINKGENVQFRFRAIVEDEATRPYTRSSEATVIILVTDENDESPTISLLP-NPELINANALNSVAGPNSFNYFSVFENQPINTVVATVQAYDPDFGGKDQVECNLKDSNFSLVRLTSQNQLDSDR-----NIAVNTLTEYHLITARVVDRESTSHQVATIVCSDMVGHYTERNVTIRIMDQNDNRPKFVHDTFYFQVDENSPLGTQVKQHSQKVVRDYFNDNYPIGPSHGLSATDLDIGINSQMTFFLYEDGINSTKFKIDSHTGIITTMDVFDRELKEKYSLTAIAVDHGNPSLTGTAKVQIIINDLNDNEPIFSKSNYTFHIQENQPRSTTVGQVSATDLDSSIYGPLEYGFANDQDSVNFTIDKITGIIRNRQSLDREEKAQYTFRVLVKDTKVKPSELNLNTQQSKSIQYTGTSTVTVIVDDVNDNWPVFVSPNATSNTLAISLGQKITGYKLAYIQAEDKDEGKNGLITYTILTGNNYG--FFGLDPVSGLLYLSNPITNGDNDNSYNNVLYNMSNTSNLPSDDEFNNLLRKSSMHILTLEACDQGEDPKPRCTLYNNLKIIIQNNNDKDIHNLENTRSHYNSHIQLLNLPELPGLTSG 1039          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh1g9 (protocadherin 1 gamma 9 [Source:ZFIN;Acc:ZDB-GENE-050609-5])

HSP 1 Score: 243.047 bits (619), Expect = 2.919e-65
Identity = 196/665 (29.47%), Postives = 325/665 (48.87%), Query Frame = 3
Query:  171 WW--SIFALIDIEGLSSNKI-YRIKEETEIGYVIDYIKPN-DQNNLKIFNTN-----DNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMES--KYRNSFRLFQDNG----LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTII--ILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPG------DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLI----NQFYISENKQRSLLGVIKATDFD---NQTI-YYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            WW   +F  + I  +   +I Y I EE   G V+  I  + D    ++F  N     ++G   F ++   G+L +  RIDRE +C       S +  C + ++   +N   + R+ I I+D+NDN+P++   + I++  E++  G+R  L  A D D+GSN    Y +     +    +L +D      L +E  + LDREK+ +  +++ A D G P +S   ++T+ I+D NDN P F  S +  E +V EN+PPG  ++ +KAVD D   N E T+   P+T   +   F +   TGEV++K++ID+++DK+ F+F ++ +D    P  +     V +D+ D ND  P I          ++   + E++   T +  IS  D D+    K+           L P I+      N + ++++ K DRE+ S  N  I  TD+          I+  +LDVND+PP F    Y  YIKEN   G++L + +  SD D   N K T S+ +         S+  I+ +N  + S  +FD E++ V ++++ A DHG   L+S+  V+V I D NDN PV+I P      +Q      K   L+  + A D D   N  I Y L++    S FS+  H+G +  + SL  ++  +  + +   D
Sbjct:  827 WWIAGLFHALVIWNIIEAQIRYTIPEELNEGTVVGNIAKDLDLKLSEVFERNLRIDTESGKQFFSVDPVKGELVVKERIDRETLC-------SQSATCLLPLEAIVENPLQLYRVEIEIQDINDNSPVFQNQEKILNIAESTAPGARFRLEAAQDRDVGSNSLRTYTISKNDHFVLDMKLAKDRSQVPELVLE--KPLDREKQPIIILMLTALDGGKPVRSGTAELTIIILDNNDNAPVFEKSQY--ETKVAENTPPGVAVITVKAVDPDEALNKEITYSFGPHTPDIIHMSFSIDTLTGEVKVKNEIDFEADKS-FDFDIVARDKGTPP--MEGLCSVHLDVLDTNDNAPEIVL-------KSLPSPVREDAPIGTVVALISAKDLDTGDNGKISLRLLPGVPFNLKPSIS------NHYTVITDEKLDRESHSVYNVVIVATDSGSPQLTSKQEILVNVLDVNDSPPIFILPFYTVYIKENAAAGSILCS-VSASDPDQGENAKVTYSVFASRVVDPLVSSYVYINSENGSIFSMHSFDYEKIKVFQIQVQAKDHGSPSLSSNATVHVFILDQNDNAPVVIYPSAVMGSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLVEATDASLFSVNLHTGEVRTKRSLLEQDDSSQRLQIKIQD 1463          

HSP 2 Score: 234.187 bits (596), Expect = 1.802e-62
Identity = 188/663 (28.36%), Postives = 325/663 (49.02%), Query Frame = 3
Query:  171 WW--SIFALIDIEGLSSNKI-YRIKEETEIGYVIDYIKPN-DQNNLKIFNTN-----DNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL-FQDNGLYIENTQM---LDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI------ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLI----NQFYISENKQRSLLGVIKATDFD---NQTI-YYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            WW   +F  + +  ++  +I Y I EE   G V+  I  + D    ++F  N     ++G   F ++S+ G+L +  RIDRE +C       S +  C + ++   +N   + R+ I I+D+NDN+P++    + ++  E++  G+R  L  A D+D+GSN    Y +         +  + +G  +    +   LDREK+    I++ A D G P +S + ++TV ++D+NDN P F     + E ++ EN+P  TV+  + AVD D G N +  +  SP+TS  +   FL+   +G +++  KIDY++  + F F +I +D  + P  +     V I++ DIND  P I          ++   + EN+   T +  IS  D D+    KV           L P I+      N + ++++ K DRE+    N  I   D+     ++ + + I +LD NDNPP F++  Y  Y+KE+   G++L + +  SD D   N K + S+      E+P  S+  I+ +N  + S  +FD E++ V ++++ A DHG   L+S+  V+V I D NDN P +I P I    +Q     +K   L+  + A D D   N  I Y L +    S FS+  H+G +  +  L  ++  +  + +   D
Sbjct:   12 WWIAGLFHALVLWNITEAQIRYTIPEELNEGTVVGNIAKDLDLKLSEVFERNLRIASESGKQYFSVDSAKGELVVKERIDRETLC-------SQSVNCLLPLEAIVENPLQLFRVDIEIQDINDNSPVFQNKDSTLNIAESTVPGARFRLEAAKDLDVGSNSLRSYTVSKNEHFVLDIKTETDGTKVPELVLESPLDREKQPTLTILLTALDGGKPARSGKTEITVRVLDINDNAPVFEK--LQYETKIAENTPIETVVSSVIAVDKDEGINSDIRYSFSPHTSDIIRSLFLIDSISGAIKVNDKIDYETGSS-FRFDIIAKDRGIPP--MEGLCSVHIEVLDINDNAPEIVL-------KSLPSPVSENAPIGTVVALISAKDLDTGDNGKVVLTLLPGVPFALKPSIS------NHYTLITDMKLDRESHFVYNVIIIAADSGSPQLTSKQEIPIYVLDANDNPPFFSQTFYTAYVKEDSAAGSILCS-VSASDPDQGENSKISYSVLDSRVLETPVSSYVYINSENGSIYSMHSFDYEKIKVFQIQVQAKDHGSPSLSSNATVHVFILDQNDNAPSVIYPSIVMGSHQRIPRTSKAGHLVTKVTAVDADSGHNAWISYQLAEATDASLFSVNLHTGEVRTKRLLSEQDDSSQRLLIEIQD 648          

HSP 3 Score: 115.931 bits (289), Expect = 1.232e-25
Identity = 165/629 (26.23%), Postives = 286/629 (45.47%), Query Frame = 3
Query:  798 QVTVEIIDVNDNPPKFTDSIFRPEK--QVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-----LVRPTGEV-EIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDN-DKLNPIIAIGT-----NEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSF---FTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATDFD---NQTIYY------LIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD----SLHTASXXXXXXXXDENDNKPIFKNMNKVI----KIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPAS---RESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIA 2570
            +V +EI D+NDN P F +     EK   + E++ PG    L  A D D G+N   T+ +S N       HF     L +   +V E+  +   D +K      ++      +P   S  A + I I D ND  P         + +     + EN+     +  +   D D + L+K    S+     D ++   +I T        NE +  +++ FD       +   R   T     + ++ + +LD NDN PE    +    ++E+ PIGT++   +   D D+ +NGK +L +  PG  F    +I     ++  +   DRE  SV+ + I+A D G  +LTS   + V++ DVND+P I        YI EN    S+L  + A+D D   N  + Y      ++D    S   I   +G +F  +S D E+ +   I V A D    SL +++ TV V ++D+NDN P+    + V+    ++  S   G  + K+ A DAD G+N  + Y L +++    LF+++  +G++    SL  +   D++  L I+  D G+P Q T  + +++      +EP S   +++ +  K S    L   + +A++S L ++   I++A
Sbjct:  933 RVEIEIQDINDNSPVFQNQ----EKILNIAESTAPGARFRLEAAQDRDVGSNSLRTYTISKN------DHFVLDMKLAKDRSQVPELVLEKPLDREKQPIIILMLTALDGGKPVR-SGTAELTIIILDNNDNAPVF-------EKSQYETKVAENTPPGVAVITVKAVDPD-EALNKEITYSFGPHTPDIIHMSFSIDTLTGEVKVKNEIDFEADKSFD------FDIVARDKGTPPMEGLCSVHLDVLDTNDNAPEIVLKSLPSPVREDAPIGTVV-ALISAKDLDTGDNGKISLRL-LPGVPFNLKPSISNHYTVITDE-KLDRESHSVYNVVIVATDSGSPQLTSKQEILVNVLDVNDSPPIFILPFYTVYIKENAAAGSILCSVSASDPDQGENAKVTYSVFASRVVDPLVSSYVYINSENGSIFSMHSFDYEKIKVFQIQVQAKDHGSPSL-SSNATVHVFILDQNDNAPVVIYPSAVMGSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLVEAT-DASLFSVNLHTGEVRTKRSL--LEQDDSSQRLQIKIQDNGEPVQSTTVT-VDVLIEDGFHEPISDYRKKNTELNKKSGKITLYLIISLASVSLLCLMTFFILLA 1528          

HSP 4 Score: 114.005 bits (284), Expect = 5.268e-25
Identity = 162/628 (25.80%), Postives = 278/628 (44.27%), Query Frame = 3
Query:  795 LQVTVEIIDVNDNPPKFT--DSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV--------RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS--DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQ--QNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATDFD---NQTIYY------LIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD----SLHTASXXXXXXXXDENDNKP--IFKN--MNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPAS----RESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIA 2570
             +V +EI D+NDN P F   DS       + E++ PG    L  A D D G+N   ++ +S N      +HF++            E+ ++S +D +   T     +   D      S  +E  + + + DIND  P         +       I EN+   T +  +   D+D      +        +D +  +  I +       I  N K D ET S    +I   D        + ++ I +LD+NDN PE    +    + EN PIGT++   +   D D+ +NGK  L++  PG  F        +  L + +  DRE   V+ + I+A D G  +LTS   + +++ D NDNP   +      Y+ E+    S+L  + A+D D   N  I Y      +++    S   I   +G ++  +S D E+ +   I V A D    SL +++ TV V ++D+NDN P  I+ +  M    +I  +   G  + K+ A DAD G+N  + Y L +++    LF+++  +G++     L      D++  L IE  D G+P Q T  + +++      +EP S    R ++ +KKS     L   + +A++S L ++   I++A
Sbjct:  117 FRVDIEIQDINDNSPVFQNKDSTL----NIAESTVPGARFRLEAAKDLDVGSNSLRSYTVSKN------EHFVLDIKTETDGTKVPELVLESPLDREKQPT-LTILLTALDGGKPARSGKTE--ITVRVLDINDNAPVF-------EKLQYETKIAENTPIETVVSSVIAVDKDEGINSDIRYSFSPHTSDIIRSLFLIDSISGA---IKVNDKIDYETGSSFRFDIIAKDRGIPPMEGLCSVHIEVLDINDNAPEIVLKSLPSPVSENAPIGTVV-ALISAKDLDTGDNGKVVLTL-LPGVPFALKPSISNHYTLITDMKLDRESHFVYNVIIIAADSGSPQLTSKQEIPIYVLDANDNPPFFSQTFYTAYVKEDSAAGSILCSVSASDPDQGENSKISYSVLDSRVLETPVSSYVYINSENGSIYSMHSFDYEKIKVFQIQVQAKDHGSPSL-SSNATVHVFILDQNDNAPSVIYPSIVMGSHQRIPRTSKAGHLVTKVTAVDADSGHNAWISYQLAEAT-DASLFSVNLHTGEVRTKRLLS--EQDDSSQRLLIEIQDNGEPVQSTTVT-VDVLIEDGFHEPISDYRKRTTELNKKSG-KITLYLIISLASVSLLCLMTFFILLA 713          

HSP 5 Score: 95.1301 bits (235), Expect = 3.167e-19
Identity = 126/483 (26.09%), Postives = 208/483 (43.06%), Query Frame = 3
Query: 1020 GEVEIKSKIDYDSDKTHFEFKVIVQDHAVE-PYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLD-NDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD--HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDS-----FFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQ-RSLLGVIKATDFD----NQTIYYLIDNKSQS-KFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPLFN---LDSDSGDLHLAVSLHTIRPIDTNTF-LDIEACDQGQPN 2396
            GE+ +K +ID ++  +     ++  +  VE P  L     V+I+IQDIND  P      +N DS       L  + +  P  +  +       +      SY +  N+     I   T+      +V     DRE +  L   +   D      S    +T+ +LD+NDN P F K  Y   I EN PI T++ + + V DKD   N     S  SP  S      F ID  +  +K     D E  S  +  I+A D G   +   C V++ + D+NDN P I+   +    +SEN    +++ +I A D D     + +  L+     + K SI  H   L     LDRE    +++ + A+DS     T+   + + V+D NDN P F        +    + G  +C + A+D D G N  + Y +L     + P+ +   ++S++G ++   S+H+        F + ++A D G P+
Sbjct:   82 GELVVKERIDRETLCSQSVNCLLPLEAIVENPLQLFR---VDIEIQDINDNSPVF----QNKDST------LNIAESTVPGARFRLEAAKDLDVGSNSLRSYTVSKNEHFVLDIKTETDGTKVPELVLESPLDREKQPTLTILLTALDGGKPARSGKTEITVRVLDINDNAPVFEKLQYETKIAENTPIETVVSSVIAV-DKDEGINSDIRYSF-SPHTSDIIRSLFLIDSISGAIKVNDKIDYETGSSFRFDIIAKDRGIPPMEGLCSVHIEVLDINDNAPEIVLKSLPS-PVSENAPIGTVVALISAKDLDTGDNGKVVLTLLPGVPFALKPSISNHY-TLITDMKLDRESHFVYNVIIIAADSGSPQLTSKQEIPIYVLDANDNPPFFSQTFYTAYVKEDSAAGSILCSVSASDPDQGENSKISYSVLDSRVLETPVSSYVYINSENGSIY---SMHSFDYEKIKVFQIQVQAKDHGSPS 544          

HSP 6 Score: 93.5893 bits (231), Expect = 8.466e-19
Identity = 124/491 (25.25%), Postives = 202/491 (41.14%), Query Frame = 3
Query:  993 EKHFLVRPT-GEVEIKSKIDYDSDKTHFEFKVIVQDHAVE-PYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLD-NDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD--HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSF----FTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGVIKATDFDNQ-----TIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFN----LDSDSGDLHLAVSLHTIRPIDTNTF-LDIEACDQGQPN 2396
            ++ F V P  GE+ +K +ID ++  +     ++  +  VE P  L     VEI+IQDIND  P      +          IL  + +  P  +  +     + +      +Y +  ND     + +  +      +V  +  DRE +  +   +   D      S    LTIIILD NDN P F K  Y   + EN P G  +     V D D   N + T S            F+ID     +K K   D E        I+A D G   +   C V++ + D NDN P I+   +      +    +++ +I A D D       ++  L       K SI  H   +     LDRE    +++ + A+DS     T+   + V V+D ND+ PIF      + I  + + G  +C + A+D D G N  V Y +  S   +PL +    ++S++G +    S+H+        F + ++A D G P+
Sbjct:  887 KQFFSVDPVKGELVVKERIDRETLCSQSATCLLPLEAIVENPLQLYR---VEIEIQDINDNSPVFQNQEK----------ILNIAESTAPGARFRLEAAQDRDVGSNSLRTYTISKNDHFVLDMKLAKDRSQVPELVLEKPLDREKQPIIILMLTALDGGKPVRSGTAELTIIILDNNDNAPVFEKSQYETKVAENTPPGVAVITVKAV-DPDEALNKEITYSFGPHTPDIIHMSFSIDTLTGEVKVKNEIDFEADKSFDFDIVARDKGTPPMEGLCSVHLDVLDTNDNAPEIVLKSLPSPVREDAPIGTVVALISAKDLDTGDNGKISLRLLPGVPFNLKPSISNHY-TVITDEKLDRESHSVYNVVIVATDSGSPQLTSKQEILVNVLDVNDSPPIFILPFYTVYIKENAAAGSILCSVSASDPDQGENAKVTYSVFASRVVDPLVSSYVYINSENGSIF---SMHSFDYEKIKVFQIQVQAKDHGSPS 1359          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 238.81 bits (608), Expect = 1.497e-64
Identity = 249/872 (28.56%), Postives = 403/872 (46.22%), Query Frame = 3
Query:  120 PFLFFERLSIANMNSLLWWSIFALIDIEGLSSNKIYRIKEE----TEIGYVIDYIKPNDQNNLK---------IFNTNDNGVNCFELESSTGKLFITR-RIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTI-AFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD--NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS--LHTASXXXXXX-XXDENDNKPIFKNMNKVIKIDA---SESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF-LDIEACDQGQPN--QCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN-----------VLIAAISGLLVLMIIIMIAFIV 2579
            P L  +  S A++  L+   + +L      +  K Y +KEE      IG +   +  N   N+K         ++ T D  V    +E+STG++F T  RIDRE +C        N ++C  E+ + +    I  + ++  +IED+NDNAP++ +    +S  EN+ I +R  +P A D D+G NG   Y +  K  + F L        D    +   Q LDRE K+ + + I  +D G+P KS+   + V + DVNDN P F DS    E  V EN+P GT +  L A D D G+N +  F  S   SP  ++HF +   TG + +K  +D +S+  H +  V+  D +  P    S A V +++ D+ND  P+I   Y  NP + T+   + EN+   T I  I+V DRD+    KV C   + D+D   +L P+        ++F + +    D ET  +   +I  +D+     +T   + I I D NDN P F +      I EN   GT L  ++  +D DS +N     S+       F ID ++ IL      DRE+   +   ++A D+G   L S+  V + ++D NDN    T     FY+ EN      +G+I  TD D  +  I  L     +  F I+  +G +    + DRE+Q ++   V A DS  + T S     + VVD NDN+P+F   +     D    + +PG  + ++ A D D G N  ++Y +   S +  LF +D  +G++ L      I   D     L ++  D GQP          L +  T +       +  KS ++  D+ + ++           V+IA I+G + ++++I +  +V
Sbjct:   37 PTLSMDLASEAHVLVLILTCLVSLC----WAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGD--VPLVRVEASTGEIFTTANRIDRERLCSG----VFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYEL-VKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDS--EVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVH-KLIVLASDGSATP----SRATVIVNVTDVNDNVPSIDTRYIMNPVNGTV--LLSENAPLNTKIALITVTDRDADLNGKVTC---YTDHDVPFRLKPVFN------DQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLI-KITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRG-LFAIDKTTGNITLQ---EKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFLQEQVRKSMETPLDKNVGDSDILPQTNGYVIVVIAIIAGTMTVILVIFVTALV 874          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh1g9 (protocadherin 1 gamma 9 [Source:ZFIN;Acc:ZDB-GENE-050609-5])

HSP 1 Score: 236.113 bits (601), Expect = 2.106e-64
Identity = 203/666 (30.48%), Postives = 333/666 (50.00%), Query Frame = 3
Query:  162 SLLWWSIFALI-DIEGLSSNKIYRIKEETEIGYVIDYIKPN------DQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESK--YRNSFRLFQDNGLYIENT--QMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHS--TVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI------ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITP------LINQFYISENKQRSLLGVIKATDFD---NQTI-YYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            +  W   F+L+ +I G  +   Y I EE + G+V+  +  +      D  + K+   +++    F ++S  G+L +  RIDRE+IC       + +  C + +++  ++   + R+ I I+DVNDN+P + T  A +   E+  +G+R SL  A D+D+GSN    Y +     +R + +  +D     E    + LDREK++V+++I+ A D G+P KS    + + + DVNDN PKF  + ++    V E++  G+ +L LKA D D G NGE  +  S +T+  V++ F V P TG++ +   +DY++ K+ + F V  +D       L   + V+IDI D ND  P I        ++  NP + EN++  T +  I+V D DS    KV          KL P         N +++V+    DRE +S+ N EI   D+   S  T K + + +LDVNDN P F++ +Y  Y+KEN P G  L +   V D D + N   T SI      + P  S+F I+ +N  + S  TFD E++ +  + + A DHG   L+S+  ++V I D NDN P +I P      + +Q      K   L+  + A D D   N  I Y L +    S FS+  H+G +  + SL  ++  +  + +   D
Sbjct:   12 AAFWLLGFSLLWNITG--AQIRYTIPEELKEGFVVGNLAKDLGLDVSDIASRKLRLASESNRQYFHVDSEKGELVVNGRIDREQIC-------AESSSCLLPLQVVIEDPLQLHRVEIEIQDVNDNSPNFHTKDATLKVAESVALGARFSLESAEDLDVGSNSLSSYSLSRNEFFRLNVKTLKDGRKVPELVVDKPLDREKQSVHKLILTALDGGNPVKSGTALLQIFVQDVNDNEPKFELAAYK--AHVTESAVVGSSVLTLKASDLDEGLNGEILYIFSTHTTELVKRAFKVNPNTGDITVIGDLDYETTKS-YTFDVCAKDKGYP--ELEGHSSVQIDIVDENDNAPEIIL------TSLPNP-VPENATVGTVVALINVRDLDSAENGKVQLNISPEFPFKLKPSFD------NHYSLVTGSVLDREDKSEYNVEIVAHDSGVPSLKTTKFVHVKVLDVNDNRPAFSQSSYSVYVKENNPAGGSLFSVTAV-DIDKDKNAMLTYSIVELHLNKVPMSSYFYINSENGTIYSMSTFDYEKLKMLNVVVQAKDHGSPSLSSNTTIHVFILDQNDNAPAVIYPSAVIGSVSHQRIPRTAKAGHLVTKVTAVDADSGHNAWISYRLAEATDASMFSVNLHTGEVRTKRSLSEQDDSSQRLLIEIQD 649          

HSP 2 Score: 99.3673 bits (246), Expect = 1.156e-20
Identity = 167/634 (26.34%), Postives = 280/634 (44.16%), Query Frame = 3
Query:  798 QVTVEIIDVNDNPPKF--TDSIFRPEKQVFENSPPGTVILLLKAVDHDFGN---------NGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPII--AIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS-----DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI--ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENK-QRSLLGVIKATDFD---NQTIYYLID----NK--SQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD----SLHTASXXXXXXXXDENDNKPIFKNMNKVI------KIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPAS---RESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIA 2570
            +V +EI DVNDN P F   D+  +    V E+   G    L  A D D G+           EF FR++  T  +  K        E+ +   +D +    H   K+I+          S  A+++I +QD+ND  P           A     + E++   + +  +   D D +GL+    E  ++ +     ++  A   N PN  +I      D ET      ++   D        HS+V+   I I+D NDN PE    +    + EN  +GT++   + V D DS  NGK  L+I  E P     + D    ++   V  DRE  S + ++I+A D G   L ++  V+V + DVNDN    +      Y+ EN      L  + A D D   N  + Y I     NK    S F I   +G ++  ++ D E+ +  ++ V A D    SL +++TT+ V ++D+NDN P     + VI      +I  +   G  + K+ A DAD G+N  + Y L +++    +F+++  +G++    SL      D++  L IE  D G+P Q T  + +++      +EP S   ++S +  K S    L   + +A++S L ++   I++A
Sbjct:  117 RVEIEIQDVNDNSPNFHTKDATLK----VAESVALGARFSLESAEDLDVGSNSLSSYSLSRNEF-FRLNVKTLKDGRK------VPELVVDKPLDREKQSVH---KLILTALDGGNPVKSGTALLQIFVQDVNDNEPKFEL-------AAYKAHVTESAVVGSSVLTLKASDLD-EGLNG---EILYIFSTHTTELVKRAFKVN-PNTGDITVIGDLDYETTKSYTFDVCAKDKGYPELEGHSSVQ---IDIVDENDNAPEIILTSLPNPVPENATVGTVV-ALINVRDLDSAENGKVQLNISPEFPFKLKPSFDNHYSLVTGSV-LDREDKSEYNVEIVAHDSGVPSLKTTKFVHVKVLDVNDNRPAFSQSSYSVYVKENNPAGGSLFSVTAVDIDKDKNAMLTYSIVELHLNKVPMSSYFYINSENGTIYSMSTFDYEKLKMLNVVVQAKDHGSPSL-SSNTTIHVFILDQNDNAPAVIYPSAVIGSVSHQRIPRTAKAGHLVTKVTAVDADSGHNAWISYRLAEAT-DASMFSVNLHTGEVRTKRSLS--EQDDSSQRLLIEIQDNGEPVQSTTVT-VDVLIEDGFHEPISDYRKKSTELNKKSGKITLYLIISLASVSLLCLMTFFILLA 714          

HSP 3 Score: 64.6994 bits (156), Expect = 4.841e-10
Identity = 109/458 (23.80%), Postives = 188/458 (41.05%), Query Frame = 3
Query: 1020 GEVEIKSKID-----YDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD--HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK----FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNP--VIITPLINQFYISENKQ-RSLLGVIKATDFDNQTIYYLIDNKS-----QSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS----LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPL---FNLDSDSGDLH 2312
            GE+ +  +ID      +S       +V+++D    P  L     VEI+IQD+ND  P   F+ ++          L    ++     + V             E + L+   L      G   P    +V ++  DRE +S     +   D  +   S    L I + DVNDN P+F    Y  ++ E+  +G+ +   +  SD D   NG+    F+          F ++     +      D E    +   + A D G   L     V + I D NDN   +I+T L N   + EN    +++ +I   D D+     +  N S     + K S + H   L   + LDRE++  +++ + A DS    L T +  V V V+D NDN+P F   +  + +  +   G  +  + A D D   N ++ Y I++    K P+   F ++S++G ++
Sbjct:   81 GELVVNGRIDREQICAESSSCLLPLQVVIED----PLQLHR---VEIEIQDVNDNSPN--FHTKDATLKVAESVALGARFSLESAEDLDVGSNSLSSYSLSRNEFFRLNVKTLKD----GRKVPE---LVVDKPLDREKQSVHKLILTALDGGNPVKSGTALLQIFVQDVNDNEPKFELAAYKAHVTESAVVGSSVLT-LKASDLDEGLNGEILYIFSTHTTELVKRAFKVNPNTGDITVIGDLDYETTKSYTFDVCAKDKGYPELEGHSSVQIDIVDENDNAPEIILTSLPNP--VPENATVGTVVALINVRDLDSAENGKVQLNISPEFPFKLKPSFDNHYS-LVTGSVLDREDKSEYNVEIVAHDSGVPSLKT-TKFVHVKVLDVNDNRPAFSQSSYSVYVKENNPAGGSLFSVTAVDIDKDKNAMLTYSIVELHLNKVPMSSYFYINSENGTIY 517          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 238.81 bits (608), Expect = 3.325e-64
Identity = 236/801 (29.46%), Postives = 377/801 (47.07%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFITR-RIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTI-AFYPRNPDSATMNPTIL--ENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD--NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS--LHTAS-XXXXXXXXDENDNKPIFKNMNKVIKIDA---SESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF-LDIEACDQGQPN--QCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN-----------VLIAAISGLLVLMIIIMIAFIV 2579
            ++ T D  V    +E+STG++F T  RIDRE +C        N ++C  E+ + +    I  + ++  +IED+NDNAP++ +    +S  EN+ I +R  +P A D D+G NG   Y +       F L        D    +   Q LDRE K+ + + I  +D G+P KS+   + V + DVNDN P F DS    E  V EN+P GT +  L A D D G+N +  F  S   SP  ++HF +   TG + +K  +D +S+  H +  V+  D +  P    S A V +++ D+ND  P+I   Y  NP    +N T+L  EN+   T I  I+V DRD+    KV C   + D+D   +L P+        ++F + +    D ET  +   +I  +D+     +T   + I I D NDN P F +      I EN   GT L  ++  +D DS +N     S+       F ID ++ IL      DRE+   +   ++A D+G   L S+  V + ++D NDN    T     FY+ EN      +G+I  TD D  +  I  L     +  F I+  +G +    + DRE+Q ++   V A DS  + T S   VT+ VVD NDN+P+F   +     D    + +PG  + ++ A D D G N  ++Y +   S +  LF +D  +G++ L      I   D     L ++  D GQP          L +  T +       +  KS ++  D+ + ++           V+IA I+G + ++++I +  +V
Sbjct:   66 VYKTGD--VPLVRVEASTGEIFTTANRIDRERLCSG----VFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKVGALEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDS--EVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVH-KLIVLASDGSATP----SRATVIVNVTDVNDNVPSIDTRYIMNP----VNGTVLLSENAPLNTKIALITVTDRDADLNGKVTC---YTDHDVPFRLKPVFN------DQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLI-KITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRG-LFAIDKTTGNITLQ---EKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFLQEQVRKSMETPLDKNVGDSDILPQTNGYVIVVIAIIAGTMTVILVIFVTALV 835          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 238.424 bits (607), Expect = 4.117e-64
Identity = 252/874 (28.83%), Postives = 405/874 (46.34%), Query Frame = 3
Query:  120 PFLFFERLSIANMNSLLWWSIFALIDIEGLSSNKIYRIKEE----TEIGYVIDYIKPNDQNNLK---------IFNTNDNGVNCFELESSTGKLFITR-RIDREEICPTNRLLKSNNQQC--EVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTI-AFYPRNPDSATMNPTIL--ENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND---KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD--NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDA---SESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF-LDIEACDQGQPN--QCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNEN-----------VLIAAISGLLVLMIIIMIAFIV 2579
            P L  +  S A++  L+   + +L      +  K Y +KEE      IG +   +  N   N+K         ++ T D  V    +E+STG++F T  RIDRE +C        N ++C  E+ + +    I  + ++  +IED+NDNAP++ +    +S  EN+ I +R  +P A D D+G NG   Y +  K  + F L        D    +   Q LDRE K+ + + I  +D G+P KS+   + V + DVNDN P F DS    E  V EN+P GT +  L A D D G+N +  F  S   SP  ++HF +   TG + +K  +D +S+  H +  V+  D +  P    S A V +++ D+ND  P+I   Y  NP    +N T+L  EN+   T I  I+V DRD+    KV C   + D+D   +L P+        ++F + +    D ET  +   +I  +D+     +T   + I I D NDN P F +      I EN   GT L  ++  +D DS +N     S+       F ID ++ IL      DRE+   +   ++A D+G   L S+  V + ++D NDN    T     FY+ EN      +G+I  TD D  +  I  L     +  F I+  +G +    + DRE+Q ++   V A DS     T+   VT+ VVD NDN+P+F   +     D    + +PG  + ++ A D D G N  ++Y +   S +  LF +D  +G++ L      I   D     L ++  D GQP          L +  T +       +  KS ++  D+ + ++           V+IA I+G + ++++I +  +V
Sbjct:   37 PTLSMDLASEAHVLVLILTCLVSLC----WAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGD--VPLVRVEASTGEIFTTANRIDRERLCSG----VFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYEL-VKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDS--EVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVH-KLIVLASDGSATP----SRATVIVNVTDVNDNVPSIDTRYIMNP----VNGTVLLSENAPLNTKIALITVTDRDADLNGKVTC---YTDHDVPFRLKPVFN------DQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLI-KITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRG-LFAIDKTTGNITLQ---EKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFLQEQVRKSMETPLDKNVGDSDILPQTNGYVIVVIAIIAGTMTVILVIFVTALV 874          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.593 bits (501), Expect = 3.553e-52
Identity = 209/795 (26.29%), Postives = 346/795 (43.52%), Query Frame = 3
Query:  222 IYRIKEETEIGYVIDYIKPNDQNNL--KIFNTNDNGVNCFELESST--------GKLFITRRIDREEIC---PTNRLLKSNNQQCEVTIKLTHQNINFVQRLSI--IIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL-----------------------FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPN-TSPEVEKHFLV-RPTGEVEIKS--KIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRN----PDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPN--EFNIVSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEF--------NKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDS---FFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVII-----TPLINQFYISENKQ-RSLLGVIKATDFDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNS-------------LDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFK--NMNKVIKIDASESPGFKI--CKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTI 2336
            +Y + EE  +GYVI  ++   Q+NL    F      V+   L + +        G+L +  R+DRE +C   P            +V      Q  + ++ L +  ++ D+ND+AP +      VS +E+  +G R  LP A D D G+N    YR+ +   +  +L                          +   +E  + LDRE    YE+++  +D G+P  S  + +T+ ++D NDN P F D   RP + + E+S  GT ++ L+A D D G NG   +      TS   +    V   TG V +++  K+D ++   H    V+ +D      S S+   V +++ D ND  P            PD       I+EN  + TP+  ISV D D      V     F    +L          PN  +F + + R  D E   + N  +   D  T   S + NL I ++D+NDN P F        +   Y   ++EN P GT++ N +  +D DS  NG   FTLS  + G+S    F+++ +   L      DRE+   ++L + A D G  +  +  IV V + D NDN P  +     T  + QF++ E     + +G +  +D D         + ++   ++ + +G  ++  +             LDRE++  + ++V A DS     +AS  V++ V D NDN P+    N N   K   + SP   +    + A D D G+NG   Y +   + K  +F L++DSG L LA ++ ++
Sbjct:   30 LYEVDEEVLVGYVIGDLR---QSNLLCVCFFPPAPHVSPLPLHTPSLCIVNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVR-ITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVH-RLVVVARDGG--QLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGV---KIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAEL--------ASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLN-LLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDE-------GDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKG-IFLLNADSGALSLARTVSSL 797          

HSP 2 Score: 85.8853 bits (211), Expect = 3.397e-17
Identity = 89/341 (26.10%), Postives = 159/341 (46.63%), Query Frame = 3
Query: 1485 LTIIILDVNDNPPEF-NKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFT-----IDQQNQIL--KSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSL--------LGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNS--LDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKV--------IKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEP---LFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQ 2399
            LTI+++D NDN P F +  T    I E+  +GT +  ++  +D D+  NG    S  +   S  T     +D    ++  ++    DRE + VH+L ++A D G    ++S  V V + D NDN PV     +   Y+ +   + +        + +I  +D D   + T+   ++  + ++ +   +  +  L+ +  LD EE + ++++V A+D      +    + + VVD NDN P+F N   +        + +  +   G  +  ++ATDAD G NG + + L + +  E    LF+L+  +G L LA  L   R       L +EACD G P +
Sbjct:  258 LTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSV-VQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELA-SPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLD--REKRMRYELSVEACDGGSPQR 594          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.438 bits (498), Expect = 3.391e-51
Identity = 194/723 (26.83%), Postives = 334/723 (46.20%), Query Frame = 3
Query:  330 CFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVR-PTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNE-FNIVSNRK------FDRETESKLNAEIRCTDTSDHSTVKNLT--IIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQV------SVHKLKILAIDHGDER-LTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATDFD---NQTIYYLIDNKSQ-SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHT---ASXXXXXXXXDENDNKPIFKNMNKVIKIDASESP--GFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNT----FLDIEACDQGQPNQCT 2405
             F L+S TGK+   + +DREE+     ++++ ++            +    ++++++ D+NDN P++   +   S  EN P G+  +   ATD D G+NG V Y++ +     F++    G  +     LDRE++ VY++ + A D G     +   VT+ + D  D PP F    +     VFEN  PGT++  + A   D   N   T+ +    S +    F +    G +   + ID + ++  ++ +V+     V     + EA V + + D+N+  P         D A+   +I E+    +    +   D+DS    +V  E              IG     E F I  + +       DRET  + +  +   DT       ++T  + +LDVNDN P FN  +Y F+  E + +G+++   +  +D D+ +NG  T S E P    F +D +   + S   FDRE +      +     ++A D G  + L     V V ++DVNDNP      + Q  +SE+    + L  + A+D D   N  + Y I+  ++  KF+++  +G++ L  SLDREE  ++ + V+A+DS  +   AS TV V V+DENDN P F     ++ +DA ES   G  +  + A+D D G +G V+Y +   +     F +D  +G + LA      R +D  T     L++ A D G+P + +
Sbjct:  496 MFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSP--------PLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGA-VSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDY--SFVVFENVAPGTLVGSVSASTLDL--NANVTYLI---VSGDQRGSFSIEWSGGRIFTANAIDRE-EQAFYQLRVVANSGGV-----AGEASVSVLVHDVNNHAPVF-------DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYE--------------IGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLV-GAVQATDADAGSNGGVTYSFEKP-QVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF--TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGN-THATFAIDRSTGSVFLA------RRLDFETQRLYRLNVSAEDGGRPPRSS 1164          

HSP 2 Score: 183.726 bits (465), Expect = 3.228e-47
Identity = 199/735 (27.07%), Postives = 327/735 (44.49%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYR----MESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEK---QVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMF---VSDKDSNNNGKFTLSI-ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQ----FYISENKQ-RSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREE------QETHHITVTASDSLHTASXXXXXX----XXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQ---PNQCTI 2408
            I + ND G   F ++ STG +    ++DRE        + + +Q  +     T         L++ + DVND  P++T  K + +  ENS  G       A D D+G NG V Y     M ++YR  FRL    G  +   + LDRE+   Y +++ AQD GSP   +  +VTV + D+NDN P     +F P +    + EN P GT +  + A D D G NG   ++++   +   + + +   TG V  +  +D + ++  ++ +V   D         S A+V I + D  D  PT A      D  +    + EN +  T +G +S     +  LD     +Y + +       +I   E +   I +    DRE ++     +   ++   +   ++++++ DVN++ P F++ +Y   I E+EP+    ++R F    +DKDS  NG+    I E  G   F I    Q L  +   DRE    + L + A+D G E L+SS  V V + DVNDN     PL N     F+  E ++  SL+G ++ATD D   N  + Y  + K Q  F ++  +GR+      DRE         +   +V A+D                V D NDN P F        +  S S   ++ ++ A+D D G NG ++Y + + + +   F +D+ +G + L  SL   R    +  L + A D G       CT+
Sbjct:  380 IVSGNDLG--WFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTS--------LTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTG-KVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHP-----VFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAV---TGAVSTRVSLDRE-ERAVYQLQVTALDGG--HLRARSPAIVTITVADAQDTPPTFAR-----DDYSF--VVFENVAPGTLVGSVS-----ASTLDLNANVTYLIVSGDQRGSFSI---EWSGGRIFTANAIDREEQAFYQLRV-VANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPV----NSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQ-LYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDN----KPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE-KPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGN-EGGKFTVDASTGQITLLGSLD--REETASYTLVVSATDSGTSPLAASCTV 1063          

HSP 3 Score: 181.415 bits (459), Expect = 1.811e-46
Identity = 188/701 (26.82%), Postives = 305/701 (43.51%), Query Frame = 3
Query:  327 NCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM-ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVF---ENSPPGTVILLLKAVDHDFGNNGEFTFRM-SPNTSPEVEKHFLVRPTGEVEIKSKIDYDS-----DKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNR-------KFDRETESKLNAEIRCTDTSDHSTVKNLTII--ILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSF--FTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN---KQRSLLGVIKATDFD-NQTIYYLIDNK--SQSKFSIEKHSGRLFLQNSLDRE-EQETHHITVTASDS---LHT---ASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
              F +E S G++F    IDREE               ++ +      +     +S+++ DVN++AP++      VS  E+ P+ SR     ATD D G NG+V Y + E      F +F D  LY+     LDRE +  Y + + A D G    S+ + V V ++DVNDN P F  S +     VF   E    G+++  ++A D D G+NG  T+    P  + E++       TG +      D ++         F F V+  D    P  L   A V++ +QD+ND  P  A        +    ++ E++S +T + +++  D D +G+           N  L   I  G NE  +F + ++          DRE  +     +  TD+       + T+   +LD NDNPP F +        E+  +G +L   +  SD+D+  +G    +I + G++   F ID+    +      D E   +++L + A D G    +S+ I+ VH++D NDNP    P      I EN     R +    +  D D N  ++Y I  +    + F+I+  SG +     +DRE       +TV A+D    +HT   A   VTV+V DENDN P F     ++      + G  +  + A+D D   N  V+Y +        LF LD  +G +  +  L
Sbjct:  702 GSFSIEWSGGRIFTANAIDREE-----------QAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVR--YELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSY-----VFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSE-----TGRIASLRVFDREALIRQGGAASFSFSVVATDGG-RPKPLQDRATVQVFVQDVNDNPPQFA-------KSVYQASVSESASNLTQLLRVTASDVD-EGV-----------NGALRYAINEG-NEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLIT-LTASDEDTGPSGDVRYAIVA-GNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGD-AAILFRLDRRTGIIETSTEL 1355          

HSP 4 Score: 173.711 bits (439), Expect = 4.578e-44
Identity = 182/642 (28.35%), Postives = 285/642 (44.39%), Query Frame = 3
Query:  486 LSIIIEDVNDNAPIWTTDKAI-VSFNENSPIGSRRSLPEATDIDIGSNG--QVIYRM-----ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPII-AIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD---HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD-SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQF-YISENKQRSLLGV----IKATDFD---NQTIYYLID----NKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
            + +++ DVNDNAP +     + V+F E++ +G +  L  A D D+G NG     Y++     E +      + +   L++  T  LDRE    Y + + A+D GSP +   LQV V + D NDNPP F    +R    V E+SP G     L+ + H     G       P              TG V  +  +D+++ +  +   +   D    P  LS  A   I + D+ND  P I F    P  A  + ++ E+++  T    ++V D DS   +     S    N++ + ++ A G        + S  + DRE     N  I  +D       S   +L + + DVND+ P F    Y   + E  P G+ + + +   D DS  N K   SI S  D  +F++D+   ++ +    DRE  S   L I A D G +  T+   + V + DVND P    PL  Q  Y++   + SL G+    + A D D   N T+ Y  D     + +  F ++  +G++    SLDREE E + + V A D       ++  VTVVV D NDN P+F  +     I  +E  G  +  + ATD D G NG V+Y L         F +++ +G +   VSL
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYR--ASVAEDSPVGAA---LRDLLHR--GRGPLAVPFDPK-------------TGMVSTRQPLDFEA-RRQYTLSLRAADGGNPP--LSGRATAVIQLLDVNDNDPAIRFVYLPP--AARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVAS--QLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKD-VTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEP----PLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR--FQVNAVTGAVSTRVSL 616          

HSP 5 Score: 172.555 bits (436), Expect = 9.102e-44
Identity = 196/728 (26.92%), Postives = 318/728 (43.68%), Query Frame = 3
Query:  279 NDQNNLKIFNTNDNGVNCFELESSTG--KLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKY-RNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNR-KFDRETESKLNAEIRCTDTSDHSTVKN---LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSL---HTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHT------IRPIDTNTF-LDIEACDQGQP 2393
            N + ++ I   N+ G          G   L +  ++DRE I   N  + +++    V    T         L + + DVND+AP +       + +E +P GS      A D D G N ++ Y + S      F + +  GL   + ++ DRE  +   + I AQD G+  K+    +TV ++DVND PP FT + +       ENS PG  ++ + A D D G NG   +   P+   +  + F L   TG+V     +D + +   +   V  QD    P  L S A V + + D+ND  P   FYP          +ILEN    T +  ++  D D      V  +    D  +       G         VS R   DRE  +    ++   D   H   ++   +TI + D  D PP F +  Y F + EN   GT++ + +  S  D N N  + L +       F+I+     + +    DRE+ + ++L+++A   G   +     V V + DVN++  +      +  I+E++   S    ++ATD D     +  Y + +     KF I    G+L+++  LDRE +E + +TV+A D+     ++S TV V V+D NDNKP+F + + V      +  G  +  + ATDAD G+NG V Y  +K       F LDS++G +    SL        IR     +F   + A D G+P
Sbjct:  263 NGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATAS-------LVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKV-DREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKY--VATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDRE-ELEEYPLVVQAQDRGSPP--LGSTAKVTVVVGDLNDNHPV--FYP-----VQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGA--------VSTRVSLDREERAVYQLQVTALD-GGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGS-VSASTLDLNANVTY-LIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPD-GQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN---FELDSETGRI---ASLRVFDREALIRQGGAASFSFSVVATDGGRP 949          

HSP 6 Score: 157.918 bits (398), Expect = 3.103e-39
Identity = 165/616 (26.79%), Postives = 277/616 (44.97%), Query Frame = 3
Query:  483 RLSIIIE--DVNDNAP----IWTTDKA-IVSFNENSPIGSRRSLPEATDIDI-GSNGQV-IYRMESKYRNSFRLFQDN--GLYI-ENTQMLDREKKNVYEIIIIAQDNGSPY-KSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD---HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD-NQTIYYLIDNKSQ-SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKE 2273
            R + +I+  DVNDN P    ++    A   S +E++  G+  +L   TD D   +NG++ +  +    R  F L      GL + +    LDRE+  +Y + I+A DNG P  +S    + V + DVND+ P+F  S +     + E +P G+ +  + A+D D G N +   R S  +  ++    +   TG V    K+D +   +     +  QD   +P +  +   + + + D+NDE P                T +ENS     +  +S  D D   L +     Y  D D       +   +     + + +  DRE   +    ++  D       ST K +T+++ D+NDN P F    Y   I ENEP        +  +D D   NG     + +   + F ++     + ++V+ DRE+ +V++L++ A+D G  R  S  IV + + D  D P         F + EN    +L+G + A+  D N  + YLI +  Q   FSIE   GR+F  N++DREEQ  + + V A+        +V+V+V D N++ P+F   +  + I   E    +   + ATD D G NG VKY + + +  E
Sbjct:  208 RATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAY--AAALSEGAPAGSYVKDVTAMDADSGLNAKL--RYSIVSGNDLGWFSVDESTGLVTTDGKVDREV-ASSVVLNISAQDQGAQPKTAYTS--LTVTLLDVNDEPPLFT-------QTKYVATAVENSLPGLFVVSVSAADSD---LGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAK-VTVVVGDLNDNHPVFYPVQYFASILENEPG-GTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGE 804          

HSP 7 Score: 154.836 bits (390), Expect = 3.368e-38
Identity = 181/665 (27.22%), Postives = 285/665 (42.86%), Query Frame = 3
Query:  180 IFALIDIEGLSSNKIYRIKEETEIGYVIDYIKPND----QNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFN---ENSPIG-SRRSLPE---ATDIDIGSNGQVIYRM----ESKYRN-SFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFT-DSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYS-LSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPN-EFNIVSN-----RKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSF--FTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVND-NPVI-ITPLINQFYISENKQRSLLGVIKATDFDN------QTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            +FA+ ++E         ++E T  G VI  +   D    QN L  ++        F +++++G L  +RR+DREE                +T++ +        RLS+ + D NDN+P ++  +   SF+   + +P G + R++     A D D G  G+V Y +    +S + + +F L    G  +  T+ LDRE +  Y +   A D G    +  L V V  +D NDN P    DS+     +V E++PPGT +L + A D D G N E  F +S   S + E  F V   G++ +   +D +  ++ +   V V D A  P + LSS   V + + D+ND  P       +P SA + P   E+S     +  +   D DS     V    Y L  D        G        N V+      R+ DRE        +   D      ++   L + + D NDN P F +  Y   I E+EP GT +  R+   D D   NG+    I S GD    F +D     L      DRE+ + ++L + A D G    + +  V V + DVND +P   ++P     +  EN Q   + +++    D+      Q  Y          FS+    G + L  SLDRE Q  H + +TA+D
Sbjct: 1515 VFAVPEME-------LEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREE-----------RASYLLTVRASDGTHATDARLSVAVRDANDNSPRFS--RHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGA-LNVTRPLDRESRACYVLRARATDGGGLAATARLYVNV--LDANDNAPSVQNDSL---AAEVPEDAPPGTSLLRISATDDDEGVNAELEFSIS---SGDPEGRFAVGNDGQLSVARALDRER-QSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT----SPRSA-LAP---EDSPVGAVVATVQAVDPDSGRNSYVE---YALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEV-LRLSAWDPDEGANGELRYDIAS-GDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYT--VHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPD-GHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 8 Score: 145.976 bits (367), Expect = 1.667e-35
Identity = 161/648 (24.85%), Postives = 287/648 (44.29%), Query Frame = 3
Query:  483 RLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPG-----TVILLLKAVDHDFGNNGEFTFRMSPNT-SPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYF-LDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDH-----STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNG--KFTLSIESPGDSFFTIDQQNQILKSKVT--------FDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFD------NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTA---SXXXXXXXXDENDNKPIFK-NMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
            ++ I +EDVNDN P++   +  +   EN+  G       ATD D G N  V Y + S    +F +   +G+ +  ++ LDRE++  Y + + A D      + + +++V + D NDN P+F+   +     V E++ P       VI  + A D D G  GE T+ ++P+  S   +  F + P TG + +   +D +S   +     +++  A +   L++ A + +++ D ND  P++        + ++   + E++   T + +IS  D D    + V+ E  F + +       A+G    N+  +   R  DRE +S  N  +R +D + H     S+   +++I+ DVNDN P F          E+ P+G ++     V D DS  N   ++ L+ +                 + VT         DRE    + L +LA+D G   LTS+  + V + D NDN         +  I+E++      V++ + +D       +  Y +        F ++   G L +   LDRE   ++ + V A D    A   + +V V + D ND  P F+ +   V   + ++ P   I ++VA D D G++G V Y     +     F++  D G +HL  SL
Sbjct: 1501 QVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGV-LRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAY--SFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACY-----VLRARATDGGGLAATARLYVNVLDANDNAPSV-------QNDSLAAEVPEDAPPGTSLLRISATDDD----EGVNAELEFSISSGDPEGRFAVG----NDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTS-PRSALAPEDSPVGAVVATVQAV-DPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTE-VLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGG-AFSVSPD-GHVHLLRSL 2117          

HSP 9 Score: 140.584 bits (353), Expect = 6.903e-34
Identity = 155/584 (26.54%), Postives = 254/584 (43.49%), Query Frame = 3
Query:  762 QDNGS-----PYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFL----DNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD--SFFTIDQQNQILKSKVTFDREQVSVHKLKILAID---HGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFD---NQTIYYLIDN----------KSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPL--FNLDSDSGDLHLAVSLHTIRPID---TNTF-LDIEACDQGQPNQC 2402
            +DNG+     P  S+  QV + + DVNDNPP F  ++   E +V EN+  G VI  L A D D G N   T+ +   +    E  F+V   +G +    ++D + ++  +   V   D      + +++A + + ++D ND  P  + +  + D A       +  +T   IG +   D DS    +V   +Y L    D+D  +    +    P    +   R  DRE+ +      R TD    +    L + +LD NDN P     +    + E+ P GT L  R+  +D D   N +   SI S GD    F +    Q+  ++   DRE+ S + L +   D   H   RL+S+  V + + DVNDN    T   +     ++   +++  ++A D D   N  + Y +                 F++   +G + L   LDRE ++++ +TV A D      T++ T+ V V D NDN P F        I   E PG ++ ++ A D D G NG ++Y +      +P   F LD   G L +A      RP+D   T ++ L + A D G P + 
Sbjct: 1484 RDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVF--AVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGS----EGAFVVDAASGVLRASRRLDRE-ERASYLLTVRASDG-----THATDARLSVAVRDANDNSPRFSRHAYSFDVA--EDAAPDGKTTRAVIGTVLAGDADSGPFGEV---TYALAPSEDSDWADGAFGL---HPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSL-LRISATDDDEGVNAELEFSISS-GDPEGRFAVGNDGQLSVARA-LDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASG---DPTGDFRLDPVLGTLAVA------RPLDRERTASYELAVRARDGGGPARS 2035          

HSP 10 Score: 132.494 bits (332), Expect = 1.999e-31
Identity = 148/585 (25.30%), Postives = 256/585 (43.76%), Query Frame = 3
Query:  354 GKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQR---LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREK------KNVYEIIIIAQDNGSPYKSNELQVTVEII--DVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETES--KLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI--ESPGDSFFTIDQQNQILKSKVTFDREQV-SVHKLKILAIDHG---DERLTSSCIVYVHIKDVNDN-PVIITP---LINQFYISENKQRSLLGVIKATDFD---NQTIYYLIDNKSQS-KFSIEKHSGRLFLQNSLDRE 2027
            G+L++   +DRE             ++  +T+      +  +     +++ + DVNDN P++ +   +  F E   +GS     +ATD D GSNG V Y  E    N F L  + G  I + ++ DRE          +   ++A D G P K  + + TV++   DVNDNPP+F  S++  +  V E++   T +L + A D D G NG    R + N   E  K  +   TG++ +   +D + +   +   V   D    P  L++   V + + D ND  P           + ++   LE++     +  ++  D D+     V    Y +     +   AI   + +  ++   R+ D ET+   +LN           S+   L + + D NDNPP F  G     I EN PIGT +   +   D D++ NG+   SI  + P  + FTID ++  + +    DRE    + ++ + A D       R ++   V V + D NDN P  +TP   L++    +     S++G ++A+D D   N  + Y +     +  F +++ +G +     LDRE
Sbjct:  812 GQLYVRYELDRE-----------TREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN-FELDSETG-RIASLRVFDREALIRQGGAASFSFSVVATDGGRP-KPLQDRATVQVFVQDVNDNPPQFAKSVY--QASVSESASNLTQLLRVTASDVDEGVNG--ALRYAINEGNEGGKFTVDASTGQITLLGSLDRE-ETASYTLVVSATDSGTSP--LAASCTVAVQVLDENDNPPRFT-------ESLLSVDALESTRVGELLITLTASDEDTGPSGDVR---YAIVAGNTHATFAI---DRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVIT-VTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAG---SVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDRE 1358          

HSP 11 Score: 124.405 bits (311), Expect = 7.228e-29
Identity = 147/615 (23.90%), Postives = 263/615 (42.76%), Query Frame = 3
Query:  483 RLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRL-FQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQ---VFENSPPGTVILLLKAVDHDFGN-NGEFTFRMSPNTSPEVEKHFLVRPTG-----EVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNG--KFTLSIESPGD--SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYIS--ENK-QRSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXX---XXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYIL 2252
            ++++ ++D NDN P +       S  E+SP+G+                  +  +  + R    + F      +   Q LD E +  Y + + A D G+P  S      ++++DVNDN P        P  +   V E++ PGTV  L+   D D    NGE +  +          HF++   G      +++ S++D +     +   ++  D+  +P + S+ A + + + D+ND  P  A        +     + E +   + +  ++  D DS GL+     S    ND    +     +E     + ++ K DRE  S +   I   D      +   +LT+ +LDVND PP F +  Y     EN   G  + + +  +D D   NG  ++    + P      F +D     + +  + DRE++  + L + A D G   L S+  V V + D+NDN  +  P+  Q++ S  EN+   + +  + ATD D   N T+ Y +     ++F +   +G +  + SLDREE+  + + VTA D  H  + +   VT+ V D  D  P F   +    +  + +PG  +  + A+  D   N  V Y++
Sbjct:  121 QVNVTVQDANDNPPAFEKPAYRASVAEDSPVGA-----------------ALRDLLHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNE---RGHFVLHAPGVPGLRVLKVASQLDRER-IPMYNLTILASDNG-KPVARSATASLVVYVNDVNDHAPRFA-------LSAYAAALSEGAPAGSYVKDVTAMDADS-GLNAKLRYSIVSGND----LGWFSVDESTGL-VTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVS-VSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPV--QYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNAN--VTYLI 695          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.037 bits (471), Expect = 7.736e-48
Identity = 176/654 (26.91%), Postives = 290/654 (44.34%), Query Frame = 3
Query:  486 LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNG-SPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETES--KLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI-ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLG--VIKATDFD-----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLD-------IEACDQGQP 2393
            +++++ED NDN P +   +   +  E++PIGS  +L  ATD D G N  + YR+       F +    G  I  T  LDRE +  Y + + A D G +P  S+   + V + DVND+ P+F ++ +        ++P GT +  + A D D G NG+  F +S + S      F V P   V I +       +      V V D    P S  +   V +  +D   EFP  A  PR+        +  E+    T I  ++       G    H  S       L  + A+   +P    +  +R  D E +   +L  E R +     S    L + +LD+NDN PEF+   +   + EN P  T++   +   DKDS  NG+   SI +    + F ++  +  ++S  T DRE V+ ++L + A D G      +  V + + D NDN    +P   Q + +  ++ + +G  V++ +  D     N  I + + + S   FSI   +G + +   L+RE++  + + V ASD   T ST VT+VV D NDN P F      I+          + ++ A+DAD G NG V + ++  +     F +  DSG++H    L    P    +  +       + A D+G+P
Sbjct:   12 VTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG-DGHFSVNPSTGQII-TTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPY--VAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSAS----AGFSVDPRRGV-IHAARALQGPRDDLTLTVRVSDGGAPPRSAVT--TVTVRFRDAG-EFPRFAPGPRSF-------SFREDQPPGTTITVVAARSSRRAGPVSYHLAS----GGNLGDVFAV---DPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIV--VLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDN----SPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSL-PFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN---FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRP 629          

HSP 2 Score: 167.548 bits (423), Expect = 4.076e-42
Identity = 185/750 (24.67%), Postives = 328/750 (43.73%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPNDQ----NNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNG--------LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVK--NLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQ-RSLLGVIKATDFD---NQTIYYLIDNKSQSK-FSIEKHSGRLFLQNSLDREEQETHHITVTASDS-----LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF----LDIEACDQGQP 2393
            ++E+  +G+ +  +   D     N    F+  D  +  F +  STG++ ++RR++RE+       +++++    V+  +T           I+++DVNDNAP +      + F E S   +  +   A+D D G+NGQV + M S+  N FR+ +D+G         Y +          N Y  ++ A D G P  S++  VT+ I+  N N P+F     R    V      GT IL + AVD D   NG+  + +         + F V   G + +++ +  D+    F   V  +D    P  LSS A   I + + N   P  A  P       +  ++ EN    + + +++  D D+     +       D   L  I    +    +  +V   + D ETE   N  +   D    +  +   ++I + DVNDNPP  N   Y+  I EN P GT +   M   D DS +N     S++      F ++Q+  +L ++   D E    ++L + A ++ D    S+  V+V I  VN+  P  +    N F +SE+    + +G + ATD D   + T++Y++  +S+SK FS+ +H+G + + + LDRE + +  + V A ++            V V + D ND  P+F +     ++  + S G  +  + A D D          L +S      F++++ +G + +A       P+D  +     L + A D G+P
Sbjct:  448 VREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLP-FSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVSTDVT-----------IVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN-FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRE--RYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSV---VGGNASRRFDVDAGGFLHLRASLAGDAGSI-FSVTVEARDRGRPP--LSSRATAIISVTEENQYAPRFAHPP-------LELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDI----SRASGDVLLVG--ELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTV-LVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYN-FVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVA------SPLDRESVPLYNLTVVAVDMGEP 1154          

HSP 3 Score: 146.362 bits (368), Expect = 1.292e-35
Identity = 159/599 (26.54%), Postives = 281/599 (46.91%), Query Frame = 3
Query:  492 IIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNS-FRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLS-SEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN-------LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK-FTLSIESP-GDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGV-IKATDFD---NQTIYYL----IDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDAD 2219
            I + + N  AP +      +S  EN P GS  +   ATD D G NG ++Y + S   +  F + + +G  +   + LD E + +Y + + A D G   K+    V++ + DVNDNPP    S + P   + EN+P GT +L++ AVD D  +N    + +      E +   L + TG +  +  +DY++ +T +E  V   ++   P +   S A V + I  +N+ FP   F  R       N  + E++    P+G +   DRD+ G+D      Y L  +  +   ++  NE +   I+ + + DRE E+  +A +R     +  +++        + + I D ND PP F+   YH  + E   +GT +   +   D DS    + F+  I+S      F+I+    ++      DRE V ++ L ++A+D G+   T + +V V ++DVNDN P ++T   +   ++EN+   +  + ++A D D   N+  Y       D   +  FS+   SG L     +DRE++   H+ V  +D+     T++ T+ + V+D+NDN    +++   +    S  PG  I  +   D D
Sbjct:  743 ISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGE-LDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYP--VIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDG---EADLFVLNQKTGVLTTQGFLDYETKQT-YELTVRAFNY---PDTFHYSTAQVHVQITGVNEYFPR--FVQRE-----YNFVVSESAPVGAPVGSVFATDRDA-GIDGT--VFYMLFGESRSKGFSV--NE-HTGEIIVSSQLDREREA--SATLRVI-AKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVG-VSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLT---SSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSS-SGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGDVRPRDPD 1309          

HSP 4 Score: 126.331 bits (316), Expect = 1.993e-29
Identity = 180/758 (23.75%), Postives = 311/758 (41.03%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPNDQN---NLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTI--KLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVF---ENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDIND---EFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD---TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQ--FYI---SENKQRSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQET---------HHITVTASDSLHTASXXXXXXXXD---ENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLD--IEACDQGQP 2393
            + E+  IG  +  +   D +   N  I      G   F +  STG++  T  +DRE            +   EVT         ++    L + + DVND+ P +     +     ++P G+      A D D G NG + + +       F +    G+ I   + L   + ++  + +   D G+P +S    VTV   D  + P       F P  + F   E+ PPGT I ++ A        G  ++ ++  +   +   F V P +GEV +   +D++  + H+E  V  +D    P+S   +  +E+D+ DIND   EF +  F+ + P          EN+   T I  ++  D+DS    +V    Y + +  +  +  +    PN   I S    DRE  +     ++ TD    + H TVK L I + D NDN P F +  +  +++E+  +G  +  R+   D D   N   T S+  P   F       +I  S+   +RE  S + +K+ A    D   T S  V + + DVNDN     P   Q  +YI     ++  +L+  + A+D D   N  +++ + ++++  F + + SG +     L   +            +   VTA D      ++   V ++    N N P F        + A+   G +I  + A D D   NG + Y +   +     F++D+  G LHL  SL      D  +     +EA D+G+P
Sbjct:   35 VPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQIITTASLDRE---------GRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGV-IHAARALQGPRDDL-TLTVRVSDGGAPPRSAVTTVTVRFRDAGEFP------RFAPGPRSFSFREDQPPGTTITVVAARSSR--RAGPVSYHLA--SGGNLGDVFAVDPQSGEVSVHRALDHEY-QHHYELVVEARDSGFPPFSAYLK--LEVDVLDINDNAPEFSSSRFWAKVP----------ENTPPRT-IVVLTAVDKDSGINGQV---DYSIIDGNIGNVFRV---NPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVL-ISVTDENDNSPRFTQ-IFSAHVREDAAVGFPV-LRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSR-RLNREDRSGYAVKVRA---SDPAWTVSTDVTIVVDDVNDN----APRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTE-NFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASR-RFDVDA-GGFLHLRASLAG----DAGSIFSVTVEARDRGRP 733          

HSP 5 Score: 117.087 bits (292), Expect = 1.404e-26
Identity = 130/540 (24.07%), Postives = 227/540 (42.04%), Query Frame = 3
Query:  771 GSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPT------IAFYPRNPDSATMNPTILENSSTMTPIGQI--SVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS--DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD--SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD---SLHTASXXXXXXXXDENDNKPIFKNM-NKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
            G P  +    VTV + D NDN P+F  +  R    V E++P G+ + L+ A D D G N   ++R+        + HF V P TG++   + +D +  +++   +V   D    P  LSS A + + + D+ND  P       +A+ P +  + T    +    +   P G +  S+    S G                       + +P    I + R   +     L   +R +D      S V  +T+   D  +  P F  G   F  +E++P GT +     V+ + S   G  +  + S G+    F +D Q+  +      D E    ++L + A D G    ++   + V + D+NDN    +       + EN     + V+ A D D     Q  Y +ID    + F +  +SG +   ++LDRE   ++ +TV A+D        +  V + V DENDN P F  + +  ++ DA+   GF + ++   DAD G N  + + L   S     F++   +G++ ++  L
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELR--AAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG-----DGHFSVNPSTGQIITTASLDREGRESYV-LEVTALDGGPTP-GLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGF----------------------SVDPRRGVIHAARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF-PRFAPGPRSFSFREDQPPGTTI---TVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAV--GFPVLRVSTLDADEGPNAAITFSLLDPSLP---FSIHPSTGEITVSRRL 500          

HSP 6 Score: 75.485 bits (184), Expect = 6.031e-14
Identity = 66/221 (29.86%), Postives = 102/221 (46.15%), Query Frame = 3
Query: 1770 GDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHT----ASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTI 2408
            G+ RLT +  V V ++D NDN P      +      +    S + ++ ATD D   N  I Y +       FS+   +G++    SLDRE +E++ + VTA D   T    +S T+ V V D ND+ P F N   V    +S   G  +  + A DAD G NG +++ L  S+     F++D   G +H A +L   R    +  L +   D G P +  +
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL-RGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAG--FSVDPRRGVIHAARALQGPR---DDLTLTVRVSDGGAPPRSAV 216          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.037 bits (471), Expect = 8.553e-48
Identity = 176/654 (26.91%), Postives = 290/654 (44.34%), Query Frame = 3
Query:  486 LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNG-SPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETES--KLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI-ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLG--VIKATDFD-----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLD-------IEACDQGQP 2393
            +++++ED NDN P +   +   +  E++PIGS  +L  ATD D G N  + YR+       F +    G  I  T  LDRE +  Y + + A D G +P  S+   + V + DVND+ P+F ++ +        ++P GT +  + A D D G NG+  F +S + S      F V P   V I +       +      V V D    P S  +   V +  +D   EFP  A  PR+        +  E+    T I  ++       G    H  S       L  + A+   +P    +  +R  D E +   +L  E R +     S    L + +LD+NDN PEF+   +   + EN P  T++   +   DKDS  NG+   SI +    + F ++  +  ++S  T DRE V+ ++L + A D G      +  V + + D NDN    +P   Q + +  ++ + +G  V++ +  D     N  I + + + S   FSI   +G + +   L+RE++  + + V ASD   T ST VT+VV D NDN P F      I+          + ++ A+DAD G NG V + ++  +     F +  DSG++H    L    P    +  +       + A D+G+P
Sbjct:   12 VTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG-DGHFSVNPSTGQII-TTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPY--VAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSAS----AGFSVDPRRGV-IHAARALQGPRDDLTLTVRVSDGGAPPRSAVT--TVTVRFRDAG-EFPRFAPGPRSF-------SFREDQPPGTTITVVAARSSRRAGPVSYHLAS----GGNLGDVFAV---DPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIV--VLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDN----SPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSL-PFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN---FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRP 629          

HSP 2 Score: 167.162 bits (422), Expect = 4.865e-42
Identity = 185/750 (24.67%), Postives = 328/750 (43.73%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPNDQ----NNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNG--------LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVK--NLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQ-RSLLGVIKATDFD---NQTIYYLIDNKSQSK-FSIEKHSGRLFLQNSLDREEQETHHITVTASDS-----LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF----LDIEACDQGQP 2393
            ++E+  +G+ +  +   D     N    F+  D  +  F +  STG++ ++RR++RE+       +++++    V+  +T           I+++DVNDNAP +      + F E S   +  +   A+D D G+NGQV + M S+  N FR+ +D+G         Y +          N Y  ++ A D G P  S++  VT+ I+  N N P+F     R    V      GT IL + AVD D   NG+  + +         + F V   G + +++ +  D+    F   V  +D    P  LSS A   I + + N   P  A  P       +  ++ EN    + + +++  D D+     +       D   L  I    +    +  +V   + D ETE   N  +   D    +  +   ++I + DVNDNPP  N   Y+  I EN P GT +   M   D DS +N     S++      F ++Q+  +L ++   D E    ++L + A ++ D    S+  V+V I  VN+  P  +    N F +SE+    + +G + ATD D   + T++Y++  +S+SK FS+ +H+G + + + LDRE + +  + V A ++            V V + D ND  P+F +     ++  + S G  +  + A D D          L +S      F++++ +G + +A       P+D  +     L + A D G+P
Sbjct:  448 VREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLP-FSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVSTDVT-----------IVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN-FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRE--RYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSV---VGGNASRRFDVDAGGFLHLRASLAGDAGSI-FSVTVEARDRGRPP--LSSRATAIISVTEENQYAPRFAHPP-------LELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDI----SRASGDVLLVG--ELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTV-LVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYN-FVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVA------SPLDRESVPLYNLTVVAVDMGEP 1154          

HSP 3 Score: 146.362 bits (368), Expect = 1.440e-35
Identity = 159/599 (26.54%), Postives = 281/599 (46.91%), Query Frame = 3
Query:  492 IIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNS-FRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLS-SEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKN-------LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK-FTLSIESP-GDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGV-IKATDFD---NQTIYYL----IDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDAD 2219
            I + + N  AP +      +S  EN P GS  +   ATD D G NG ++Y + S   +  F + + +G  +   + LD E + +Y + + A D G   K+    V++ + DVNDNPP    S + P   + EN+P GT +L++ AVD D  +N    + +      E +   L + TG +  +  +DY++ +T +E  V   ++   P +   S A V + I  +N+ FP   F  R       N  + E++    P+G +   DRD+ G+D      Y L  +  +   ++  NE +   I+ + + DRE E+  +A +R     +  +++        + + I D ND PP F+   YH  + E   +GT +   +   D DS    + F+  I+S      F+I+    ++      DRE V ++ L ++A+D G+   T + +V V ++DVNDN P ++T   +   ++EN+   +  + ++A D D   N+  Y       D   +  FS+   SG L     +DRE++   H+ V  +D+     T++ T+ + V+D+NDN    +++   +    S  PG  I  +   D D
Sbjct:  743 ISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGE-LDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYP--VIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDG---EADLFVLNQKTGVLTTQGFLDYETKQT-YELTVRAFNY---PDTFHYSTAQVHVQITGVNEYFPR--FVQRE-----YNFVVSESAPVGAPVGSVFATDRDA-GIDGT--VFYMLFGESRSKGFSV--NE-HTGEIIVSSQLDREREA--SATLRVI-AKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVG-VSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLT---SSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSS-SGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGDVRPRDPD 1309          

HSP 4 Score: 126.331 bits (316), Expect = 2.024e-29
Identity = 180/758 (23.75%), Postives = 311/758 (41.03%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPNDQN---NLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTI--KLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVF---ENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDIND---EFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD---TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQ--FYI---SENKQRSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQET---------HHITVTASDSLHTASXXXXXXXXD---ENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLD--IEACDQGQP 2393
            + E+  IG  +  +   D +   N  I      G   F +  STG++  T  +DRE            +   EVT         ++    L + + DVND+ P +     +     ++P G+      A D D G NG + + +       F +    G+ I   + L   + ++  + +   D G+P +S    VTV   D  + P       F P  + F   E+ PPGT I ++ A        G  ++ ++  +   +   F V P +GEV +   +D++  + H+E  V  +D    P+S   +  +E+D+ DIND   EF +  F+ + P          EN+   T I  ++  D+DS    +V    Y + +  +  +  +    PN   I S    DRE  +     ++ TD    + H TVK L I + D NDN P F +  +  +++E+  +G  +  R+   D D   N   T S+  P   F       +I  S+   +RE  S + +K+ A    D   T S  V + + DVNDN     P   Q  +YI     ++  +L+  + A+D D   N  +++ + ++++  F + + SG +     L   +            +   VTA D      ++   V ++    N N P F        + A+   G +I  + A D D   NG + Y +   +     F++D+  G LHL  SL      D  +     +EA D+G+P
Sbjct:   35 VPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQIITTASLDRE---------GRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGV-IHAARALQGPRDDL-TLTVRVSDGGAPPRSAVTTVTVRFRDAGEFP------RFAPGPRSFSFREDQPPGTTITVVAARSSR--RAGPVSYHLA--SGGNLGDVFAVDPQSGEVSVHRALDHEY-QHHYELVVEARDSGFPPFSAYLK--LEVDVLDINDNAPEFSSSRFWAKVP----------ENTPPRT-IVVLTAVDKDSGINGQV---DYSIIDGNIGNVFRV---NPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVL-ISVTDENDNSPRFTQ-IFSAHVREDAAVGFPV-LRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSR-RLNREDRSGYAVKVRA---SDPAWTVSTDVTIVVDDVNDN----APRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTE-NFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASR-RFDVDA-GGFLHLRASLAG----DAGSIFSVTVEARDRGRP 733          

HSP 5 Score: 117.087 bits (292), Expect = 1.310e-26
Identity = 130/540 (24.07%), Postives = 227/540 (42.04%), Query Frame = 3
Query:  771 GSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPT------IAFYPRNPDSATMNPTILENSSTMTPIGQI--SVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS--DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD--SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD---SLHTASXXXXXXXXDENDNKPIFKNM-NKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
            G P  +    VTV + D NDN P+F  +  R    V E++P G+ + L+ A D D G N   ++R+        + HF V P TG++   + +D +  +++   +V   D    P  LSS A + + + D+ND  P       +A+ P +  + T    +    +   P G +  S+    S G                       + +P    I + R   +     L   +R +D      S V  +T+   D  +  P F  G   F  +E++P GT +     V+ + S   G  +  + S G+    F +D Q+  +      D E    ++L + A D G    ++   + V + D+NDN    +       + EN     + V+ A D D     Q  Y +ID    + F +  +SG +   ++LDRE   ++ +TV A+D        +  V + V DENDN P F  + +  ++ DA+   GF + ++   DAD G N  + + L   S     F++   +G++ ++  L
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELR--AAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG-----DGHFSVNPSTGQIITTASLDREGRESYV-LEVTALDGGPTP-GLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGF----------------------SVDPRRGVIHAARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF-PRFAPGPRSFSFREDQPPGTTI---TVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAV--GFPVLRVSTLDADEGPNAAITFSLLDPSLP---FSIHPSTGEITVSRRL 500          

HSP 6 Score: 75.485 bits (184), Expect = 6.127e-14
Identity = 66/221 (29.86%), Postives = 102/221 (46.15%), Query Frame = 3
Query: 1770 GDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHT----ASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTI 2408
            G+ RLT +  V V ++D NDN P      +      +    S + ++ ATD D   N  I Y +       FS+   +G++    SLDRE +E++ + VTA D   T    +S T+ V V D ND+ P F N   V    +S   G  +  + A DAD G NG +++ L  S+     F++D   G +H A +L   R    +  L +   D G P +  +
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL-RGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAG--FSVDPRRGVIHAARALQGPR---DDLTLTVRVSDGGAPPRSAV 216          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 175.252 bits (443), Expect = 5.990e-45
Identity = 218/857 (25.44%), Postives = 371/857 (43.29%), Query Frame = 3
Query:  225 YRIKEETEIGYVIDYIKPNDQNNLKIFNTN-------------DNGVNCFELESSTGKLFIT-RRIDREEICPTNRLLKSNNQQCEVTIK---LTHQNINFVQRLSIII--EDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQ------DNG---LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP------TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTIL--ENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNE---PNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNL--TIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPI--FKNMNKVIKIDASES-PGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPLFNLDSDSGDLHLAVSL----HTIRPIDTNTFLDIEACDQGQPNQC------------TIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVLIAAI-SGLLVLMIIIMIAFIVFK 2585
            YR+ EE   G  I     N   +L++ + N             D       +   TG+LF   R++DRE +C      +    +C V ++   L  Q   F + + + I  ED+NDNAP +      VS  EN+P G R  +  A D D  +NG   Y +      +   F+       NG    Y+   + LDRE++ +YE+ + A D GSP  S    + + + D NDN P F  +    E  + ENSP GT ++ L A D D G+N E  +R+  +T          R       +G V +   ++ +       +++I+      P  + + A V + + D+ND  PTI         A +N  I   E S    P+  I+V D D      V C  Y       NP +     +   PN++ + +    D ET+++   +I+  D    S  + +  TI +LD NDN P F + TY   + EN  IG  L   +  +D+D + N +    +     + F +D +  I+      DRE+ + +   ILA D G   L  +  V V++ DVNDN    +     FY++EN  + S +G++   D D     +    ++   ++  FSI+  SG +      DRE++  + + V A+D    + +++  V + V+D NDN PI      N   K     + PG  + ++ A D D   N  ++Y I+  + +   LF++D   G++ L   L    H +        L +   D G   Q             T+ +   I+W    +     ++D +     +Q  N+ +L+AA+ +G+L + +I+++  +V +
Sbjct:   41 YRVAEELREGAFIG----NPSVDLRLADYNLELTYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALCGG----QDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVE--IPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPV---YRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEI---RDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIY-------NPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLIT-VSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHN--LFHIDPVIGNITLMEPLTETHHGLH------RLVVRVSDIGIAVQHHAVALVHVFVNETLENATYIEWLIAGSLQTPLDTDVAGFGRREQEDNKVLLLAAVLAGVLGVALIVLLGVLVHR 865          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 231.876 bits (590), Expect = 3.702e-62
Identity = 213/749 (28.44%), Postives = 357/749 (47.66%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPNDQNN-------LKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYR-NSFRLFQDNG-LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLD----KVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQ----FYISENKQRS--LLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSL---HTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQP 2393
            + E    G  + Y+   D ++         I + N+N    F ++  TG++     +DRE I   +  + +++      +  T  NI+        I D NDN P +T   +  + +E+SP G+R     ATD DIG NG V Y + S  + NSF+L   +G L + +T  LDRE    Y +++ A D GSP +S    + V ++DVNDN P+F  S+F  E  + E++   + +L +K  D D G+NG  T  +    S E   +F +  TG V  K+ +DY++    ++  V  +D    P S S+ A V+I I ++ND  P+      +P   T  P   E+ +  T + +++  D D   L     + +  S F   D+ + +I++             ++ DRET +     +R T+T     S   N TI +LDVNDN P FN G+Y   + EN PIG  +  ++  +D+D   N K T  +     S F ++    ++ +K   DRE  + + L++ A+DHG    ++   + + I D+NDN    +P  +Q      ++EN      +L V+ A+D D     +  Y +I     + F I+  +GR+ +   +DRE   ++++T++A DS      ++  V + V DENDN PIF +      ID   S G ++  + ATD D G+N  V Y + +       F +++ +G L +   ++  R       L I A D+G P
Sbjct:  694 VGENLAAGVAVCYVTATDADSGANGKISYSILSGNEN--MAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNIS--------IADENDNQPTFT-GPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRST--LDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGE--IREDASVHSTVLQVKVEDKDEGSNGAITLSL----SGEGSDNFTIDSTGFVLSKTPLDYET-TAAYQLTVTARDGG-SP-SKSATAQVKITIINVNDNVPSFV----SPAQVTSIP---EDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSF-KIDQSSGLISVA------------KRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTV-AKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDN----SPQFSQSKYTLTVTENTANGSNILRVL-ASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSA--FAINAMNGVLTVKKEIN--RETVPTYTLTIRASDRGSP 1390          

HSP 2 Score: 194.897 bits (494), Expect = 1.726e-50
Identity = 199/726 (27.41%), Postives = 333/726 (45.87%), Query Frame = 3
Query:  300 IFNTNDNGVNCFELESSTGKLFIT-RRIDREEICP--TNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRM-SPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND-----KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLS-IESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLG----VIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXX---XDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTI 2408
            I + ND G+  F ++SSTG +  T R+ DRE         L +    +C       H+    V    I ++D NDNAP +  +  + +  EN+P  ++ ++  ATD D G+N  + Y + S   N F +    G  I     LD E K+ Y + I A D     K       + + DVNDN P F  S+++    V+E+   G+++  L AVD D G N   ++ + S +TS     +F V   G +  K   D ++ K  ++  +  QD    P S S +A VEI+I D+ND  P  +       SA    ++ E+ +    +  ++  D+D+   +       F   +      L+ +  +         +  +R  D E  S     +  TD      +   +L I + D+NDNPP F+   Y   +KEN P GT +      +D+DS+ NG      I+   D  FTID    I+    + D E  + + L + A D G      +  V + I+DVND+  + +P     Y  +  + +++G     + ATD D     +  Y LI    +  F+I+ +SG + + + LDRE   ++ + V A D   T+ ++ T V     D NDN PIF+    V ++  S SPG +I ++ ATDAD  +NG V+Y L  ++    +F++++ +G + L   L   +   T   + + A D G P++ ++
Sbjct:    3 IMDGNDQGM--FTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRC-------HKGRTVVV---IDVKDENDNAPEFPLNSYVFNIRENTP-AAQVAIVTATDRDSGTNAAITYSLFSG-ENKFMMNSKTG-EIRTVTPLDHETKDSYTMRISAFDG----KHTTFVPLITVDDVNDNAPFFALSVYK--TGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTS-----YFTVDSQGVIRTKGAFDRET-KASYQVALRAQDGG-SP-SRSGQATVEIEILDVNDNRPVFS-------SAQYTASVDEDVAIGAAMVTVTASDKDNG--NNADLRYSFTSGNTNHAFTLDAVTGV---------VTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVS----ATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSP---SNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGP-YVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNT---DVFSINTSTGLITLKTQLDYEKK--TQYMVTVTAKDGGTPSRSSL 668          

HSP 3 Score: 191.815 bits (486), Expect = 1.702e-49
Identity = 203/718 (28.27%), Postives = 324/718 (45.13%), Query Frame = 3
Query:  318 NGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD------TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD-SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQ----FYISENKQRSLLGV-IKATDFD--NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPID---TNTF-LDIEACDQGQPNQCT 2405
            N  + F+++ S+G + + +R+DRE       ++++         +   Q  +     +I + DVNDNAP++       S +EN PIG   +   ATD D G N +V Y +     + F +    GL +   + LDRE +  Y + + A D+G P +S    +T+ I D+NDN P+F+ S +     V EN+  G+ IL + A D D G NG  T+ +    S      F +   TG + +   +D ++    +   +  +D  V P+   S A V I + D ND  P  A       S   +  I E  S  + +  ++  DRD     +V       D        A   N  N    V  ++ +RET       IR +D      TSD    K LT+++ DVNDNPP FN  +Y   ++EN    T +   +   D D   N     SI S  D   F I+  + ++ +    D E+ S + L++ A D    + T+   V + + ++ND    ITP   Q      + EN   S   V + A+D D      Y ++  K   KFSI++ SG +   + LDRE    + I V  +D+ +   +  T VT+ ++DENDN P F + +    I  + +P     K+ ATDAD G N  + Y L ++      F + + SG + LA      +P+D    +T+ L I+A D G P Q +
Sbjct: 1037 NAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRAT--------ETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGL-VTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKY--TLTVTENTANGSNILRVLASDPDAGANGRVTYSI---ISGNHGNAFRIDSTTGRITVVGVVDREA-LASYNLTISAKDSGVPPWV--STAFVAITVADENDNSPIFA-------SNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTS------AFAINAMNGVLTV-KKEINRETVPTYTLTIRASDRGSPMMTSD----KELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLT-VAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATD---SKYTAKTNVTIRVINLND----ITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRND----AFMIGASSGVITLA------QPLDRENKSTYDLAIQARDHGTPPQAS 1701          

HSP 4 Score: 186.037 bits (471), Expect = 9.682e-48
Identity = 180/654 (27.52%), Postives = 307/654 (46.94%), Query Frame = 3
Query:  327 NCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPT-GEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNI-------VSNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLIN----QFYISENKQRS-----LLGVIKATDFDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD----SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDAD 2219
            N F ++S+TG++ +   +DRE +   N  + + +      +            ++I + D NDN+PI+ +++     +E   IGSR ++  ATD D GSN QV Y +     ++F +   NG+     + ++RE    Y + I A D GSP  +++ ++TV + DVNDNPP F    +     V ENS   T +L + A D D G N    + +    S   EK F +  T G +   + +D++ +K+ +  +V   D        +++  V I + ++ND  P  AF  +N        ++ ENS T T + ++S  DRDS G       SY +          +G  + ++F+I        +    DRE  S    ++R TD  +   S +  +TI ILD NDN P+F+  +Y   I EN    +    ++  +D D   N + T ++ S  D+F  I   + ++      DRE  S + L I A DHG     SS  + V + D+ND+     PLIN    +  + EN+ +      +L     T  + +  + L+ N+ +S F+++  +G +  +  LDRE+Q  + + +  +D    SL + +  V + V+DE+DN P F+     + I  S   G  I ++ A D D
Sbjct: 1249 NAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAF--------VAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKE-INRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYI--GSVRENSAQSTSVLTVAADDSDVGANAVLRYSI---ISGNDEKRFKINSTSGVIMTTTPLDFE-EKSQYGLEVTATDS-----KYTAKTNVTIRVINLNDITP--AFTQQN-----YTASVRENSPTSTSVVKVSASDRDSFG-----SLSYSI----------VGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSS-FSFKLAATDADEGTNARITYNL-SRNDAFM-IGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDH----RPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVA-DVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 5 Score: 180.644 bits (457), Expect = 4.751e-46
Identity = 183/631 (29.00%), Postives = 289/631 (45.80%), Query Frame = 3
Query:  492 IIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIG-QISVHDRDSK-------GLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPG-DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRS-LLGVIKATDFDNQT----IYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
            I ++DVNDNAP +          E+  +GS      A D+D+G N ++ Y + S   + F +  D+   I      DRE K  Y++ + AQD GSP +S +  V +EI+DVNDN P F+ + +     V E+   G  ++ + A D D GNN +  +     TS      F +   TG V +   +D++  ++ +   + V D    P + +S  +  I++ DIND  P   F P     +     + EN    TP G Q+S  DRDS        G+ K + +  F   D    II+I    P+         ++ +T   L  + R            +TI I DVND+ P F+   Y   I E+  IG+ +   +  +D DS   G+    + S      F ID  +  ++     DRE    + L++ A D G    +SS  V + ++D+NDN P+   P +  F +SE+      +G + ATD D+ +     Y L DN     FSI   +G + L+  LD E++  + +TVTA D      ++ T V V+V D NDN P F        +  + + G  +C + ATDAD G NG + Y +  S  +   F +D  +G++   V L
Sbjct:  156 ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTV--DSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQY--TASVDEDVAIGAAMVTVTASDKDNGNNADLRYSF---TSGNTNHAFTLDAVTGVVTVSRSLDFEQ-RSSYALGLSVTDRGSPPLTDTSHLL--INVNDINDNPP--VFSP-----SAYQSRVKEN----TPAGTQVSATDRDSSTNGALVFGIIKGNDDGVFT-IDGSTGIISIA-KSPD---------YENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVT-VTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYV--FRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNT--DVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSI-LSGNENMAFAMDRFTGEITTRVPL 748          

HSP 6 Score: 173.711 bits (439), Expect = 8.545e-44
Identity = 184/708 (25.99%), Postives = 329/708 (46.47%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQN-----INFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESK-YRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND----KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDS-FFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGV-IKATDFDNQTIYYLIDNKSQS-KFSIEKHSGRLFLQNSLDREEQETHHITVTASDSL---HTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTI 2408
            FE+  +TG +   R +DRE+             Q   ++++T  +      + V  +++ I D+NDN+P ++  K  ++  EN+  GS      A+D D G+NG+V Y + S  + N+FR+    G  I    ++DRE    Y + I A+D+G P   +   V + + D NDN P F  +       + E    G+ + ++ A D D G+N +  + +    +     + +    G + +K +I+ ++  T +   +   D    P  ++S+  + + + D+ND  P         +S +   ++ ENS+  T +  ++  D D  G + V   S    ND    K+N    +         I++    D E +S+   E+  TD S ++   N+TI ++++ND  P F +  Y   ++EN P  T +   + VS  D ++ G  + SI    DS  F+IDQ++ I+ +    DRE VS++ +++   D G+  L++   V + I D NDN            I EN   S     + ATD D  T   +  N S++  F I   SG + L   LDRE + T+ + + A D       +S T+ V V+D ND++P+  + +    +  ++     + +I+A+DAD G N  + + L  + +K  +F LD+ +GD+   V L   R       L I   D+G P+  ++
Sbjct: 1146 FEVNPATGLVTTKRPLDRED-------------QASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTG-RITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASN--ETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAM---NGVLTVKKEINRETVPT-YTLTIRASDRG-SPM-MTSDKELTVVVNDVNDNPPVF-------NSQSYIGSVRENSAQSTSVLTVAADDSD-VGANAVLRYSIISGNDEKRFKINSTSGV---------IMTTTPLDFEEKSQYGLEVTATD-SKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSV---VKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKS-VFTLDNTTGDISTKVPLD--REQQAVYTLRIGVADKGNPSLSSV 1807          

HSP 7 Score: 168.318 bits (425), Expect = 3.378e-42
Identity = 186/663 (28.05%), Postives = 288/663 (43.44%), Query Frame = 3
Query:  483 RLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRK-------FDRETESKLNAEIRCTDTSDHSTVKN--LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLIN-QFYISE----NKQRSLLGVIKATDFD---NQTIYY-LIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLA-------VSLHTIRPIDTNTFLDIEACDQGQP 2393
            ++ I I +VNDN P + +   + S  E+  I +      ATD D          +E    +SF++ Q +GL I   + LDRE    Y +++ A + GS  +S     T+ ++DVNDN P F    +   K + EN P G  +  + A D D G N + T+ +S   +      F V P TG V  K  +D + D+  +  +V   DH  +P S S+ A + + I D+ND  P  +        +    T+ EN++  + I ++   D D+    +V   +Y +          I  N  N F I S           DRE  +  N  I   D+     V    + I + D NDN P F      + I E   IG+ +   +  +D+D  +N +   SI     S F I+  N +L  K   +RE V  + L I A D G   +TS   + V + DVNDNP    P+ N Q YI      + Q + +  + A D D   N  + Y +I    + +F I   SG +     LD EE+  + + VTA+DS +TA T VT+ V++ ND  P F   N    +  +      + K+ A+D D   +     +  K S K   F++D  SG +  A       VSL+ I+         +   D G P
Sbjct:  982 QVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD--GTPLTFDIVEGNAGSSFKIDQSSGL-ISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSY--AKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDT----SKFEVNPATGLVTTKRPLDRE-DQASYSLRVTAMDHG-KP-SQSAVAAITLTINDLNDNSPQFS-------QSKYTLTVTENTANGSNILRVLASDPDAGANGRV---TYSI----------ISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRV-AVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNP----PVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDK---FSIDQRSGIISTADVLDRELVSLYAIQ---------VRVTDAGNP 1595          

HSP 8 Score: 129.798 bits (325), Expect = 2.732e-30
Identity = 158/580 (27.24%), Postives = 265/580 (45.69%), Query Frame = 3
Query:  225 YRIKEETEIGYVIDYIKPNDQN---NLKIFNTNDNG-VNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFV---QRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKY-RNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHD-FGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTI--IILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIES-PGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGV-IKATDFD 1925
            Y I E   IG  +  +   D++   N ++F +   G  + F + +  G L + + I+RE + PT  L          TI+ + +    +   + L++++ DVNDN P++ +   I S  ENS   +      A D D+G+N  + Y + S      F++   +G+ I  T  LD E+K+ Y + + A D+    K+N   VT+ +I++ND  P FT   +     V ENSP  T ++ + A D D FG     +   S     + +K  + + +G +     +D +   + +  +V V D    P  LS+   V I I D ND  P         DS++ + +ILENS+  +   +++  D D     ++   +Y L     N    IG +      I   +  DRE +S  +  I+  D        ++TI   ++D+ND+ P  N  +    ++EN+P  T +  R+  SD D+  N + T S+ S    S FT+D     + +KV  DREQ +V+ L+I   D G+  L+S   V + + D +DN     P      ISE+  R    V + A D D
Sbjct: 1315 YGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETV-PTYTL----------TIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGV-IMTTTPLDFEEKSQYGLEVTATDSKYTAKTN---VTIRVINLNDITPAFTQQNY--TASVRENSPTSTSVVKVSASDRDSFG-----SLSYSIVGGKDSDKFSIDQRSGIISTADVLDREL-VSLYAIQVRVTDAGNPP--LSNLTWVTIKILDENDNSPKF-------DSSSYSSSILENSAPSSFSFKLAATDADEGTNARI---TYNLSR---NDAFMIGASSGV---ITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHV-MRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 197.978 bits (502), Expect = 2.169e-51
Identity = 202/748 (27.01%), Postives = 339/748 (45.32%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPND----QNNLKIFNT----NDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYR-MESKYRNS-FRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD--HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQI-LKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLG----VIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD---SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF----LDIEACDQGQP 2393
            + E+ E+G V+  +  +D     N +  ++     N      F ++  TG +   R +DRE +      +K+ +            ++     L+I + DVNDN PI+  +       E+  IG       A+D D GSNG+V Y  + S   NS F + + +G  +   + LDREK   Y + + AQD G+P +S  + V + ++DVND  P+F+  ++     + E+ P   ++  ++A D D G+NGE  F +   +  ++    + R  GEV +K K+DY+     F   V  QD   +P+ L ++  V+I + D+ND  P          S+     I EN +      ++  +D+D     ++     F+ ND     +    NE N   I    + DRE   K    I+  D           +TI +LD+NDNPP+F++  YH  I EN   GT +     +       N  +++   S  D  F I+ Q  I L   + ++ + V V      ++   D  L+S+ +VYV++ D N +         + Y +E K+ + LG     + ATD D   N  I Y I      +FS+++ +G +    SLDRE+ +T+   VTA+D       A + V + + D NDN P+F   +   K+     PG ++ ++ A+DAD G N  + Y    +   +  F +DS  G       + T++P+D  T     L + A DQG P
Sbjct:   29 VSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGG--------EPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGA-VTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVY--SATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIV--SGNDMNFFSINRINGEVRVKQKLDYEMIGV-FNLLVTAQDKG-QPF-LYNQTTVDIALIDVNDNAPQFV-------SSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFS--FMQND-----LPFSINE-NTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYV-----FSVSASDGMLSSTALVYVNVTDSNTHA---PEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLV-PEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQG------IIRTLKPLDRETIPEYELTVVATDQGTP 730          

HSP 2 Score: 188.348 bits (477), Expect = 2.719e-48
Identity = 191/723 (26.42%), Postives = 332/723 (45.92%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPNDQNN-----LKIFNTNDNGVN-CFELESSTGKLFITRRIDREEICPTNRL-LKSNNQ-----QCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKY-RNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGVIKATDFD----NQTIYYLIDNK-SQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSL---HTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHG-NNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
            I E+  IG  +  ++ +D ++     +K    N +G N  F +   +G + + +++DRE++ PT  L +++ +Q        VT+K+T             + DVND  P ++      +  E+ P+    +   ATD D GSNG+V + + S    N F + + NG  +   Q LD E   V+ +++ AQD G P+  N+  V + +IDVNDN P+F  S F  +  + EN   G     ++A D D G NGE TF    N  P     F +   TG + IK ++D +     F F +  +D  V P+     A + I + DIND  P  +           + +I ENS   T + Q+   D DS   + V+       +D+   I   G        I  +   +  T+      +  +D    ST   + + + D N + PEF + +Y   +KE+  +GT +   +  +D+D+ +N K + SI +    F ++D+   ++K+  + DRE+V  ++ ++ A DHG  +L +   VY+HI DVNDN PV + P        + +    +  + A+D D     Q IY    N   Q  F+I+   G +     LDRE    + +TV A+D       AS  V V++ D  D+ P+F+     + +     P   +  + A   D     G++  I++ +S +  +F+++ ++G +   + L
Sbjct:  137 IPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKV-PTYTLQVQAQDQGNPPRSATVTVKIT-------------LLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRING-EVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHF--QTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLP-----FSINENTGGISIKEELDREK-VPKFTFGIKARDKGV-PFK-EGTAQITITLLDINDNPPKFS-------QEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQGL-------ITLSCTLNYNTKHVYVFSVSASDGMLSSTAL-VYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLT-VLATDRDTGSNAKISYSIATLVPEF-SVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQ--VFDINPNTGAIQTLMKL 815          

HSP 3 Score: 149.828 bits (377), Expect = 2.172e-36
Identity = 166/656 (25.30%), Postives = 289/656 (44.05%), Query Frame = 3
Query:  513 DNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKY----RNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVK--------------------NLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ--RSLLGVIKATDFDN---QTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQP 2393
            +N P ++  +   S +E++ +G+  +   A+D D GSNG + Y M           F + Q  G+ I   + LDRE  + +   + A+D G P     + +T+ ++DVNDN P F  +I+  +  + E+   G  +L ++A D D G+NGE  + +  N+  +     +   +G V +  K+D +   T +  +V  QD    P   S+   V+I + D+ND  P    + +   SAT+   +        P+ Q+    R +             D D+       G+N    F IVS    +  + +++N E+R     D+  +                      + I ++DVNDN P+F    +   I EN  +G     R+   DKD   NG+ T S     D  F+I++    +  K   DRE+V      I A D G      +  + + + D+NDNP   +       I+EN +   S+L V KA D D+     +Y ++ +    +       G + L  +L+   +  +  +V+ASD + +++  V V V D N + P FK  +   ++    S G  +  ++ATD D G+N  + Y +   +   P F++D  +G +  A SL   + +DT  F ++ A D G P
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGV-ITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAAD--IPEDKSIGDFVLAVRASDADSGSNGEVKYCIL-NSDGDNSAFSIGEVSGAVTVMKKLDREKVPT-YTLQVQAQDQGNPPR--SATVTVKITLLDVNDCTPQ---FSKKVYSATIREDV--------PVNQLVTTVRAT-------------DCDQ-------GSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEF-YRVQAYDKDHGTNGEITFSFMQ-NDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQV-KAIDPDSGPTNVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSI---ATLVPEFSVDETTGVIKTAGSLDREK-VDTYRF-EVTATDHGIP 624          

HSP 4 Score: 96.6709 bits (239), Expect = 3.599e-20
Identity = 139/599 (23.21%), Postives = 254/599 (42.40%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINF---VQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM--ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS---DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLG-----VIKATDFD--NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTAS 2084
            F +  +TG + I   +DRE++            +    IK   + + F     +++I + D+NDN P ++ ++   S  ENS  G+     +A D D G    V+Y +   S +   FR+    GL I  +  L+   K+VY   + A D      S+   V V + D N + P+F    +  E  V E++  GT +L + A D D G+N + ++ ++    PE     +   TG ++    +D +   T + F+V   DH +    L +++ V I I D+ND  P            +    + E+      + ++S  D D  G +     S+  + D         T +  +  I + +  DRET  +    +  TD       ++VK + +I+ DV D+PP F K  Y   + E+ P  + +      S   S   G     +       F I+     +++ +  D E  S ++L + A         +   V V++KD+NDN    TP++  F+++ N Q   +       I A D D  ++  + +++  ++   ++   SG L +   L +  +   +I +  +D L TAS
Sbjct:  385 FSINENTGGISIKEELDREKV-----------PKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPT-NVVYSIVSSSGHDRCFRI-NPQGL-ITLSCTLNYNTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAE--VKEDASLGTSVLTVLATDRDTGSNAKISYSIA-TLVPEFS---VDETTGVIKTAGSLDREKVDT-YRFEVTATDHGIP--QLKAKSFVYIHIADVNDNDPVFL-------KPSYEAKVREDIRPGGRVIEVSASDADI-GKNAQIIYSFASNGDGQGTF----TIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVK-VKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATL---SPFFTETTVMVYLKDINDN----TPVLEAFHMNINVQEGKVPPEARYKIPAYDPDVSDKLTFKVMEGNAKEWVTLNATSGELSVNKKLIQASKPA-NIKIAVTDGLRTAS 936          

HSP 5 Score: 56.6102 bits (135), Expect = 6.739e-8
Identity = 72/264 (27.27%), Postives = 114/264 (43.18%), Query Frame = 3
Query: 1827 DNPVIITPLINQFYISENKQ-RSLLGVIKATDFD---NQTIYYLIDNK----SQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHT---ASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQP---------------NQCTI-FSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVLIAAISG 2537
            +NP   + L     +SE+ +  +++  + A+D D   N  I Y +       S + FSI++ +G +  +  LDRE  + H   V A D           +T+ V+D NDN PIF+       I   +S G  +  + A+DAD G+NG VKY +  S      F++   SG + +   L   + + T T L ++A DQG P               N CT  FS      T   + P ++     + +  DQ  N  V    +SG
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREK-VPTYT-LQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSG 276          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 196.438 bits (498), Expect = 5.268e-51
Identity = 202/691 (29.23%), Postives = 308/691 (44.57%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDRE---EICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNS-FRLFQ-----DNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFY---PRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS--DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD-SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDF---DNQTIYYLI---DNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTA---SDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPLFNLDSDSGDLHLAVSL 2327
            F   S+TG +  T RIDRE   +I    R L  +NQ   V ++               ++D+NDN P + T    +   E+  + +   +  ATD D G+NG V Y + S    + F L        + L +   + LDRE  + Y++ I A D G+P       + + I+D ND+ P FT + +     + EN+ PG  IL + A D D G+NG+  + +  +         L   TG +  K  +D++  K  + F VI  D  V   S +  A V I++ D ND  P +      P N D A  +    ENS   T I  I V D+DS    +   +    D++    +  +G      + I   +  DRE     N  +  TD      ST+  + I + DVNDN P F    Y   I E    G+ +  ++  +D D  +NG  + SI    D  +F +D Q+ ++ +    DREQVS   + I A DHG    T S  V V I D NDN         +  ISE     + +  + ATD    DN  I Y I   D +    F +   +G L+ ++ LDRE +  +  TV A    D    +S  V + + D NDN P+F  +     I  +E PG K+ ++ ATDAD G N ++ Y I+  ++     F++DS +G +    SL
Sbjct:   42 FGFNSNTGVISTTARIDRETTTQISLQLRTLNPSNQPISVQVQ---------------VDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYL--GSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEV-KNSYTFNVIASDGGVP--SKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRS----ENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGF-----YFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYV-LQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPG-KLLQVTATDADEGTNAVISYDIIGGNNNGN--FSIDSSTGVISTLASL 699          

HSP 2 Score: 165.622 bits (418), Expect = 2.541e-41
Identity = 202/725 (27.86%), Postives = 314/725 (43.31%), Query Frame = 3
Query:  396 CPTNRLLKSNNQQCEVTIK-LTHQNINFVQR-----------------LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNS---FRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRP---EKQV-FENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHF-EFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNI-------VSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIG-TMLDNRMFVSDKDSNNNGKFTLSIESPG---DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFDNQT----IYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLH--------------LAV--SLHTIRPIDTNTFLDIEACDQ 2384
            CPT   L      C +T K L  +  +F Q                  ++I I D ND+AP++T +  + S  EN+  G       A D D GSNG + Y ++     S   F L    G+ I   Q LD E KN Y   +IA D G P K++   VT+ ++D NDN P+   +   P   +K +  ENS   T I  +   D D   N +   ++   T+ + E  F V   G   I+ +   D +   F    + V D  V   S S+   V ID+ D+ND  P    +  N  +A ++  + +N S +    Q++  D D              DN  ++  I  G N+   F +        + +  DRE  S +   I   D  ++  +    +T+ I+D NDN P F K +Y   I E   IG T+L  ++  +D DS +NG+ T  I S     +  F ++ Q  +L +K   DRE  S++   +LA DHGD +L SS  V + I D+NDN  +  P+     I EN+    L  + ATD D  T     Y +I   +   FSI+  +G +    SLD E +E   + ++A D        +  V V V+++ DN P+F        +  +   G  + ++ AT  D   NG + Y +  S     LF +DS  G +               LAV   + T++P+     ++IE  D+
Sbjct:  150 CPTGSTL------CVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGV-IRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKI---TNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVP--SRSTLGFVLIDVTDVNDNSPA---FTSNAYTANISE-LAQNGSYVL---QLNATDPDEG------------DNGTVSYSIT-GGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVL--QVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDK--NGSISYAI-VSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDR 837          

HSP 3 Score: 159.844 bits (403), Expect = 1.419e-39
Identity = 199/741 (26.86%), Postives = 329/741 (44.40%), Query Frame = 3
Query:  327 NCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSP--YKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRD-SKGLDKVHC----ESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESK--------LNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPG--DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFD---NQTIYYLIDNKS-QSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH-----TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLH--LAVSLHTIRPIDTNTF-LDIEACDQGQPNQCTIFSGLEIQWT-TNRNEPA 2456
            N F ++S+ G + I   +DREE     + L +   +      L+ Q       ++I + D NDNAP ++T   IV  +    +G       A D+D G NG V Y++ S       +   +G+     ++ D ++   Y + ++A D+GSP  + +  + +T+ I    ++PPKFT S +     V  + P       + AVD D G NG+  + +        E  F + P G++ I+  +   + K  ++  V   D  V   S S+   V I IQD ND     + +  N    T    + ENSS  T +G +  H  D S+  D V+     ES+F  + +                I +  + DRE   K        + AE    DT+       + + + D+NDN P F++  Y   + E    G+ +  R+   D D  +N KF  S+ S    D FF      ++  SK T DRE  S + L + A D  +  L S+  + + + D ND   +         I+E+    SL+  + A+D D   N  I Y I N +  + F +E  +GRL +  SLD E  + + +T+TA D  H     +++  VTV V+D NDN P+F      + +  + + GF + +  A+D D G N  + + +  S      F+++S + ++    A+ L T+ P   ++F L + A DQG P   T  S + +Q T  N N P 
Sbjct:  785 NLFLVDSTGGIIKINGDMDREEKA---QYLLAVIARVGTVKPLSAQ-----ATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQ-YTVQVLASDSGSPPQHSTMTIHITLSI----NHPPKFTLSSYV--THVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNE---EGLFGIFPGGKLYIRKSL-LQALKGSYDLIVRATDGGVP--SFSASVPVTIYIQDSNDHR---SLFVNN----TFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVR-------------SGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPV-FRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSK-TLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQD--HGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSM-YSQTPSKTFSVNSATCEITTIAAIDLETM-PAGRDSFQLVVMATDQGSPKLSTRKS-ITVQVTDENDNSPG 1477          

HSP 4 Score: 123.635 bits (309), Expect = 2.036e-28
Identity = 149/591 (25.21%), Postives = 261/591 (44.16%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQR----LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKY-RNSFRLFQDNG-LYIENTQMLDREKKNVYEIIIIAQD--NGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVR-PTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRET----ESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVS--DKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLIN----QFYISENK--QRSLLGVIKA---TDFDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDRE 2027
            F ++  +G++    R+DREE      L+K+      +       N   ++R    + + + D+NDNAP+++     ++ +E S  GS     +A D D G N +  Y + S    + F +    G L++  T  LDRE  + Y +++ A D  N + Y + ++++TV   D ND  P F +S +     + E++  G++++ L A D D G NG   + +S   +  +   F V   TG + +   +D+++ +  +E  +  QDH + P  LSS   V +++ D+ND  P    +P  P    +  T+ EN +T  P+G+ +  DRD+     +    Y        P      N      I +    D ET           +  TD      ST K++T+ + D NDN P        F        G+ L N M ++  D D N+NGK T SI S  + +F +      L+  +    +  ++++L I A D G     +  +V V      + P+   P  +    Q  ++ENK    S++ V+ A   +  +    YYL  + S+  F + K +G +     +DRE
Sbjct: 1096 FAVDVRSGQITTRVRLDREE------LIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKT--LDRETTSSYNLVVKATDASNANLYSTAKIEITVG--DSNDQRPVFPESDYT--VNITEDALIGSLVINLNASDKDIGQNGLIKYSIS---NGNLAAMFDVESATGRLIVAKSLDFETTQL-YELTITAQDHGLIP--LSSTVNVTVNVLDVNDNAP---LFPTQP----VTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMY-----SQTPSKTFSVNSAT-CEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSP-------GFVSPPAAAAGSSL-NVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQ-MIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSVF----KEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDRE 1642          

HSP 5 Score: 78.5666 bits (192), Expect = 1.254e-14
Identity = 72/268 (26.87%), Postives = 123/268 (45.90%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPND----QNNLKIFN-TNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSII-----IEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQM--LDRE----KKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTV------ILLLKAVDHDFGNNGEFTFRM 968
            I E+  IG ++  +  +D    QN L  ++ +N N    F++ES+TG+L + + +D E             Q  E+TI  T Q+   +   S +     + DVNDNAP++ T    ++  EN   G       A+D D G+N  + + M S+  +  + F  N    E T +  +D E     ++ ++++++A D GSP  S    +TV++ D NDN P F              SPP         ++ + A D D  +NG+ T+ +
Sbjct: 1273 ITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFE-----------TTQLYELTI--TAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPS--KTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFV-------------SPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSI 1512          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 177.178 bits (448), Expect = 7.659e-45
Identity = 186/759 (24.51%), Postives = 340/759 (44.80%), Query Frame = 3
Query:  210 SSNKIYRIKEETEIGYVIDYIKPNDQN---NLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQ---RLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIIL--DVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESP-GDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLIN-QFYISENKQRSLLGVIKATDFDNQT----IYYLIDNK-SQSKFSIEKHSGRLFL----QNSLDREEQETHHITVTASDSLHTASXX----XXXXXXDENDNKPIFKNMNKVIKIDASESP--GFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDT--NTF--LDIEACDQGQP 2393
            SS+   ++ E   IG  +  I   D++    +     N +    F +++ TG++     +DRE +            Q E+ ++    ++N V    ++ + +EDVNDN P+++     + + E SP G+     +A D DIG N  V+Y +     +   +    G+    +  LDRE +  +   I A D+G P KS+   V ++++D+NDN P F ++ +     V EN P GT +L++ A D D G N + ++ +    S  +   F + P TG +  +  ++ + +   +   +   D A+     ++  +  I + D ND  P           +    ++ E+      +G+++  D D     +V    Y++ +   + + ++  NE     I +    DRE  +     I   D    +   N +++I   DVNDN P F+K  Y+  ++E+  + T +  ++  +D D   NG+FT  I +   D  F ID    ++  K   D E+ S++ L + A D G   LT +C V +H+ DV+DN PV   P  + + Y +  +   ++  + ATD D +     +YY I++  + S F I + SG + L       L+RE    + + V A   ++           + V+D NDN P F + + V  +     P     I  + A D D G +G + + +  S  +  +F +D+ +G       L   RP+D    +F  L + A D+G+P
Sbjct: 1194 SSSLTVKLSENASIGTNVTKITALDKDIGDTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVT-----------QYELFVQ-AKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYY--AYVRENQPAGTPVLVVTASDKDVGTNAKLSYVL----SGVLYTRFAIDPDTGNITTREPLNRE-ETGSYTLTLRAVDSAIRAREGTTRVI--ITVTDANDHVPQFT-------QSGYAFSVREDVKVGHTVGRVATTDEDINDNARVR---YYISSGNTSLMFSV--NE-TTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQV-VQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVI-TVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTI-VSGNENGVFQMDNKTG------VLTRTRPLDREDTSFYSLVVMAEDKGEP 1909          

HSP 2 Score: 173.326 bits (438), Expect = 9.931e-44
Identity = 160/598 (26.76%), Postives = 271/598 (45.32%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRP--EKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTM--TPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLT---IIILDVNDNPPEFNKGTY-HFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD-SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPL-------INQFYISENKQRSL-LGVIKATDFDNQTI--YYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            F ++  TG +     ++REE       L++ +         T        R+ I + D ND+ P +T      S  E+  +G        TD DI  N +V Y + S   +      +    I  T  LDRE+   Y +II A+D+G P   +   V + I DVNDN P F+ S++     + VF      T ++ + A D D G NG+FT++++   + +V   ++   TG + IK+K+DY+   + +   V  QD    P  L+    VEI + D++D  P +   PR       N T   +  T+  T I   + H R    ++  + +S FL  ++   I           N   +   +RET ++   ++      + +  K+L    I +LDVNDN P F+  +Y    +++  PI       +   D D   +G+   +I S  +   F +D +  +L      DRE  S + L ++A D G+  L+SS  V + + D+NDN P++ TP+          F + EN    + +GV+ A D D + +  YY+ + + Q  F + + SG L  + +LDRE+   H++ V AS+
Sbjct: 1446 FAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTT--------RVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLK----TQVVQVIATDPDEGANGQFTYKITAGDTDDV--FYIDANTGLITIKAKLDYEK-TSLYNLTVSAQDLGTPP--LTGACFVEIHVSDVDDNAP-VFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVIT---------LNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTKNLIYYYITNTEEQKYFILNETSGELRTRITLDREDSSVHYLYVKASN 2016          

HSP 3 Score: 171.785 bits (434), Expect = 2.882e-43
Identity = 192/720 (26.67%), Postives = 330/720 (45.83%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPNDQN---NLKIFNTNDNGVNCFELESSTGKLFITRRIDRE-------EICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLY--IENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEI-KSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHS--TVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSF-FTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENK--QRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD---SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHL 2315
            + E    G VI  +   D++   N  IF +++     F +  STG + +   +DRE        +   N +  + +   +V I +T               DV D+ P + +    V  +EN+ IG+  +   A D DIG    + Y + +   + + LF  + +   I     LDRE    YE+ + A+D+ +   S+ L+V V++ DVNDNPP F+   +  E   +E SP GT IL +KA+D D G+N    + +  N +  V  + +   TG + +  S++D + ++ +F F +   D  V   S SS A V I + DIND  P       N D       + EN    TP+  ++  D+D     K+   SY L    L    AI   +P+  NI +    +RE        +R  D++  +      + I + D ND+ P+F +  Y F ++E+  +G  +  R+  +D+D N+N +    I S   S  F++++   I+ +  T DREQ + + L I A DHG   L S+  V + I+DVNDN  + +  +    + E+   +  ++ VI ATD D     Q  Y +    +   F I+ ++G + ++  LD E+   +++TV+A D      T +  V + V D +DN P+F       ++  + + G  +  + ATD D   +    Y   +S   + +F +   SG + L
Sbjct: 1098 VSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVT---------------DVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDT--ISYSIANG--DPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVN-LVSDLLKVVVQVEDVNDNPPVFSMPGYTIE--YWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAI---TGVISLGSSQLDREVEE-YFNFTIRATDSGVP--SKSSTASVAIKLVDINDNSPVF----NNTDYYAY---VRENQPAGTPVLVVTASDKDVGTNAKL---SYVLSG-VLYTRFAI---DPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTV-GRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVI-ATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITL 1773          

HSP 4 Score: 150.984 bits (380), Expect = 7.996e-37
Identity = 184/731 (25.17%), Postives = 318/731 (43.50%), Query Frame = 3
Query:  333 FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNI------NFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM----ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRN----------------PDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCES-------YFLD-------------------NDKLNPIIAIGTNEP--------NEFNIVSNRKFDRETESK--LNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCI-VYVHIKDVNDNPVIIT-PLINQFYISENKQRSLLGVIKATDF---DNQTIYYLIDNKSQSKFSIEKHSGRLFLQNS-LDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDL 2309
            F L+  TG+L + + +DRE   P        + +  + I  T Q        +   R+SI + D NDN+P + +       +E +  GS      ATD D+   G+VIY +    E++     +L +    + +N  +    K +V    ++                + + DVNDN P F  S +  +  V ENSP GT +L + A D D G NG+ T+++   T+   +  F +   TGE+ +   ID ++  T F   V  +D   EP S  + A V I ++D ND FP  +F                    PD    + T+   SS   P   ++   R+ + +  ++ ES       Y+++                   ++ +N II   +N          +  +I+ +   DRE ++   LN            T   + I + DV D+ P FN  +    + EN  IGT +  ++   DKD  +   ++++   P    FTID     +++    DRE V+ ++L + A D  +  L S  + V V ++DVNDNP + + P     Y  E+ + + +  +KA D    DN  + Y I        ++   +G + L +S LDRE +E  + T+ A+DS     +++ +V + +VD NDN P+F N +    +  ++  G  +  + A+D D G N  + Y+L    Y    F +D D+G++
Sbjct:  758 FRLDPVTGELSVRKELDRE--SPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKLVRHYNWHKKNCVLCKESKCSVERTYVV----------------IYVDDVNDNDPVFNQSKYAAD--VLENSPTGTPVLRVHASDRDQGANGKITYKL---TNGNKDDAFSINNVTGEITVAGVIDREAVHT-FVLTVQAEDQG-EPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMVPDQKISSSTLRPRSSPRAPAALLTA--REKRPITLINDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNV-TKITALDKDIGDTISYSIANGDPY-GLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVN--LVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTR--FAIDPDTGNI 1455          

HSP 5 Score: 142.51 bits (358), Expect = 3.079e-34
Identity = 165/650 (25.38%), Postives = 299/650 (46.00%), Query Frame = 3
Query:  507 VNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAV-VEIDIQDINDEFP-------TIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS--DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTA---SXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFK--ICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQP 2393
            +ND +P++      V+ +E++  G       ATD D G N  +I+   +     F + +  G  I ++  LDRE KNVY + + A +  +  +    QV + + DV D+ P F  S      ++ EN+  GT +  + A+D D G+   ++     N  P     F +   TGE+   +++D + + T +E  V  +D      +L S+ + V + ++D+ND  P       TI ++  +P+      +IL+  +    IG     D  +     V   + ++  + +  +I++G+++            DRE E   N  IR TD+     S+  ++ I ++D+NDN P FN   Y+ Y++EN+P GT +   +  SDKD   N K +  +     + F ID     + ++   +RE+   + L + A+D        +  V + + D ND+    T     F + E+ K    +G +  TD D     +  YY+    +   FS+ + +G +   ++LDRE+  ++ + +TA D    A   +T+V + + D NDNKP+F     V  +   ES   K  + +++ATD D G NG   Y +      + +F +D+++G + +   L   +    N  L + A D G P
Sbjct: 1082 INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINA-IIFYSSNGAEAKFYVSRSTGDIIVDSP-LDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSL--TVKLSENASIGTNVTKITALDKDIGDTISYSI---ANGDP--YGLFTIDNVTGEIRTVAELDRE-NVTQYELFVQAKDSV----NLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGT----SILQVKAIDADIG-----DNAAVLYSIVENVTDYVTVNAITGVISLGSSQ-----------LDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPV-LVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFS--KSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGD-TDDVFYIDANTGLITIKAKLDYEKTSLYN--LTVSAQDLGTP 1691          

HSP 6 Score: 138.272 bits (347), Expect = 7.577e-33
Identity = 150/540 (27.78%), Postives = 243/540 (45.00%), Query Frame = 3
Query:  744 EIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNI------VSNRKFDRETESKLNAEIRCTD---TSDHSTVKNLTIIILDVNDNPPEFNKG-TYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILK-SKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITP----LINQFYISENK-----QRSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHH---------ITVTASDSL------HTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY 2246
            +++    D    + +N   VT+ +I+VNDN P F  S +     + E   PGT I  + A D D G  G  T+ +    +     +F V    G +     +DYD+ +  ++F ++V+D     Y   + A V + +QD+ND  P     P   D       I EN    T + Q++  D+DS             +N +L+  I+ G ++   F+I       + R+ DRET +     +   D   +S H  V+ LT+ +LD NDN P+   G T    I E    GT+L + +   D D+ +NG+ T S+ S GDS FT++     L+ S    DRE    + L I   D+G    T+S  V+V I DVNDN     P     +  + I+ ++      ++L+  I ATD D   N  + Y +       F ++  +G L ++  LDRE  +            + +TA+D         +A+  V++ V D NDN P F++ N   ++  +  PG  + ++ ATD D    G V Y
Sbjct:  357 KVVATETDTSEKFSANA-SVTLTLINVNDNKPMFAKSSYN--YTMDEEITPGTHIADITATDADLGTFGALTYELRGGQA----AYFSVNADNGTISAAQILDYDTLR-QYQFSLVVKDGG-GFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSD-------IAENLPAGTIVFQVTATDKDSG------------ENGRLSFNISAG-DDGGHFSINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQ-LTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSM-SGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLID-INATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIY 864          

HSP 7 Score: 125.561 bits (314), Expect = 5.132e-29
Identity = 178/682 (26.10%), Postives = 278/682 (40.76%), Query Frame = 3
Query:  348 STGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPE---ATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFE-----NSPPGTV---ILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKT--------HFEFKVIVQDHAVEPYSLSSEAV-VEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPG-DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGD--ERLTSSCIVYVHIKDVNDNPVIITPLINQF----YISENKQRSLLGVIKATDFDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDL 2309
             +G +   R +DRE I      + + +      +   H+++    +L++ + D NDN P   TD   ++ N +   G    L     A D D GSNGQ+ Y M S   + F L    G    +   LDRE K+ Y++II   DNGSP  +N   V V I+DVNDN P F  +   P + +       +  PGT+   ++ + A D D   NG+  + +S +        F + P TGE+ ++ ++D +S +          F   +   D A       S  V V I ++D ND  P   F  +N ++      + E +   + + Q+S  D+D +   KV       D D+         N   E   +       +    L  E +C+    +     + I + DVNDN P FN+  Y   + EN P GT +  R+  SD+D   NGK T  + +   D  F+I+     +      DRE V    L + A D G+   R T + +V + +KD NDN         QF    Y  E  + S +G          TI  + D K  S     + S R        RE++    I                      ND  P+F+     + +  S S G  I ++ ATD D G N ++ Y    S+  E  F +   +GD+
Sbjct:  546 GSGLVTTARELDRETIATYTLTVSAYDHG----VSSRHKHV----QLTVNVLDENDNTP-QITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSM-SGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPN---PAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDE----HGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSP--QFQSQNYETR-----LSEAARPGSNVIQVSATDQDLEYKGKVIYN--ITDGDE---------NRKCEVEKLVRHYNWHKKNCVLCKESKCSVERTY-----VVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPV-LRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVV-ITVKDENDN-------FPQFSFTGYEGEIAENSPVG---------STITMVPDQKISSSTLRPRSSPRAPAALLTAREKRPITLI----------------------NDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFY---SSNGAEAKFYVSRSTGDI 1144          

HSP 8 Score: 124.405 bits (311), Expect = 1.112e-28
Identity = 193/696 (27.73%), Postives = 296/696 (42.53%), Query Frame = 3
Query:  483 RLSIIIE--DVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDS--IFRPEKQVFENSPPGTVIL-LLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPT-GEVEIKSKIDYDSDKTHFEF----------------------KVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD---HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD-SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRS--LLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQ-NSLDREEQETHHITVTASDSL---HTASXXXXXXXXDENDNKPIFKN------MNKVIKIDASESPGF---KICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRP-------IDTNTFLDIEACDQGQP 2393
            R ++IIE  D++D  P +     +    EN+PIGS     EA D D+G N  ++Y + S   +       N   I     +D EK +V+ I + A +   P  +  + V V ++DVNDN P F  S  IF   + V   + PG V+   L+  D D   N  F   +      + +K F + PT G + I   +DY+  + +F F                      K +V          S+ A V + + ++ND  P  A        ++ N T+ E  +  T I  I+  D D   L      +Y L   +     A  +   +   I + +  D +T  +    +   D         +  +T+ + DVNDN PEF    Y   I EN P GT++  ++  +DKDS  NG+ + +I +  D   F+I+    +  ++   DRE ++ + L + A DHG         + V++ D NDN P I   L     ISE       LL  I A D D     Q  Y +  +   S+F++   +GRL +    LDRE ++++ + +  +D+    +T STTV V ++D NDN P F           VI +D  E PG     +  I ATD D   NG V Y L  S  +   F LD  +G+L +   L    P        D    LDI A DQ  P
Sbjct:  136 RTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDV---ALPGRVVSDQLQVTDGD--KNPVFRRVLYHLVGADSDK-FAIDPTSGTLYINKTLDYEK-QINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFA-------KSSYNYTMDEEITPGTHIADITATDAD---LGTFGALTYELRGGQA----AYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIV-FQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGLVTTAR-ELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSM--SGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVD--EGPGTINKTLIDINATDPDADANGKVAYSL--SGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATP 802          

HSP 9 Score: 123.25 bits (308), Expect = 2.493e-28
Identity = 158/589 (26.83%), Postives = 257/589 (43.63%), Query Frame = 3
Query:  477 VQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILL-LKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSD-KTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDS-ATMNPTILENSSTMT-PIGQISVHDRDSKGLDKVHCESYFLDND-----KLNPIIAIGTNEPNEFNIVSNRKFDRET---------ESKLNAEIRCTDTSD-----HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQF-YISENKQRSLLGV----IKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTAS----XXXXXXXXDENDNKPIF 2135
            +  +++ ++DVNDN P +T         EN P G+      ATD D G NG++ + + +           +GL +   + LDRE    Y + + A D+G   +   +Q+TV ++D NDN P+ TD +      + E +  GTV+L  + AVD D G+NG+ T+ MS   S    +  L   TG ++I S    D + K  ++  + V D+   P + S+   V + I D+ND  P  AF P    S AT   T+ E   T+   +  I+  D D+    KV   +Y L  D     +L+P+         E ++   ++ DRE+         + +   +I  TD +       S    ++I + D NDN P+F    Y   + E    G+   N + VS  D +        +E  G   + I   ++  K +V       + HK   +        +  + +V +++ DVNDN     P+ NQ  Y ++  + S  G     + A+D D     +  Y L +      FSI   +G + +   +DRE   T  +TV A D    +S      V + V DENDN P F
Sbjct:  477 IATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGL-VTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGL-TITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDS----RFTLNSATGRLQI-SPTGLDRELKDSYDLIINVTDNGSPPNTNST--TVHVTILDVNDNTP--AFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKV---AYSLSGDEHGFFRLDPVTG-------ELSV--RKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGS---NVIQVSATDQD--------LEYKGKVIYNITDGDENRKCEVEKLVRHYNWHKKNCVLCKESKCSVERTYVV-IYVDDVNDND----PVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQF 1026          

HSP 10 Score: 84.7297 bits (208), Expect = 1.708e-16
Identity = 62/208 (29.81%), Postives = 104/208 (50.00%), Query Frame = 3
Query:  492 IIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENT--QMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSKIDYDSDKTHFEFKVIVQDHAV 1106
            +I++D NDNAP++T    +    EN+ +G+      A D D G+N QV Y+  +        F  N +  E T    LD E    Y +++IA+D G P   +   V +E+ D++D PP+F  S +   K++ EN+P G+ ++ ++A D D G N    + +    S  V   F +   TG + +   I  D++KT   F++ V+   V
Sbjct:   34 LIVDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYL--KEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGV---FTIDSNTGVITVNGSI--DAEKTDV-FRITVKASEV 233          

HSP 11 Score: 71.2478 bits (173), Expect = 2.277e-12
Identity = 58/206 (28.16%), Postives = 100/206 (48.54%), Query Frame = 3
Query: 1491 IIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNG----KFT--LSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLG----VIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            +I+ D NDN P F +  Y   I EN  +GT +  ++   D DS  N     KF+   + ++P   FF+++  N  L      D E    + L ++A D G  +L S   V + + D++D P      +  FY+ E ++ + +G     ++A D D    N  +Y +I   S   F+I+ ++G + +  S+D E+ +   ITV AS+
Sbjct:   34 LIVDDYNDNAPVFTEQPYMAKIAENARVGTTI-LKISAIDADSGTNSQVQYKFSNATATQTP---FFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMP---PRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASE 232          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 174.096 bits (440), Expect = 7.178e-44
Identity = 212/820 (25.85%), Postives = 363/820 (44.27%), Query Frame = 3
Query:  492 IIIEDVNDNAP--IWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESK-YRNSFRLFQ----DNGLYIE-----NTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKS-KIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPT--ILENSSTMTPIGQISVHDRDSKGLDKVHC-----ESYF-LDNDKLN--PIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD--HSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDS-----FFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD-SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCT----------------IFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIAFIVFKQKSIFFARIPSRSNFSHQKKHMNPSVTCYRDNFV--------TPDYHCSTELENLETDLRQNRDMGTTPIF 2774
            + ++D+NDN+P  +  T   +V F  +     R+ L  A D D GSN    Y + S    N F+L      D  LY +     ++  +DRE+ + Y + I A D G+P     L++++ + D NDN P+F++  +     + EN   GT IL + A D D G N E  + +  ++ P+    F + PT  V + + ++DY++ +++    V+  +     + LSS A+V I++ D+ND  P I        S T+  +  + EN++  T + ++SV D DS    +V+      + YF +  D LN   IIA+G            +  DRET      +  C D  D   +T K+  I + DVND  P+F++ TY   + EN  + T++     V D+D  +N +   +I +  +S     +F ID  + ++ +    DREQ+    L +L  D G   L+ +C V V++ D NDN P       N      +   S +  + A D D   N  I Y I   + + F ++   G +    +LD E Q ++   V A+D    + + TV V + D NDN+P+F   +  ++   +   G  IC++ A D D     + ++I+++ +  E +F++D  SG + LA  L   R    N  L ++A D G  +                   IFS  E  +T   +  A          S D+  N  V+ +   G    +++I     ++ Q  +   +IPS       K    P +  Y +  +        +P ++ S+ L  L  D        T  +F
Sbjct:   46 VYVQDLNDNSPSFVRGTSAKLVVFENDKDF--RQKL-IAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSY--SGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQA--IFGIHPTTGVIVNNVRLDYEAKRSY--LIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHV------SYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVG------------QSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAV-DQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPN-TPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADE-VFSVDG-SGLITLAKLLD--RETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVF 832          

HSP 2 Score: 171.785 bits (434), Expect = 3.250e-43
Identity = 191/756 (25.26%), Postives = 330/756 (43.65%), Query Frame = 3
Query:  225 YRIKEETE----IGYVIDYIKPNDQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLD-REKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFP-----TIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTV--KNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDH-GDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD----SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESP-GFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF----LDIEACDQGQPNQCTIF 2411
            + I+E ++    IG+V    +    N   +++ +    +   L +STG L++   +D E+I      +++ ++         +        ++I + D+NDN+P + +   +V   E++PIG         D D G  G+V + + S     F L  + G  +  T+++D       Y + + AQD GSP +S+   + ++++DVND  P F +  +     V E +PP + I+ + A D D G NG  ++             F +R  G++ IKSK+D + D   +  KVI  DH       SS A V++ + D+ND  P     + AF+            + EN    T +G +S  D D      V   +Y  D      I+   T +     I +++  DRE ++     I  TD      V    +T+I+ DVND  P+F+K  Y   + E+ P+G+ L   +   D     N   T  I + G   F+++Q   +L      DRE    H L ++A D  G++ L +   + +++ DVNDN PV I     +    +    S++  + A D D     +  Y +++  +   F I + +G +    +LD E    + + V+A+D       T+   VT+ V D NDN+P F + N +I       P    +  I A D D G N  + Y +   S +   F ++S++G       + T  PID        L + A DQ    Q  ++
Sbjct:  710 FTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYAN--------VTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGA-LSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSY--TAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVD---TSKFGLRNGGKIFIKSKLDRE-DIEEYNLKVIAIDHGTP--RRSSSADVKVIVDDVNDNNPHFQQASYAFF------------VKENEPVATYLGAVSASDSDEGSNGHV---TYRFDTQVAQFIVDKQTGK-----ITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVA-GPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTF-DKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRA-HFKINSETG------LIQTTHPIDREEISEYSLKVRATDQAFTEQDRLY 1419          

HSP 3 Score: 162.925 bits (411), Expect = 2.056e-40
Identity = 162/643 (25.19%), Postives = 285/643 (44.32%), Query Frame = 3
Query:  465 NINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPE--ATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKF-------------------------TDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDIND-EFPTIAFYPRNPDSATMNPTIL-----ENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIII--LDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD-SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISEN-KQRSLLGVIKATDFDN----QTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHH--ITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYIL 2252
            ++N    L I + D NDN+P +     +    E++     R + +  ATD+D G+NG+V Y + +               I   ++LDRE    ++++I   D+G P KS   QV V + D+NDNPP F                         TD   R    +   S PG  IL + A D D G+N +  +      S +++ + +   TG +  +  ID     +  +  V   D  V P      A+V + I    + +F   +++ + P++A M  ++L     +N++ + P+G+IS +         +   +YF    + + +I++            N+  D ET+ +    +   D +  S    + + I   DVND  P F +  Y     E  P+GT++ N +  +DKDS  NG+   +I+S  D   F ID++  +++++   D E +  H + + A D G   + +   V + + D+NDN PV   P  N   + EN    S L  I ATD D+    +  + +I    Q  F I+K SG L    + D E    +   +T+ A+D+ +   +++ T+ V V DE++  P F  M+    +  +   G  + ++ ATD D G+ G V ++ 
Sbjct: 2046 SLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQID-YKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPP----QRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGL-PLGRISYN---------IENSNYFRIGQR-SGVISV------------NKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVN-VSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVF 2659          

HSP 4 Score: 159.458 bits (402), Expect = 2.085e-39
Identity = 204/722 (28.25%), Postives = 331/722 (45.84%), Query Frame = 3
Query:  315 DNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDI-GSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQ-VTVEIIDVNDNPPKF-TDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS--DHSTVKN---LTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFDN------QTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD---SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASE-SPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEI 2426
            D  V  F ++  TGK+  ++ +DRE        + + +      +  T        ++++I+ DVND +P ++ +K  V+ NE+ P+GS      ATD D  G N  + Y + +  + +F L Q  G+ +     LDRE  + + + ++A D G       +  + + ++DVNDN P F  ++ F   K V E  P G+V+  + AVD D G+NG+  +++    +    K  +   TG +     +D++     +  +V   D   +    S + +V I ++D ND  PT   + +NP    +   I EN    T +  I  HD DS GL+       +   D  +P      N      I +    DRE  S+ + ++R TD +  +   + N   L III D+NDN P+F       Y+ E+EP    +   +   D D+   G     I SP    F++D +  +LK   + D E V  + L I A D G   LTS  +  V + DVNDNP   T  +    +SENK      V+K T +D       +  Y +       KFSI+KHSG +   + LDRE+++T+ +TV A+        +ST+V + V+D NDN P F  ++ V+ +   E SP   I  +   D D+GNN  V Y +  S   +  F +   +G+L     L   R    +  L ++A D   P   T F+ + I
Sbjct: 1056 DTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKT--------QVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPK-AFSLNQVTGV-LTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTF---KTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFK--INETTGVISTLRALDFEV-TNRYVLRVSATDMGKKQQKTSYQ-LVTIYVEDANDNRPT---FDKNP----IITWIYENVPINTNVTTIKAHDDDS-GLN----SRIWYTIDSQSPRAHFKINSETGL-IQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLT-YVMEDEPFNFQV-TSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTG-TSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKF--ISPVVTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSI-MSGNTDGAFTIGRSTGELSTTTKLD--RETKASYQLSVQAKDI-TPPYYTAFANITI 1738          

HSP 5 Score: 159.458 bits (402), Expect = 2.232e-39
Identity = 192/672 (28.57%), Postives = 310/672 (46.13%), Query Frame = 3
Query:  354 GKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHD-FGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQI--SVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFN--IVSNRKFDRETESKLNAEIRCTDTS---DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK--FTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHG---DERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSL-LGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREE--QETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESP-GFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSG 2303
            GK+FI  ++DRE+I   N  +        + I       +    + +I++DVNDN P +          EN P+ +      A+D D GSNG V YR +++    F + +  G  I  +Q+LDRE K  Y   I+A D GS  + ++ QVTV + DVND  PKF+ + +     V E+ P G+ +L L A D D  G N + T+ +         K F L + TG + + S +D +    H    V+  D      SL +   +EI++ D+ND +P             +N T  +      PIG +  +V   DS   D      Y + N   +     GT + NE    I + R  D E  ++    +  TD       ++ + +TI + D NDN P F+K     +I EN PI T +   +   D DS  N +  +T+  +SP  + F I+ +  ++++    DRE++S + LK+ A D      +RL ++  + + I+D+NDN P  ++   N  Y+ E++  +  +  I A D D      + Y I +    KFS++  +G L L  SLD E+  Q T HI+ T   S    S  +  VVV + ++ P     +  I   +   P G  + K+ A D D G+N  + Y +  S  +   F++D  SG
Sbjct:  966 GKIFIKSKLDREDIEEYNLKV--------IAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ-FIVDKQTG-KITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKY--SVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAG-----PKAFSLNQVTGVLTLVSPLDREVTHRHI-LHVVASDKGGN-QSLETITYIEINVLDVNDNYPVF-----------INETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVR-YKIVNGNTD-----GTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNV-TTIKAHDDDSGLNSRIWYTIDSQSP-RAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSR--NLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSI-PSGVEMDKFSIDKHSG 1596          

HSP 6 Score: 156.377 bits (394), Expect = 2.279e-38
Identity = 181/670 (27.01%), Postives = 304/670 (45.37%), Query Frame = 3
Query:  492 IIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQ-DNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQ----ISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSN-------RKFDRETESK---LNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD-SFFTIDQQNQI-LKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFD---NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD---SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDAD-HGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEI 2426
            + + D+NDN P++      V + EN+ IG  +S+ +   ID  S    I R   +  N+  +F  D    I   ++LDRE ++ Y + + A D G     N+  V + ++DVND PP F+ + +    Q  E+S   +VI  + A+  D G N E  + +S   +  +    L+  TG + ++S++D++   + +   V  +D    P  L   A V I + DIND  P              + +IL      TPIG     +SV D DS  L +V                ++ +N    FN+ SN       +  D    ++   L  + +   +   S+   L + ++DVND  P F   +Y  ++ E  P  + +   +  +D DS  NG+ + + +S  D S F +    +I +KSK   DRE +  + LK++AIDHG  R +SS  V V + DVNDN          F++ EN+   + LG + A+D D   N  + Y  D +  ++F ++K +G++     LDRE + ++  ++ A+D   S     T VTV+V D ND  P F      + ++     G  +  ++ATD D  G N  + Y++         F+L+  +G L L   L   R +     L + A D+G        + +EI
Sbjct:  587 VSLTDLNDNQPVFDPSSYSVEYFENTRIG--QSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQ--EHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNI---VLINSTGTLYLQSEVDHEKIPSLY-LTVQAKDKGTPP--LFGYANVTIAVIDINDNSPQFN-----------SSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVS--------------FSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNI-IEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKSK--LDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQV-AQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAG---PKAFSLNQVTGVLTLVSPLD--REVTHRHILHVVASDKGGNQSLETITYIEI 1212          

HSP 7 Score: 148.673 bits (374), Expect = 5.171e-36
Identity = 176/665 (26.47%), Postives = 287/665 (43.16%), Query Frame = 3
Query:  483 RLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRME--SKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYK-SNELQVTVEIIDVNDNPPKFTDS-IFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTN----------EPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIII--LDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLG----VIKATDFDNQ----TIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXX---XXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL-HTIRPIDTNTFLDIEACDQGQP 2393
            RLSI +ED NDN P ++      +  EN  +G+      A+D DIG+N ++ Y +E  S  +  F +    G+ + N + LD E K  Y I++ A+D GS ++ S+   V +E++DVNDN P    S       QV EN+  GT +  +   D D G NGE    +         K  ++     + +   +D ++   HF  K +  D    P   ++E    I++ D+ND  P         D  T    + EN++  T +  ++  D+D            F  N +L   IA  T           +P+   I +    DRE   ++   +   D        N ++I+   D NDN P FN+ +Y+  + EN P G+ +  ++   D D   N     SI +P   FF +D +  ++ +  T D E  S +  ++ A D G    + +  V+V + D+NDN  +  P     Y  E  + + +G     +KA D D+     T + +    +   FS++  SG + L   LDRE Q+ + +TV A D     S       + V+D ND  PIF        I         I  + A   D G N  V Y + K +    +  L + +G L+L   + H   P   + +L ++A D+G P
Sbjct:  157 RLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVR-LDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHD-HFFLKAVCIDKGDPPR--TTEKSFRINVGDVNDCAPKF-------DRHTYETRVWENATVNTLVAIVNAVDQD------------FGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPV-VQLLAQDPDIGENSLILYSILTPNTPFF-LDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGR--SCNATVHVSLTDLNDNQPVFDP---SSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDG-SGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIV--LINSTGTLYLQSEVDHEKIP---SLYLTVQAKDKGTP 785          

HSP 8 Score: 134.806 bits (338), Expect = 8.742e-32
Identity = 172/687 (25.04%), Postives = 297/687 (43.23%), Query Frame = 3
Query:  486 LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYR-MESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHST-----VKNLTIIILDVNDNPPEF-NKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIES--PGDSFFTIDQQNQIL--KSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN----KQRSLLGVIKATDFDNQT----IYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSL---HTASXXXXXXXXDENDNKPIFKNMNKV---------------------------IKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQ 2399
            + I + D NDN P + +    +   ENSP     +L    D+D G+N +V+Y  M      +F + +  G  +  T  LDRE K  Y++ + A+D   PY +    +T+ I D NDNPP F  S++     + E +PPGT IL L A D D G+NG   + +S +T      + +   TG V   ++ +  S K  + F  I +D   +P    +   V I I+D N+  P     P           I  N+S    +  ++  D D+         +Y LD+ K +   ++   E N  ++ ++  F    + +    I      DH +        + I+I ++ D+PP F N+      I EN  +G+ +      +  D+    + T SI S   G +F+ +D    ++   S    D E     +L ++A   G   L    I+ +++ D NDN     P      ++E+    K R ++ V  ATD D+ T     Y +        F+I+  +G +     LDRE   +  + +  +DS     + +  V VVV D NDN P+F  +++V                             + ++ +PG  I ++ ATD D G+N  +KY    ++  +  + +D+D+G +    ++  +R  D+   + ++A DQG P Q
Sbjct: 1632 VRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTL-TVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTG-ELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLY--SSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDT---YGVYSIDSRTGIVYSAARFE-TSIKQEYNFFCIAKDQGQDPK--MAIVPVRIKIEDKNNHAPQFTKTP-------YEVHIFPNTSASALVTMVTATDADTDKSTNGKV-TYRLDDSKNS--TSLFVVESNTGSVRTSAGFSNPPQGRHALYIIA---EDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDA----QVTYSIISGNKGRAFY-VDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKV-TATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTID-VRIRDSFIQIPVQAMDQGVPPQ 2288          

HSP 9 Score: 115.546 bits (288), Expect = 6.565e-26
Identity = 168/692 (24.28%), Postives = 297/692 (42.92%), Query Frame = 3
Query:  486 LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDI--GSNGQVIYRME-SKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEK-QVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRP-TGEVEIKSK--IDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTP--IGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS--DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDN---------------------------RMFVSDKDSNNNG--KFTLSIESPGDSFFTIDQQNQILKSKVTFD-REQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLG--VIKATDFDNQT------IYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXX---XXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF----LDIEACDQGQP 2393
            + I IED N++AP +T     V    N+   +  ++  ATD D    +NG+V YR++ SK   S  + + N   +  +       +  + + IIA+D+GSP       V + I ++ D+PP+F +    P +  + ENS  G+ I  ++A      ++ + T+ +    S    + F V P TG + + S   +DY+S K +F   ++         SL+   +++I++ D ND  P  AF+P N     M   + E++    P  + +++  D DS    KV   S +  N+       + T +     I + +  DRET +  +  IR TD+     ST   + +++ D+NDNPP F+  +    I+E+   G ++ +                           R+  +D+DS +N   K++  I +     + ID    ++ ++ T D R + S  ++ + A+D G        +VYV I  +   P    P     Y  +  + +++G  V+     DN        I Y I+N +   F I + SG + +   LD E +    + V+A D    +      V   V D ND KP+F     + +       G  +  + A D D G NG V + ++    K   F +D  +G       + T R +D  T     + + A D+G P
Sbjct: 1840 VRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQT--PARVSIPENSKVGSYITTVRA---RASSDAQVTYSI---ISGNKGRAFYVDPFTGVISVASADALDYESTK-NFRLHLVATPQGW--VSLNGYMILDINVIDRNDNSP--AFHPSN-----MLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKV-TYSIWTGNEA-----GVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLS-EVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVP--PQRALVYVRII-ITREPKFELP----SYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNY--FRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGS-FAIDRKTG------VIRTQRALDHETIKTHHVSVRATDEGSP 2490          

HSP 10 Score: 105.916 bits (263), Expect = 5.915e-23
Identity = 147/556 (26.44%), Postives = 235/556 (42.27%), Query Frame = 3
Query:  687 NGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAV------------VEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTII---ILDVNDNPPEFN-----KGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTID----QQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFD---NQTIYYLIDNKSQSK-----FSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY 2246
            N   I    +LDREK + Y + I+  +  +P KS  + V V+  D+NDN P F       +  VFEN       L+  AVD DFG+N   ++ +       V K    R T         D  +D       + V    ++ Y L+  A             + I ++D ND  P  +       + + + TI EN    T I Q+S  D+D       + E  +      +P    G + P    IV+N + D E +      ++  D      + +  I+   +LDVNDN P  +      G+Y   + EN  IGT +  R+ VSD DS  NG+  +++E  GD +F++         I+    + DRE      LK + ID GD   T+     +++ DVND          +  + EN    +L+ ++ A D D   N  + Y I N ++S+     F+I+  SG +     LDRE+     +TV   D      + + +V V + D NDN P F   +    +  +   G  + +++A D D G N L+ Y
Sbjct:   10 NAGVITTKTVLDREKVSAYNLTIV--EFSTPPKSYTVLVYVQ--DLNDNSPSFVRGT-SAKLVVFENDKDFRQKLI--AVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDG-------DLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFS-------NVSYSGTIPENIDVGTSILQVSASDKDI----GTNAEIQYSIETHSDPQAIFGIH-PTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQ--VTENATIGTQV-ARVSVSDADSGKNGEVNVTLEG-GDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILY 535          

HSP 11 Score: 95.1301 bits (235), Expect = 1.234e-19
Identity = 148/622 (23.79%), Postives = 263/622 (42.28%), Query Frame = 3
Query:  279 NDQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIW-----------TTDKAIVS----------------FNENSPIGSRRSLPEATDIDIGSNGQVIYR--MESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKF-TDSIFRPEKQVFENSPPGTVILLLKAVDHDFG-NNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQI----SVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSD---HSTVKNLTIIILDVNDNPPEFN-KGTYHFYIKENEPIGTMLDNRMF---VSDKDSNNNGKFTLS-IESPGDSFFTIDQQNQILKSKVTFDREQVSVHK--LKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISEN-KQRSLLGVIKATDFDN---QTIYYLIDNKSQSKFSIEKHSG 1994
            N +    I+  N+ GV  F ++S+TG++   + +DRE     + +++  +    +  K T+  +       +++ D+NDN P++           T   A+V+                    S  G       ATD D GSN Q+ Y   + +  +  +++  D G+      +  R + +  +I + A D G P       V V II   +  PKF   S F    +V EN+  GT +L ++  D+  G   G  ++ +      E   +F + + +G + +   +DY++ +        + D A    S      V I++ D+NDE P                  +   S   P+G I    S  D+DS    +V       D DK +  I   T       I + R  D ET    +  +R TD      H+ V ++TI +LD+NDNPP F   G     + EN P    L++R++    +D+DS  N + + + I   G   F ID+ +  L + +TFD E  +V++  L I A D G+  L+S+  + V++ D ++       +  +F +  N K    +G + ATD D+     ++++  N + +   +   +G
Sbjct: 2101 NGKVTYSIWTGNEAGV--FTIDSTTGEITTAKLLDRETTASFDLVIRGTD--SGIPPKSTNCQVK------VVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVP--PQRALVYVRIIITRE--PKFELPSYF---GKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNI------ENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAP---SKPVRVPVYINVSDVNDEKPVFG-----------QSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGD-DKGSFAIDRKTGV-----IRTQRALDHETIKTHHVSVRATDEGSPPMHTDV-SVTIRVLDLNDNPPVFRVPGPNDVQVLENLP----LNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNALKMNATTG 2674          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: ENSORLT00000005220.2 (pep primary_assembly:ASM223467v1:10:15161680:15164187:-1 gene:ENSORLG00000004171.2 transcript:ENSORLT00000005220.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 247.284 bits (630), Expect = 2.002e-68
Identity = 202/671 (30.10%), Postives = 335/671 (49.93%), Query Frame = 3
Query:  168 LW---WSIFA-LIDIEGLSSNKI-YRIKEETEIGYVIDYIKPNDQNNLKIFNTNDNGVNC------FELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNG---LYIENT--QMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGE--FTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPI-IAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLS-IESPG-----DSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYI-SENKQRS-----LLGVIKATDFDNQ----TIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            LW   W++F  L+ +   S  +I Y I EE + G  +  +  +   +++   T+   +        FE++  +G L++  RIDREE+CP       N  +C + I+ +  N   + R+ ++I D+NDNAP +  +   V  +E+S +G R  L  A D D+G N    Y++      S  + Q  G   ++ E    +++DREK+  YE+I+ A D G P K+  L + V ++DVNDN P F+  +++   QV EN+  GT +L L A D D G NG+  +TF      SP+ +  FL   TGEV +K  +D++  +  +E +V  +D    P S  S+ +VE  + D+ND  P I+       S+ M+P + E++   T + ++ V+DRD     K +C+        +N +   + +N  N +++ ++   DRET S+ N  +  TD  T   S+   +T+ + DVNDNPP F     + Y+KEN PIGT +  ++   D D + N K T   I++P       S  TI+ +   + S  +FD E++   + K+ A D G   L+S+  V V + D NDN P I+ P      + SEN   S      +  I+A D D+       Y+L + K  + F I   SG +  +  +   + ++H + V  SD
Sbjct:    6 LWDHIWNLFVILLCLCECSVAQISYVIAEEVDKGTAVGSLAKDLHLSVQQLQTSGLQIKSGYLKRYFEVDRESGNLYVNDRIDREELCP-------NMLKCALNIEASLSNPRGLHRIEVVITDINDNAPAFVEEVTTVEISESSYVGERYPLARAHDADVGINSVKTYKLSPNEHFSLDV-QSTGEQNVFAELVLQKVVDREKQPHYELILTALDGGKPPKTGSLLIKVNVLDVNDNSPAFSYPLYK--VQVVENAVLGTTLLRLAASDLDEGVNGQVVYTFTEKGRLSPD-DTFFLNNETGEVTVKGSLDFEETQA-YEIRVQARDKGNPPRSAHSKILVE--VIDVNDNVPDISV------SSLMSP-VSEDAEIGTAVARVQVNDRDGGKNGKTNCK-------IMNSVPFQLKSNYKNYYSLSTSGSLDRETVSEYNITLLATDDGTPSLSSTHIITVQVSDVNDNPPRFLDSQINVYVKENSPIGTTM-YKLKAVDADLDENAKSTYQLIKTPNVKAQMTSLVTINSETGEITSLKSFDFEELKTFQFKVQATDFGVPPLSSNVTVNVFVLDENDNSPSILAPYSEHGSVNSENIPYSAEAGYFVAKIRAVDADSGYNALLSYHLSEPKGNNLFRIGTSSGEIRTKRRMSDNDLKSHPLLVLVSD 647          

HSP 2 Score: 78.1814 bits (191), Expect = 3.386e-14
Identity = 116/446 (26.01%), Postives = 198/446 (44.39%), Query Frame = 3
Query: 1137 VEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEF-NIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIII--LDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIE-----SPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNP--VIITPLINQFYISENKQ-RSLLGVIKATDFD-------NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD----SLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKS----SYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF-LDIEACDQGQP 2393
            +E+ I DIND  P                 I E+S           HD D  G++ V  ++Y L  ++   +    T E N F  +V  +  DRE +      +   D        +L I +  LDVNDN P F+   Y   + EN  +GT L  R+  SD D   NG+   +       SP D+FF  ++  ++   K + D E+   +++++ A D G+   ++   + V + DVNDN   + ++ L++   +SE+ +  + +  ++  D D       N  I   +  + +S +   K+   L    SLDRE    ++IT+ A+D    SL +++  +TV V D NDN P F +    + +  +   G  + K+ A DAD   N    Y L K+    +    L  ++S++G++    SL +    +  TF   ++A D G P
Sbjct:  116 IEVVITDINDNAPAFV-------EEVTTVEISESSYVGERYPLARAHDADV-GINSV--KTYKLSPNEHFSLDVQSTGEQNVFAELVLQKVVDREKQPHYELILTALDGGKPPKTGSLLIKVNVLDVNDNSPAFSYPLYKVQVVENAVLGTTL-LRLAASDLDEGVNGQVVYTFTEKGRLSPDDTFFLNNETGEV-TVKGSLDFEETQAYEIRVQARDKGNPPRSAHSKILVEVIDVNDNVPDISVSSLMSP--VSEDAEIGTAVARVQVNDRDGGKNGKTNCKIMNSVPFQLKSNY---KNYYSLSTSGSLDRETVSEYNITLLATDDGTPSL-SSTHIITVQVSDVNDNPPRFLDSQINVYVKENSPIGTTMYKLKAVDADLDENAKSTYQLIKTPNVKAQMTSLVTINSETGEI---TSLKSFDFEELKTFQFKVQATDFGVP 540          

HSP 3 Score: 73.559 bits (179), Expect = 9.044e-13
Identity = 88/325 (27.08%), Postives = 152/325 (46.77%), Query Frame = 3
Query:  231 IKEETEIGYVIDYIKPNDQNNLKIFNTNDNGVNC--FELESSTG---KLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM------ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVF----ENSP----PGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEI 1145
            + E+ EIG  +  ++ ND++  K   TN   +N   F+L+S+      L  +  +DRE +   N  L + +   + T  L+  +I  VQ     + DVNDN P +   +  V   ENSPIG+     +A D D+  N +  Y++      +++  +   +  + G  I + +  D E+   ++  + A D G P  S+ + V V ++D NDN P    SI  P  +      EN P     G  +  ++AVD D G N   ++ +S    P+    F +   +GE+  K ++  +  K+H    V+V D+  EP SLS+   +E+
Sbjct:  356 VSEDAEIGTAVARVQVNDRDGGKNGKTNCKIMNSVPFQLKSNYKNYYSLSTSGSLDRETVSEYNITLLATD---DGTPSLSSTHIITVQ-----VSDVNDNPPRFLDSQINVYVKENSPIGTTMYKLKAVDADLDENAKSTYQLIKTPNVKAQMTSLVTINSETG-EITSLKSFDFEELKTFQFKVQATDFGVPPLSSNVTVNVFVLDENDNSP----SILAPYSEHGSVNSENIPYSAEAGYFVAKIRAVDADSGYNALLSYHLS---EPKGNNLFRIGTSSGEIRTKRRMSDNDLKSH-PLLVLVSDNG-EP-SLSATVSIEV 661          

HSP 4 Score: 51.6026 bits (122), Expect = 4.783e-6
Identity = 68/261 (26.05%), Postives = 116/261 (44.44%), Query Frame = 3
Query: 1668 FFTIDQQNQILKSKVTFDREQVSVHKLKI-LAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENK---QRSLLGVIKATDFDNQTI--YYLIDNKSQSKFSIEKHS-------GRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEP--LFNLDSDSGDLHLAVSLHTIRPIDTNTF-LDIEACDQGQP 2393
            +F +D+++  L      DRE++  + LK  L I+           + V I D+NDN       +    ISE+    +R  L      D    ++  Y L  N+    FS++  S         L LQ  +DRE+Q  + + +TA D      T S  + V V+D NDN P F      +++  +   G  + ++ A+D D G NG V Y   +     P   F L++++G++ +  SL      +T  + + ++A D+G P
Sbjct:   71 YFEVDRESGNLYVNDRIDREELCPNMLKCALNIEASLSNPRGLHRIEVVITDINDNAPAFVEEVTTVEISESSYVGERYPLARAHDADVGINSVKTYKLSPNE---HFSLDVQSTGEQNVFAELVLQKVVDREKQPHYELILTALDGGKPPKTGSLLIKVNVLDVNDNSPAFSYPLYKVQVVENAVLGTTLLRLAASDLDEGVNGQVVYTFTEKGRLSPDDTFFLNNETGEVTVKGSLDF---EETQAYEIRVQARDKGNP 325          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: ENSORLT00000042182.1 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 234.958 bits (598), Expect = 2.859e-63
Identity = 186/666 (27.93%), Postives = 329/666 (49.40%), Query Frame = 3
Query:  168 LWWSIFALIDIEGLSSNKIYRIKEETEIGYVIDYIKPNDQNNL-KIFN-----TNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNG------LYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI------ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITP-------LINQFYISENKQRSLLGVIKATDFD---NQTI-YYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            LWW  F L+     +    Y I EE + G V+  +  +    L +IF+      ++ G   F +++  G+L +  RIDRE +C         +  C + +++  +N   + R+ + I+D+NDN+P++ T++  +   E++  G R  L  A D+D+GSN   IY +      S ++ + +G      L ++  + LDREK++V+ +++IA D G+P K+   ++TV ++D+NDN P F    +     V EN   G+V+L ++A D D G NGE  +  + +T   ++  F + +  G++ +   +DY+     +E ++  +D  V    +     V+I + DIND  P I        ++  NP + E+S   T +  I+  D+DS    KV  +        L P  +      N + +++N   DRET S+ N EI   D+     S+VK +T+ + DVNDNPP F + +Y+ Y+KEN   G++L + +  SD DS  N K + SI      +    S+  ++ +N  + S  +FD E++ V ++ + A D G   L+S+  V+V I D NDN P +I P       L +Q      K   L+  + A D D   N  I Y L +    S F++  ++G +  + ++  ++  +  + +   D
Sbjct:   98 LWWHHFFLL-WSTTNGQTRYSIPEELKQGSVVGNVAKDLGLGLSEIFDRKLRVASEAGEQYFSVDAGRGELLVNDRIDREALC-------GQSASCVLPLQIVTENPLQLHRIEVEIKDINDNSPVFLTEERFLKIAESTATGVRFPLDPAEDLDVGSNSVKIYTLSKNECFSLKMKELSGDRQVPELVLD--KPLDREKQSVHHLLLIASDGGNPVKTGTAKITVSVMDINDNVPVFKMPFY--NVTVPENGVVGSVLLRVEATDADDGVNGEIEYVFAEHTPQSLQSVFKINQEKGDISLLEPLDYEKGAI-YEIRITARDKGVP--QMEGHCRVQIMVMDINDNVPEIVI------TSKPNP-VQEDSPKGTVVALINARDQDSGNNGKVKLKITNGSPFALKPSFS------NNYALITNGALDRETFSEYNVEITAIDSGSPPLSSVKMITVSVTDVNDNPPVFTQRSYNVYLKENGVPGSILFS-VSASDLDSGENSKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLAEATDASLFTVSLYTGEVRTKRAVSEQDDSSQRLILEIKD 734          

HSP 2 Score: 117.857 bits (294), Expect = 2.628e-26
Identity = 160/643 (24.88%), Postives = 284/643 (44.17%), Query Frame = 3
Query:  798 QVTVEIIDVNDNPPKF-TDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV--RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPT--IAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDND----KLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTID---QQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENK-QRSLLGVIKATDFDN----QTIYYLIDNKSQ-----SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKP--IFKNMNKVIKIDASESP-----GFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHL--AVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPAS-----RESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIAFIVFKQKSIFFAR 2609
            ++ VEI D+NDN P F T+  F    ++ E++  G    L  A D D G+N    + +S N    ++   L   R   E+ +   +D +    H    +I  D    P   +  A + + + DIND  P   + FY         N T+ EN    + + ++   D D    D V+ E  ++  +     L  +  I   E  + +++    +++    ++    R            + I+++D+NDN PE    +    ++E+ P GT++   +   D+DS NNGK  L I +   S F +      N  L +    DRE  S + ++I AID G   L+S  ++ V + DVNDNP + T      Y+ EN    S+L  + A+D D+    +  Y ++D+K Q     S   +   +G ++  +S D E+ +   I V A D      +++ TV V ++D+NDN P  I+ +   +  +     P     G  + K+ A DAD G+N  + Y L +++    LF +   +G++    AVS       D++  L +E  D G+P Q    + + I      +EP S     + S+ SKK+         + +  I  L  + ++ ++ F++   K +  +R
Sbjct:  201 RIEVEIKDINDNSPVFLTEERFL---KIAESTATGVRFPLDPAEDLDVGSNSVKIYTLSKNECFSLKMKELSGDRQVPELVLDKPLDREKQSVH-HLLLIASDGG-NPVK-TGTAKITVSVMDINDNVPVFKMPFY---------NVTVPENGVVGSVLLRVEATDAD----DGVNGEIEYVFAEHTPQSLQSVFKI-NQEKGDISLLEPLDYEKGAIYEIRITARDKGVPQMEGHCRVQIMVMDINDNVPEIVITSKPNPVQEDSPKGTVV-ALINARDQDSGNNGKVKLKITN--GSPFALKPSFSNNYALITNGALDRETFSEYNVEITAIDSGSPPLSSVKMITVSVTDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSGENSKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLAEAT-DASLFTVSLYTGEVRTKRAVSEQD----DSSQRLILEIKDDGEPLQSATVT-VSILLEDALHEPISELRHHKASEPSKKTG-------RITLYLILSLASVSVLSLLTFVILAVKCMRNSR 807          

HSP 3 Score: 68.5514 bits (166), Expect = 3.367e-11
Identity = 75/266 (28.20%), Postives = 125/266 (46.99%), Query Frame = 3
Query: 1659 GDSFFTIDQQNQILKSKVTFDREQVSVHKLK-ILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFY-ISENKQRSL-LGVIKATDFDNQT----IYYLIDNKSQS----KFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYK--EPLFNLDSDSGDLHLAVSLHTIRPIDTNTF----LDIEACDQGQP 2393
            G+ +F++D     L      DRE +       +L +    E       + V IKD+NDN PV +T    +F  I+E+    +   +  A D D  +    IY L  N+  S    + S ++    L L   LDRE+Q  HH+ + ASD    + T +  +TV V+D NDN P+FK     + +  +   G  + ++ ATDAD G NG ++Y+  + + +  + +F ++ + GD+ L      + P+D        + I A D+G P
Sbjct:  154 GEQYFSVDAGRGELLVNDRIDREALCGQSASCVLPLQIVTENPLQLHRIEVEIKDINDNSPVFLTE--ERFLKIAESTATGVRFPLDPAEDLDVGSNSVKIYTLSKNECFSLKMKELSGDRQVPELVLDKPLDREKQSVHHLLLIASDGGNPVKTGTAKITVSVMDINDNVPVFKMPFYNVTVPENGVVGSVLLRVEATDADDGVNGEIEYVFAEHTPQSLQSVFKINQEKGDISL------LEPLDYEKGAIYEIRITARDKGVP 411          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: ENSORLT00000037422.1 (pep primary_assembly:ASM223467v1:10:14795752:14799434:-1 gene:ENSORLG00000025685.1 transcript:ENSORLT00000037422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 232.261 bits (591), Expect = 4.008e-63
Identity = 183/676 (27.07%), Postives = 327/676 (48.37%), Query Frame = 3
Query:  132 FERLSIANMNSLLWWSIFALIDIEGLSSNKIYRIKEETEIGYVIDYIKPNDQNNL------KIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQ-DNGLYIEN---TQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI------ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITP-------LINQFYISENKQRSLLGVIKATDFD---NQTI-YYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            +  L I      LWW  F L+      +   Y I EE E G ++  +  +    L      K+   ++ G   F +++  G+L +  RIDRE +C         +  C + +++  +N   + R+ + I+DVNDNAP +     ++   E+   G R  L  A D D+GSNG   Y +      + ++ + +NG  I     T+ LDREKK V+ + + A D G+P KS   ++T+ ++D+NDN P+F ++ ++ +  V EN   G+ ++  +A D D G NGE  + +  +T P V + F V   +G++ +K ++D+++ ++ +   +  +D       +     V++D+ D+ND  P I    +       + ++ E+SS+ T +  +SV D DS    KV  +     +  L P  +      N + +++N   DRE+ S  + E+   D  T    + K + + I DVNDNPP F + +Y+ Y+KEN   G++L + +  SD DS  N K + SI      +    S+  ++ +N  + S  +FD E++ V ++ + A D G   L+S+  V+V I D NDN P +I P       L +Q      K   L+  + A D D   N  I Y L +    S F++  ++G +  + ++  ++  +  + +   D
Sbjct:    1 YSSLMIFRREIALWWHHFFLL-WSTTDAQTRYSIPEELEKGSLVGNVARDLGLGLSDIFVRKLRVASEAGEQYFSVDAGRGELVVNDRIDREALC-------GQSASCLLPLQIVIENPLQLHRMEVEIKDVNDNAPTFLKSDHVIEIAESRVAGVRFPLEMAEDPDVGSNGLKTYTLSKDECFTLKVKEIENGRKIPELVLTKSLDREKKAVHSLFLTAVDGGNPVKSGTSKITINVLDINDNVPQFENAFYKVD--VKENIANGSFVISTRAADVDEGPNGEIEYSLGVHTHPSVLELFYVDAASGDIYLKRQLDHET-QSSYRIDISAKDKGFP--KMEGHCTVQVDVIDVNDNAPEIILTSK-------STSVPEDSSSGTVVALLSVRDLDSGDYGKVTLQLLKTSSFALKPSFS------NNYALITNGPLDRESISDYSIEVTAKDSGTPPLLSTKTIPVSITDVNDNPPVFTQRSYNVYLKENGVPGSILFS-VSASDLDSGENAKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNALISYRLAEATDASLFTVSLYTGEVRTKRAVSEQDDSSQRLILEIKD 649          

HSP 2 Score: 117.087 bits (292), Expect = 2.911e-26
Identity = 171/656 (26.07%), Postives = 282/656 (42.99%), Query Frame = 3
Query:  798 QVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTS-----PEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTI--AFYPRNPDSATMNPTILENSSTM----TPIGQI----SVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS-----DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTID---QQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENK-QRSLLGVIKATDFDN----QTIYYLIDNKSQ-----SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKP--IFKNMNKVIKIDASESP-----GFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPI----DTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPAS-----RESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIAFIVFKQKSIFFAR 2609
            ++ VEI DVNDN P F  S    E  + E+   G    L  A D D G+NG  T+ +S +        E+E     R   E+ +   +D +    H  F   V      P   S  + + I++ DIND  P    AFY  +      N + + ++        P G+I     VH   S        E +++D        A G       +I   R+ D ET+S    +I   D        H TV+   + ++DVNDN PE    +    + E+   GT++   + V D DS + GK TL +     S F +      N  L +    DRE +S + +++ A D G   L S+  + V I DVNDNP + T      Y+ EN    S+L  + A+D D+    +  Y ++D+K Q     S   +   +G ++  +S D E+ +   I V A D      +++ TV V ++D+NDN P  I+ +   +  +     P     G  + K+ A DAD G+N L+ Y L +++    LF +   +G+      + T R +    D++  L +E  D G+P Q    + + I      +EP S     + S+ SKK+         + +  I  L  + ++ ++ F++   K +  +R
Sbjct:  116 RMEVEIKDVNDNAPTFLKSDHVIE--IAESRVAGVRFPLEMAEDPDVGSNGLKTYTLSKDECFTLKVKEIENG---RKIPELVLTKSLDREKKAVHSLFLTAVD--GGNPVK-SGTSKITINVLDINDNVPQFENAFYKVDVKENIANGSFVISTRAADVDEGPNGEIEYSLGVHTHPSV------LELFYVD-------AASG-------DIYLKRQLDHETQSSYRIDISAKDKGFPKMEGHCTVQ---VDVIDVNDNAPEIILTSKSTSVPEDSSSGTVV-ALLSVRDLDSGDYGKVTLQLLK--TSSFALKPSFSNNYALITNGPLDRESISDYSIEVTAKDSGTPPLLSTKTIPVSITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSGENAKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNALISYRLAEAT-DASLFTVSLYTGE------VRTKRAVSEQDDSSQRLILEIKDDGEPLQSATVT-VSILLEDALHEPISELRHHKASEPSKKTG-------RITLYLILSLASVSVLSLLTFVILAVKCMRNSR 722          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: ENSORLT00000036341.1 (pep primary_assembly:ASM223467v1:10:14795752:14799378:-1 gene:ENSORLG00000025685.1 transcript:ENSORLT00000036341.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 232.261 bits (591), Expect = 4.417e-63
Identity = 181/664 (27.26%), Postives = 324/664 (48.80%), Query Frame = 3
Query:  168 LWWSIFALIDIEGLSSNKIYRIKEETEIGYVIDYIKPNDQNNL------KIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQ-DNGLYIEN---TQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLV-RPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI------ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITP-------LINQFYISENKQRSLLGVIKATDFD---NQTI-YYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            LWW  F L+      +   Y I EE E G ++  +  +    L      K+   ++ G   F +++  G+L +  RIDRE +C         +  C + +++  +N   + R+ + I+DVNDNAP +     ++   E+   G R  L  A D D+GSNG   Y +      + ++ + +NG  I     T+ LDREKK V+ + + A D G+P KS   ++T+ ++D+NDN P+F ++ ++ +  V EN   G+ ++  +A D D G NGE  + +  +T P V + F V   +G++ +K ++D+++ ++ +   +  +D       +     V++D+ D+ND  P I    +       + ++ E+SS+ T +  +SV D DS    KV  +     +  L P  +      N + +++N   DRE+ S  + E+   D  T    + K + + I DVNDNPP F + +Y+ Y+KEN   G++L + +  SD DS  N K + SI      +    S+  ++ +N  + S  +FD E++ V ++ + A D G   L+S+  V+V I D NDN P +I P       L +Q      K   L+  + A D D   N  I Y L +    S F++  ++G +  + ++  ++  +  + +   D
Sbjct:   15 LWWHHFFLL-WSTTDAQTRYSIPEELEKGSLVGNVARDLGLGLSDIFVRKLRVASEAGEQYFSVDAGRGELVVNDRIDREALC-------GQSASCLLPLQIVIENPLQLHRMEVEIKDVNDNAPTFLKSDHVIEIAESRVAGVRFPLEMAEDPDVGSNGLKTYTLSKDECFTLKVKEIENGRKIPELVLTKSLDREKKAVHSLFLTAVDGGNPVKSGTSKITINVLDINDNVPQFENAFYKVD--VKENIANGSFVISTRAADVDEGPNGEIEYSLGVHTHPSVLELFYVDAASGDIYLKRQLDHET-QSSYRIDISAKDKGFP--KMEGHCTVQVDVIDVNDNAPEIILTSK-------STSVPEDSSSGTVVALLSVRDLDSGDYGKVTLQLLKTSSFALKPSFS------NNYALITNGPLDRESISDYSIEVTAKDSGTPPLLSTKTIPVSITDVNDNPPVFTQRSYNVYLKENGVPGSILFS-VSASDLDSGENAKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNALISYRLAEATDASLFTVSLYTGEVRTKRAVSEQDDSSQRLILEIKD 651          

HSP 2 Score: 117.087 bits (292), Expect = 3.238e-26
Identity = 171/656 (26.07%), Postives = 282/656 (42.99%), Query Frame = 3
Query:  798 QVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTS-----PEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTI--AFYPRNPDSATMNPTILENSSTM----TPIGQI----SVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTS-----DHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTID---QQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENK-QRSLLGVIKATDFDN----QTIYYLIDNKSQ-----SKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKP--IFKNMNKVIKIDASESP-----GFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPI----DTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPAS-----RESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIAFIVFKQKSIFFAR 2609
            ++ VEI DVNDN P F  S    E  + E+   G    L  A D D G+NG  T+ +S +        E+E     R   E+ +   +D +    H  F   V      P   S  + + I++ DIND  P    AFY  +      N + + ++        P G+I     VH   S        E +++D        A G       +I   R+ D ET+S    +I   D        H TV+   + ++DVNDN PE    +    + E+   GT++   + V D DS + GK TL +     S F +      N  L +    DRE +S + +++ A D G   L S+  + V I DVNDNP + T      Y+ EN    S+L  + A+D D+    +  Y ++D+K Q     S   +   +G ++  +S D E+ +   I V A D      +++ TV V ++D+NDN P  I+ +   +  +     P     G  + K+ A DAD G+N L+ Y L +++    LF +   +G+      + T R +    D++  L +E  D G+P Q    + + I      +EP S     + S+ SKK+         + +  I  L  + ++ ++ F++   K +  +R
Sbjct:  118 RMEVEIKDVNDNAPTFLKSDHVIE--IAESRVAGVRFPLEMAEDPDVGSNGLKTYTLSKDECFTLKVKEIENG---RKIPELVLTKSLDREKKAVHSLFLTAVD--GGNPVK-SGTSKITINVLDINDNVPQFENAFYKVDVKENIANGSFVISTRAADVDEGPNGEIEYSLGVHTHPSV------LELFYVD-------AASG-------DIYLKRQLDHETQSSYRIDISAKDKGFPKMEGHCTVQ---VDVIDVNDNAPEIILTSKSTSVPEDSSSGTVV-ALLSVRDLDSGDYGKVTLQLLK--TSSFALKPSFSNNYALITNGPLDRESISDYSIEVTAKDSGTPPLLSTKTIPVSITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSGENAKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNALISYRLAEAT-DASLFTVSLYTGE------VRTKRAVSEQDDSSQRLILEIKDDGEPLQSATVT-VSILLEDALHEPISELRHHKASEPSKKTG-------RITLYLILSLASVSVLSLLTFVILAVKCMRNSR 724          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: ENSORLT00000030789.1 (protocadherin gamma-A6-like [Source:NCBI gene;Acc:111948001])

HSP 1 Score: 229.565 bits (584), Expect = 1.219e-62
Identity = 179/597 (29.98%), Postives = 291/597 (48.74%), Query Frame = 3
Query:  354 GKLFITRRIDREEIC---PTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNG--LYIENT--QMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDH--STVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSI------ESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDN-PVIITP------LINQFYISENKQRSLLGVIKATDFDNQT----IYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASD 2066
            G LF++ RIDREE C   PT          C +   L  +N   + RLS+ I+D+NDNAP++  D   +   E++  G+R  +  A D DIG N    Y ++     +  +   N    Y E    + LDRE++   ++++ A D GSP +S  + + V ++D NDN P F++S++    Q  ENSP  T ++ + A D D G NGE T+  S  +        L   TGE+++   IDY+ D    +++V+++  A + Y L+SEA V IDI D+ND  P I          +++ +I EN+   T +G I+V DRDS    +V C        KL P I       N +++VS  + DRE     N  I  TD      S+ K + + + D+NDNPP F + +Y  Y+ EN   G+ L + +   D D   NG    S+       +P  S+ +++    ++ +  +FD EQ+   +++++A D+G   L+S+  V V I DVNDN P I+ P       + +         SL+  + A D D+       Y+++ +     F+I  HSG +  Q  + + +    ++ V   D
Sbjct:   82 GDLFVSGRIDREEHCKEMPT----------CVLKFDLLLENPLEMHRLSLQIQDINDNAPVFPKDIIKLEIRESADKGARYRINAAHDADIGLNAVQSYVLQENAHFALNVQTTNAGNKYGELVLDKELDREEQQELKLLLTAVDGGSPQRSGTVVIHVTVLDANDNAPLFSESVYTANLQ--ENSPINTPVIRVSASDADEGINGEITYEFSRLSDKTQNIFSLAEKTGEIKVTGNIDYEED---LKYEVMIE--AKDGYGLTSEAKVVIDITDVNDNAPEIIV-------KSLSSSIPENAPPGTEVGIINVQDRDSDKNGQVRCSIQGNAPFKLVPSIK------NYYSLVSTGQLDRELVFDYNITISATDEGSPPLSSSKTVHLSVADINDNPPAFEEQSYSAYVSENNQAGSTLCS-VSARDPDWRQNGTVIYSLLAAEVNGAPVSSYVSVNGDTGLIHTVRSFDYEQLRSFQVQVMARDNGSPPLSSNVSVSVFISDVNDNSPQILYPAPEGSSFMTELVPKAAHGGSLVSKVIAVDADSGQNAWLSYHIVKSTDPGLFTIGLHSGEIRTQRDISQSDSMKQNLIVAVKD 647          

HSP 2 Score: 119.398 bits (298), Expect = 5.395e-27
Identity = 126/511 (24.66%), Postives = 222/511 (43.44%), Query Frame = 3
Query:  354 GKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQR-----LSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIY---RMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTS----PEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLN--PIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTI--IILDVNDNPPEF-----NKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD-SFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKD 1820
            G+L + + +DREE             Q E+ + LT  +    QR     + + + D NDNAP+++      +  ENSPI +      A+D D G NG++ Y   R+  K +N F L +  G  I+ T  +D E+   YE++I A+D      ++E +V ++I DVNDN P+    +      + EN+PPGT + ++   D D   NG+    +  N      P ++ ++ +  TG+++ +   DY+         +   D    P  LSS   V + + DIND  P  AF     +  + +  + EN+   + +  +S  D D +    V    Y L   ++N  P+ +  +   +   I + R FD E       ++   D        N+++   I DVNDN P+         ++   +      G  L +++   D DS  N   +  I    D   FTI   +  ++++    +       L +   D+G   L+++C +Y+ I D
Sbjct:  192 GELVLDKELDREE-------------QQELKLLLTAVDGGSPQRSGTVVIHVTVLDANDNAPLFSESVYTANLQENSPINTPVIRVSASDADEGINGEITYEFSRLSDKTQNIFSLAEKTG-EIKVTGNIDYEEDLKYEVMIEAKDGYG--LTSEAKVVIDITDVNDNAPEII--VKSLSSSIPENAPPGTEVGIINVQDRDSDKNGQVRCSIQGNAPFKLVPSIKNYYSLVSTGQLDRELVFDYN-------ITISATDEGSPP--LSSSKTVHLSVADINDNPP--AF-----EEQSYSAYVSENNQAGSTLCSVSARDPDWRQNGTV---IYSLLAAEVNGAPVSSYVSVNGDTGLIHTVRSFDYEQLRSFQVQVMARDNGSPPLSSNVSVSVFISDVNDNSPQILYPAPEGSSFMTELVPKAAHGGSLVSKVIAVDADSGQNAWLSYHIVKSTDPGLFTIGLHSGEIRTQRDISQSDSMKQNLIVAVKDNGQPSLSATCAMYLLISD 665          

HSP 3 Score: 112.849 bits (281), Expect = 6.832e-25
Identity = 144/567 (25.40%), Postives = 246/567 (43.39%), Query Frame = 3
Query:  798 QVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNT--SPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTID---QQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQR-SLLGVIKATDFD---NQTIYYLI------DNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIF--------KNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPN---QCTIF 2411
            +++++I D+NDN P F   I + E  + E++  G    +  A D D G N   ++ +  N   +  V+        GE+ +  ++D +  +   E K+++          S   V+ + + D ND  P  +        +     + ENS   TP+ ++S  D D +G++      +   +DK   I ++   +  E  +  N   D E + K    I   D    ++   + I I DVNDN PE    +    I EN P GT +   + V D+DS+ NG+   SI+  G++ F +    +    L S    DRE V  + + I A D G   L+SS  V++ + D+NDNP          Y+SEN Q  S L  + A D D   N T+ Y +           S  S+   +G +    S D E+  +  + V A D+     +++ +V+V + D NDN P            M +++   A    G  + K++A DAD G N  + Y + KS+    LF +   SG++     +     +  N  + ++  D GQP+    C ++
Sbjct:  118 RLSLQIQDINDNAPVFPKDIIKLE--IRESADKGARYRINAAHDADIGLNAVQSYVLQENAHFALNVQTTNAGNKYGELVLDKELDREEQQ---ELKLLLTAVDGGSPQRSGTVVIHVTVLDANDNAPLFS-------ESVYTANLQENSPINTPVIRVSASDAD-EGINGEITYEFSRLSDKTQNIFSLA-EKTGEIKVTGN--IDYEEDLKYEVMIEAKDGYGLTSEAKVVIDITDVNDNAPEIIVKSLSSSIPENAPPGTEV-GIINVQDRDSDKNGQVRCSIQ--GNAPFKLVPSIKNYYSLVSTGQLDRELVFDYNITISATDEGSPPLSSSKTVHLSVADINDNPPAFEEQSYSAYVSENNQAGSTLCSVSARDPDWRQNGTVIYSLLAAEVNGAPVSSYVSVNGDTGLIHTVRSFDYEQLRSFQVQVMARDNGSPPLSSNVSVSVFISDVNDNSPQILYPAPEGSSFMTELVPKAAHG--GSLVSKVIAVDADSGQNAWLSYHIVKST-DPGLFTIGLHSGEIRTQRDISQSDSMKQNLIVAVK--DNGQPSLSATCAMY 660          

HSP 4 Score: 97.8265 bits (242), Expect = 2.478e-20
Identity = 137/505 (27.13%), Postives = 217/505 (42.97%), Query Frame = 3
Query: 1137 VEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFN-IVSNRKFDRETESKLNAEIRCTD--TSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGD---SFFTIDQQNQILKSKVTFDREQVSVHKLKILAID-HGDERLTSSCIVYVHIKDVNDN-PVIITPLINQFYISENKQRSLLGVIKATDFDNQTIYYLIDNKSQSKFSIE-----------KHSGRLFLQNSLDREEQETHHITVTASDSLH---TASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKY-ILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF----LDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIA 2570
            + + IQDIND  P    +P++     +   I E++         + HD D  GL+ V  +SY L  +    +    TN  N++  +V +++ DRE + +L   +   D  +   S    + + +LD NDN P F++  Y   ++EN PI T +  R+  SD D   NG+ T       D   + F++ ++   +K     D E+   +++ I A D +G   LTS   V + I DVNDN P II   ++          + +G+I   D D+       D   Q + SI+           K+   L     LDRE    ++IT++A+D      ++S TV + V D NDN P F+  +    +  +   G  +C + A D D   NG V Y +L       P+ +  S +GD  L   +HT+R  D        + + A D G P   +  S        N N P          S    F+ E V  AA  G LV  +I + A
Sbjct:  119 LSLQIQDINDNAPV---FPKD----IIKLEIRESADKGARYRINAAHDAD-IGLNAV--QSYVLQENAHFALNVQTTNAGNKYGELVLDKELDREEQQELKLLLTAVDGGSPQRSGTVVIHVTVLDANDNAPLFSESVYTANLQENSPINTPV-IRVSASDADEGINGEITYEFSRLSDKTQNIFSLAEKTGEIKVTGNIDYEEDLKYEVMIEAKDGYG---LTSEAKVVIDITDVNDNAPEIIVKSLSSSIPENAPPGTEVGIINVQDRDS-------DKNGQVRCSIQGNAPFKLVPSIKNYYSLVSTGQLDRELVFDYNITISATDEGSPPLSSSKTVHLSVADINDNPPAFEEQSYSAYVSENNQAGSTLCSVSARDPDWRQNGTVIYSLLAAEVNGAPVSSYVSVNGDTGL---IHTVRSFDYEQLRSFQVQVMARDNGSPPLSSNVSVSVFISDVNDNSPQILYPAPEGSS----FMTELVPKAAHGGSLVSKVIAVDA 595          

HSP 5 Score: 50.8322 bits (120), Expect = 7.755e-6
Identity = 58/233 (24.89%), Postives = 101/233 (43.35%), Query Frame = 3
Query: 1659 GDSFFTIDQQNQILKSKVTFDREQ-VSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKAT-DFD---NQTIYYLIDNKSQSKFSIEKHS-----GRLFLQNSLDREEQETHHITVTASDS---LHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYK-EPLFNLDSDSGDLHL 2315
            G  +  I+Q+N  L      DRE+        +L  D   E       + + I+D+NDN  +    I +  I E+  +     I A  D D   N    Y++   +    +++  +     G L L   LDREEQ+   + +TA D      + +  + V V+D NDN P+F        +  +      + ++ A+DAD G NG + Y   + S K + +F+L   +G++ +
Sbjct:   71 GKEYCGINQENGDLFVSGRIDREEHCKEMPTCVLKFDLLLENPLEMHRLSLQIQDINDNAPVFPKDIIKLEIRESADKGARYRINAAHDADIGLNAVQSYVLQENAHFALNVQTTNAGNKYGELVLDKELDREEQQELKLLLTAVDGGSPQRSGTVVIHVTVLDANDNAPLFSESVYTANLQENSPINTPVIRVSASDADEGINGEITYEFSRLSDKTQNIFSLAEKTGEIKV 303          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000067388.1 (SMESG000067388.1)

HSP 1 Score: 1330.47 bits (3442), Expect = 0.000e+0
Identity = 660/662 (99.70%), Postives = 661/662 (99.85%), Query Frame = 3
Query:  645 MESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIAFIVFKQKSIFFARIPSRSNF 2630
            MESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASTTVTVVVVDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIAFIVFKQKSIFFARIPSRS+ 
Sbjct:    1 MESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFDNQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASTTVTVVVVDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIAFIVFKQKSIFFARIPSRSSM 662          

HSP 2 Score: 60.8474 bits (146), Expect = 5.181e-9
Identity = 144/558 (25.81%), Postives = 228/558 (40.86%), Query Frame = 3
Query:  483 RLSIIIEDVNDNAP-----IWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRM----ESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNG-SPYK-SNELQVTVEIIDVNDNPPKFTDSIFRPEKQ-----VFENSPPGTVILLLKAVDHD------------FGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIG-----QISVHDRDS--KGLDKVHCES---YFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTII--ILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSL-LGVIKATDFD---NQTIYYLIDNKSQSK--FSIEKHSGRLFLQNSL 2018
            ++++ I DVNDN P     I+  +K +    ENSP G+   L +A D D G+NG+  +RM      +    F +     + I++    D +K + +E  +I QD+   PY  S+E  V ++I D+ND  P        P+       + ENS   T I  +   D D            F +N +    ++  T+   E + +     + E +SK++ +   T         DH       S+   + I I D+ND  P         +  T +  I EN     PIG     ++ V D+DS   G   +  ES    F   D+ N I+             S   FDRE  S    +I   D  D     +  +   I DVNDNP         FYI EN+    +      +   D +N   + L I++   S F+I++ +  L  + + DRE+   H + + A    D   T+S  V V + D NDN  I   +     I  ++     +  I ATD D   N  + Y++   S  +  F+++  SG L L  SL
Sbjct:   52 QVTVEIIDVNDNPPKFTDSIFRPEKQVF---ENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTH-FEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTD------TSDH-------STVKNLTIIILDVNDNPPEF-------NKGTYHFYIKENE----PIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILK------------SKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQRSLL----GVIKATDFDNQTIYYL-IDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTA---SDSLHTASTTVTVVVVDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSL 561          

HSP 3 Score: 57.7658 bits (138), Expect = 3.929e-8
Identity = 64/239 (26.78%), Postives = 110/239 (46.03%), Query Frame = 3
Query:  372 RRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGS---RRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSP---EVEKHFLVRPTGEVEIKSKIDYDSDKTH 1070
            R+ DRE     N  ++  +     T+K           L+III DVNDN P +          EN PIG+    R     +D D  +NG+    +ES   + F + Q N + +++    DRE+ +V+++ I+A D+G    ++   V V I DVNDNP   T  I    +     +   +++ ++KA D D     +  + +  N S     +EKH     +G + +++ +D +  +TH
Sbjct:  253 RKFDRETESKLNAEIRCTDTSDHSTVK----------NLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMF--VSDKDSNNNGKFTLSIESPGDSFFTIDQQNQI-LKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLI---NQFYISENKQRSLLGVIKATDFD----NQTIYYLIDNKSQSKFSIEKH-----SGRLFLQNSLDREEQETH 466          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000010675.1 (SMESG000010675.1)

HSP 1 Score: 519.235 bits (1336), Expect = 8.651e-168
Identity = 364/988 (36.84%), Postives = 532/988 (53.85%), Query Frame = 3
Query:  210 SSNKIYRIKEETEIGYVIDYI-------KPNDQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCES---YFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENK-QRSLLGVIKATDFDNQTIYYLIDNKSQS-KFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASXXXXXXXXDENDNKPIFK---NMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF-LDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVLIAAISGLLVLMIIIMIAFIVFKQKSIFFARIPSRSNFSHQKKHMN--PSVTCYRDNF----VTPDYHCSTELENLETDLRQNRDMGTTPI-----------FYCSNLCIPDSKDKSSSSNMFLESAS-----RSMSPLVENQMNIKDFSRKSIVNPDNNYYCKYFTDHSSN--ITISESPTQIAEFLNIPKHKNKKHQSSFV 3053
            S + IYRIKEE  I ++I Y+       +  D    +I N  D GV  F L+  + KL +  RIDRE ICPT+ +       C + +K+T    + +  + I I+DVND++P W  +K  V FNE    GSR+S+P + D D G NGQ+ Y +ES   ++F L Q++GLY++  + LDRE K+ Y++ II+ D G P KS  L+V VEI+D+NDN P+F+ SIFRP K + E  P  +V+L L   D D G NGEF+F  SP  +   + +FLV+P GE+ +  ++DY+S    F+FKVI++DHA   Y  SSE+ VEI I D NDE+P I FYP   +S T    I EN    T +  I   D+D K  D V C +    F ++  L P     TN+ NEF +V+ R  DRE E ++   I CTD+ +H T  N+T+ I DVNDN P+F+    H  IKEN   GT  + ++   DKDS  NG    SI +  D  FTID +  +++SK   DRE  ++++  I+A DHG  +L+S+    VH+ D NDNPVII     +F + EN    + +G + ATD DNQTI+Y +D  S S KF+I++ +G +  ++ LDRE Q  +     A+D L++AS+ V + V D NDN P+FK   +    I +   E+ GF + KIVA D D   +  ++Y +    Y   LF+LD D+G L+L  SL      D + + LDIEACD G P  CT F G +I     RN   ++   +         ++EN++IA I+  L+ MI++ I FI      IF  R  SR+N   +K+  N  P++  Y  N     +     CS E+  L + L    +  + PI           ++C N  IP   + S +  M +   S     R++  + E Q     +  K  +N DNN + +  T + +N  IT   S T   +  +  +   +K QSSFV
Sbjct:    5 SPDHIYRIKEELPITHIIGYLNNDIPKFRSTDSTGYEILNPRDKGVQNFILDPISSKLSVNNRIDREAICPTSSI------NCFIILKVTLHGTDRIVTIRIEIDDVNDHSPNWKINKHKVIFNEGEHAGSRKSIPISFDPDFGDNGQIKYTLESS-TDTFILVQEHGLYLQTLKQLDREHKSGYKLTIISTDRGIPSKSGRLEVEVEILDINDNTPRFSTSIFRPTKIIPETMPVQSVVLKLTGSDADAGQNGEFSFSFSPTETSIAKSYFLVKPDGEIIVLRQLDYESGIHKFDFKVIIKDHASLGYERSSESRVEIIISDENDEYPQIKFYPMRTNSETGFAIIDENKPLSTSVALIQASDKDFKESDTVTCTTDNFGFAESLSLTP-----TNDNNEFKLVTARMLDREMEKRIFIRIICTDSVNHKTSTNITVDIGDVNDNSPKFSDNIIHMSIKENMDAGTTTNKQVKAIDKDSGKNGFVVYSIPA-HDIPFTIDSRTGVIRSKDRLDREVKNLYQFIIVASDHGSPKLSSTVTALVHVDDENDNPVIIETSPYEFKVKENSPPNTPVGRVIATDKDNQTIFYSLDYVSDSGKFNIDRTTGVIVTKSKLDREIQHKYQFRAFATDKLNSASSIVMIFVEDVNDNPPVFKMPNSSLNSISLSYKEAAGFSLTKIVAEDPDDKESARIQYSVVNEKYSS-LFSLDKDTGFLYLQRSLDGAHAEDRDHYSLDIEACDMGTPRMCTTFRGFKINI--QRNGDLTKTKGQPNLLIDSSGMSENIIIALIT-FLLFMIMVTI-FI------IFLLRRKSRNNLKPRKESQNIHPTLNPYFQNVNGKSIMEFDQCSAEICELTSRLSPECET-SAPINQLPYYNMSDQYHCGNF-IPVCSEHSYNIPMIMSYNSHLPDNRALKMIPETQ----GYYTKYEIN-DNNKFPEELTSNLTNQDITTISSSTPSQKLKSTTQTCPRKPQSSFV 961          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000027424.1 (SMESG000027424.1)

HSP 1 Score: 373.244 bits (957), Expect = 4.843e-112
Identity = 282/847 (33.29%), Postives = 450/847 (53.13%), Query Frame = 3
Query:  201 EGLSSNKIYRIKEETEIGYVID------YIKPNDQNNLKIFNTNDNGVNCFELESSTGKLFITRRIDREEIC--PTNRLLKSNN------QQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKH-FLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERL-TSSCIVYVHIKDVNDNPVIITPLINQFYISENK-QRSLLGVIKATDFDNQ----TIYYLIDNKSQSK-FSIEKHSGRLFLQNSLDREEQETHHITVTASDS------LHTASXXXXXXXXDENDNKP--IFKNMNK-VIKIDASESPGFKICKIVATDADHGNNGLVKYILKKSSYKEPLFNLDSDSG--DLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQ-CTIFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENV----LIAAISGLLVLMIIIMIAFI-VFKQKSIFFARIPSRS 2624
            E  S++  Y+I+EE  +  ++       +   N +  L+I N ND  V CF++ +  G+L + RRIDR+++C   T++ + + N      ++C++ I +   ++N + ++ I IED+NDN P W   +  V F +     ++ SLP A D DIG N Q+ Y  + +    FRL  ++G Y++  Q LDRE+K  Y   +IA D G+P ++ E++V V I D+NDN P F+  I+R  K V E+S  GT+I  L+A D D G NG+F F+ +    PE+ KH F ++  G V + + +D D      +FKV+V+D A+ PYS SS+A V + I D+NDE P +     N DS T  P ++E++   T IG + V DRD    D V C    +DN +      I  + P ++ I +N  FDRE  +  +  I C D+  +    N +I I D+NDNPP F K  Y   IKEN+P+ TML +++  +D DS +  ++ +S E   +  F+ID++  I+ + V+FDRE  + + +K++A D   E + T +C V V I D NDN  + T     F+I EN    + +G++KATD D Q    ++ Y ++  S+++ F I   SG +    +LDRE++  +   V   D        +T +++VTVV+ D NDN P  I  N  K    I   ++ G KI  + A DAD  +N  + Y +   +  E +F++DS +G   L  ++  +  +P    T L + ACD G+P Q CT F  L I    N  E    +   S +    +  N NV    +I  ++ + + ++I   A I + K K  F+ R  SR+
Sbjct:    7 ETFSNDIEYKIQEEVALETMVGDLYKNVFQATNSKGKLEIKNLNDRFVKCFKI-NMNGQLVVARRIDRDQMCEKSTSQPIYTKNSRITPEEECKIFINVASPSLNIMTKVVITIEDINDNIPSWNLQRIEVKFIDGCKERTKVSLPPAFDKDIGQNAQIEYSFKERDL-PFRLDTEDGFYLQTLQTLDREQKESYTFTLIASDKGNPVQTGEIEVHVVIEDLNDNSPIFSKPIYR-FKAVSEDSAVGTIIGKLEASDADSGVNGKFNFKFA-EAVPEIVKHYFQIQSDGTVIVAAPLDSDRGNNELKFKVVVEDEALRPYSKSSDATVYVYINDVNDEKPELKLIFMNHDSRTNKPFVVEHTKIGTLIGILEVTDRDYNNKDTVSCN---VDNSQF---ALISEDRPVKYKITTNMDFDREKMTTADLRIFCRDSVGNLASSNHSINIKDINDNPPNFTKSFYVMKIKENQPVHTMLPSKLVATDPDSESTIQYFISPEYSSN--FSIDRETGIISTLVSFDREICASYTIKVIAKDSIKEPINTGTCTVQVIILDENDNKPVFTHEFYTFHIPENNFPNTAVGIVKATDLDEQDSQSSLSYRLEYSSKTRPFKINSRSGAITAIITLDREKETFYSFIVYVEDGNDYPMKRNTVTSSVTVVIDDVNDNSPKFIIPNATKSSFDISIKDTVGHKIINVYAEDADVSDNSRIYYNITAGN-DENIFSIDSATGLLLLSDSLQSNQQKPQPHYT-LSVTACDYGKPKQLCTTFKNLRI--IVNNGEDYKYKGLDSNQEPDSKDKNTNVHHEAIIICLAIVFITLLISASALICLIKCKPGFWCRSSSRA 837          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000006531.1 (SMESG000006531.1)

HSP 1 Score: 329.331 bits (843), Expect = 2.977e-97
Identity = 261/838 (31.15%), Postives = 425/838 (50.72%), Query Frame = 3
Query:  180 IFALIDIEGLSSNKI--YRIKEETEIGYVIDYIKPNDQN------NLKIFNTNDNGVNCFELESSTG--KLFITRRIDREEICPTNRLLKSNNQQCEVTIKLTHQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEATDIDIGSNGQVIYRMESKYRNSFRLFQD-NGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPN--TSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNE-FNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFDNQTIYYLIDN-KSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS----------LHTASXXXXXXXXDENDNKP--IFKNMNKVIKIDAS--ESPGFKICKIVATDADHGNNGLVKYILK-KSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF----LDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASR---ESDKSKKSSYDQF------LNENVLIAAISGLLVLMIII 2561
            +  L++   L+S  +  +++ E  ++G  I  +  + +N       + + N  D  V+ F ++  +G  +L   + IDRE IC   +  K N+  C++ I++       +  + I + D NDN P W +D   V F +    G R+++P A D+D      + Y +    R  F+L +  + LYI+N+ MLD E  + + + + A + G   +S+ L + V I+D+NDNPP F+  +F   + + E+ P  +V+L+L A D D G NGEF+FR+  N   +  +E   +   TGE+ ++  +DYD    +F FKVIV+DHA  PYSLSSEA V + + D+NDE P I FY    +  +    +LEN+   T +G I  +D D    D+V C S       LN    + +    E F I +   FDRE + K    I CTD + H    N T++ILD NDN P F   + +FY+ EN P GT+L  ++   DKD +NN +    +    +  F I+     L S  +FDRE+ S   L +   D G+ + +S   +++ I D++DNP++ T     F+ISEN    +++G ++A D D  TI Y I N K+   F I+K SG L   + LDRE+ + + I V A DS           + +   V + + DENDN P  IF N     +++AS  + P   I +I +TD+D G N  + Y ++ + S+K  +F +   SG + L         +D   F    + ++ CD G   +CT+F  L +  T++   P +    E+ K +K  +  F      +  ++L A I+G ++L + I
Sbjct:    4 VLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKN-KINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTR-FFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGID-RSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRS-------LNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILDDNDNDPYFFPDSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHN-RLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHK--IFKIHRTSGLVFLKTGNSN---LDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDY--PINTHVLENTKKEKKIFTAFWILTSIITVSLLTAFITGSILLYLKI 823          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000067386.1 (SMESG000067386.1)

HSP 1 Score: 280.026 bits (715), Expect = 2.782e-88
Identity = 134/135 (99.26%), Postives = 134/135 (99.26%), Query Frame = 3
Query: 2649 MNPSVTCYRDNFVTPDYHCSTELENLETDLRQNRDMGTTPIFYCSNLCIPDSKDKSSSSNMFLESASRSMSPLVENQMNIKDFSRKSIVNPDNNYYCKYFTDHSSNITISESPTQIAEFLNIPKHKNKKHQSSFV 3053
            MNPSVTCYRDNFVTPDYHCSTELENLETDLRQNRDMGTTPIFYCSNLCIPDSKDKSSSSNMFLESASRSMSPLVENQMNIKDFSRKSIVNPDNNYYCKYFTDHSSNITISESPTQIAEF NIPKHKNKKHQSSFV
Sbjct:    1 MNPSVTCYRDNFVTPDYHCSTELENLETDLRQNRDMGTTPIFYCSNLCIPDSKDKSSSSNMFLESASRSMSPLVENQMNIKDFSRKSIVNPDNNYYCKYFTDHSSNITISESPTQIAEFTNIPKHKNKKHQSSFV 135          
The following BLAST results are available for this feature:
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11Y7.244e-6228.48protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y7.244e-6228.48protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y8.365e-6228.48protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y1.144e-6128.48protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X1.515e-6128.61protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-12.794e-5427.76FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-14.391e-3626.04FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
hmr-12.337e-2825.07Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-12.337e-2825.07Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
cdh-15.261e-2824.63CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds3.570e-5529.93gene:FBgn0284247 transcript:FBtr0078045[more]
ds3.570e-5529.93gene:FBgn0284247 transcript:FBtr0343249[more]
ft1.841e-4827.73gene:FBgn0001075 transcript:FBtr0077478[more]
kug7.640e-4828.00gene:FBgn0261574 transcript:FBtr0346077[more]
kug7.640e-4828.00gene:FBgn0261574 transcript:FBtr0332721[more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1gc64.268e-6729.36protocadherin 1 gamma c 6 [Source:ZFIN;Acc:ZDB-GEN... [more]
pcdh1g261.101e-6629.24protocadherin 1 gamma 26 [Source:ZFIN;Acc:ZDB-GENE... [more]
CR774179.72.753e-6427.99protocadherin gamma-C5-like [Source:NCBI gene;Acc:... [more]
pcdh1g38.598e-6430.37protocadherin 1 gamma 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
pcdh1g339.718e-6427.89protocadherin 1 gamma 33 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
emc72.673e-6327.31ER membrane protein complex subunit 7 [Source:Xenb... [more]
emc73.127e-6327.31ER membrane protein complex subunit 7 [Source:Xenb... [more]
emc73.665e-6327.31ER membrane protein complex subunit 7 [Source:Xenb... [more]
emc73.964e-6327.31ER membrane protein complex subunit 7 [Source:Xenb... [more]
ENSXETT00000029153.13.227e-6128.94protocadherin 8 [Source:NCBI gene;Acc:100485587][more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11x1.158e-6429.10protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x2.503e-6429.10protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x8.443e-6429.10protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.260e-6329.10protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.260e-6329.10protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6X862|PC11X_GORGO3.150e-6128.61Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q6WYY1|PC11X_PANPA8.003e-6128.48Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q71M42|PC11X_PANTR9.558e-6128.48Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q9BZA8|PC11Y_HUMAN2.622e-6028.48Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q9BZA7|PC11X_HUMAN3.310e-6028.61Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7HBN62.502e-8929.07Protocadherin-11 X-linked (Fragment) OS=Clonorchis... [more]
G7Y8R92.156e-8829.07Protocadherin-11 X-linked OS=Clonorchis sinensis O... [more]
A0A068Y5437.254e-8528.16Protocadherin 1 OS=Echinococcus multilocularis OX=... [more]
A0A4E0S2Q97.946e-8528.29Protocadherin-11 X-linked OS=Fasciola hepatica OX=... [more]
A0A4Z2CNA11.172e-8429.28Protocadherin-11 X-linked OS=Schistosoma japonicum... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1g92.919e-6529.47protocadherin 1 gamma 9 [Source:ZFIN;Acc:ZDB-GENE-... [more]
pcdh111.497e-6428.56protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh1g92.106e-6430.48protocadherin 1 gamma 9 [Source:ZFIN;Acc:ZDB-GENE-... [more]
pcdh113.325e-6429.46protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh114.117e-6428.83protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.13.553e-5226.29pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000008517.13.391e-5126.83pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000004042.17.736e-4826.91pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004043.18.553e-4826.91pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
pcdh115.990e-4525.44protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461893.702e-6228.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482372.169e-5127.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354125.268e-5129.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303647.659e-4524.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404707.178e-4425.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000005220.22.002e-6830.10pep primary_assembly:ASM223467v1:10:15161680:15164... [more]
ENSORLT00000042182.12.859e-6327.93protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000037422.14.008e-6327.07pep primary_assembly:ASM223467v1:10:14795752:14799... [more]
ENSORLT00000036341.14.417e-6327.26pep primary_assembly:ASM223467v1:10:14795752:14799... [more]
ENSORLT00000030789.11.219e-6229.98protocadherin gamma-A6-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067388.15.181e-999.70SMESG000067388.1[more]
SMESG000010675.18.651e-16836.84SMESG000010675.1[more]
SMESG000027424.14.843e-11233.29SMESG000027424.1[more]
SMESG000006531.12.977e-9731.15SMESG000006531.1[more]
SMESG000067386.12.782e-8899.26SMESG000067386.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035286 ID=SMED30035286|Name=Protocadherin-11 X-linked|organism=Schmidtea mediterranea sexual|type=transcript|length=3214bp
TGACACAAAATCCAAAAAAAATTTAACAACTTATCTTTTCCCGGAAATTC
TGATTGGTCGATTCCAAATTCACCATCCAATAGGATGTTGGTGATATTTA
AGGATTTGTTTCAGCGATTCCATTTTTATTTTTCGAAAGACTTTCAATCG
CAAACATGAATTCTTTGTTATGGTGGTCAATATTTGCTTTAATTGACATT
GAAGGATTATCGTCAAATAAAATCTACAGAATTAAAGAAGAAACAGAAAT
AGGTTACGTTATTGACTATATCAAACCCAACGATCAAAACAACTTGAAGA
TTTTTAATACCAATGACAATGGAGTAAACTGTTTCGAGCTGGAATCGAGC
ACTGGAAAATTATTCATTACCCGTCGGATTGATCGAGAAGAAATCTGTCC
AACGAATCGGTTATTAAAGTCCAACAATCAACAATGTGAAGTGACAATTA
AATTGACGCATCAGAATATAAATTTCGTGCAAAGATTATCAATCATTATC
GAAGACGTCAATGATAATGCTCCAATTTGGACAACTGATAAGGCAATAGT
TTCATTTAATGAAAACTCACCAATAGGTTCTCGGAGATCTTTACCTGAAG
CTACTGACATTGATATCGGGTCTAATGGACAAGTCATTTATAGAATGGAA
TCAAAGTACCGAAATTCATTTCGTTTATTTCAAGACAATGGCCTATATAT
AGAAAACACTCAAATGCTTGACAGAGAGAAGAAAAATGTTTATGAAATAA
TAATAATTGCCCAGGACAACGGTTCACCGTATAAAAGCAACGAACTACAA
GTGACTGTAGAAATAATCGACGTGAATGATAATCCACCAAAGTTTACCGA
TTCAATTTTTCGACCGGAAAAGCAAGTATTTGAAAATTCTCCACCGGGAA
CCGTAATTTTACTTTTAAAAGCTGTAGATCATGACTTTGGAAATAATGGA
GAATTTACATTCAGAATGAGTCCAAACACTTCCCCTGAAGTTGAAAAGCA
TTTTCTGGTACGACCAACCGGAGAAGTTGAAATTAAATCAAAAATCGACT
ATGACAGTGATAAAACCCATTTTGAGTTCAAAGTAATTGTTCAAGATCAC
GCCGTTGAGCCCTATTCACTGTCCTCGGAAGCTGTTGTTGAAATCGACAT
TCAAGATATAAATGATGAGTTTCCTACGATTGCCTTCTATCCTCGAAATC
CCGATTCTGCTACTATGAACCCAACGATTTTAGAAAATTCATCAACAATG
ACCCCTATCGGACAAATTTCGGTCCATGATCGAGACTCTAAAGGTTTAGA
TAAAGTCCATTGCGAATCATATTTTCTAGATAATGATAAATTGAATCCTA
TTATTGCTATAGGTACCAATGAGCCCAACGAATTCAATATTGTTTCTAAT
AGGAAATTTGATAGAGAAACCGAATCGAAATTAAATGCGGAAATCCGTTG
CACGGATACATCGGATCATTCAACTGTGAAGAATTTAACTATAATCATTC
TAGATGTAAATGATAATCCACCAGAATTTAATAAAGGAACCTATCACTTT
TATATCAAAGAAAATGAGCCCATCGGCACTATGTTAGACAATAGAATGTT
TGTTTCGGATAAAGATAGTAATAATAATGGCAAATTTACATTGTCTATTG
AATCTCCAGGAGACTCATTTTTTACAATAGATCAGCAAAACCAAATTCTA
AAATCTAAAGTGACTTTTGACCGAGAACAGGTATCAGTTCACAAACTAAA
GATCCTAGCCATTGATCATGGAGACGAAAGACTAACTTCCAGTTGTATTG
TTTATGTACATATTAAAGATGTAAATGACAATCCGGTAATAATAACCCCT
TTGATAAATCAGTTTTATATCTCCGAAAACAAACAACGTTCTTTACTTGG
AGTCATAAAAGCAACAGATTTCGATAACCAAACAATCTACTATTTAATTG
ACAACAAGTCTCAATCAAAGTTCTCGATTGAAAAACATTCTGGTAGACTT
TTTTTACAAAACTCATTAGACAGGGAGGAACAGGAAACTCATCACATAAC
GGTGACAGCTTCAGATAGTTTACATACGGCCTCAACCACTGTCACAGTAG
TAGTCGTTGACGAGAACGATAACAAGCCGATTTTCAAGAATATGAATAAA
GTGATAAAAATTGATGCATCGGAATCTCCAGGATTTAAAATCTGTAAAAT
TGTAGCGACAGATGCAGATCATGGTAACAATGGACTGGTGAAATATATAT
TGAAAAAATCTTCATACAAAGAACCGTTGTTTAATCTTGACAGTGATTCC
GGTGATTTGCATTTGGCGGTATCTTTGCACACAATCCGACCGATTGACAC
CAACACGTTTCTTGACATTGAGGCCTGTGATCAAGGTCAACCGAACCAAT
GCACCATATTTTCTGGGTTGGAAATCCAGTGGACCACCAACCGAAATGAG
CCAGCAAGTAGAGAAAGTGACAAATCGAAAAAATCAAGTTACGATCAATT
TTTAAACGAAAATGTGCTCATTGCCGCAATATCTGGACTGCTAGTTTTGA
TGATAATTATCATGATTGCGTTCATCGTTTTTAAACAAAAGTCCATTTTT
TTTGCCAGAATACCAAGCAGATCAAATTTTTCACATCAGAAAAAGCATAT
GAATCCGTCTGTGACGTGCTATAGAGATAACTTTGTTACTCCAGATTATC
ATTGCTCGACTGAGTTGGAAAATCTAGAAACAGATTTGAGGCAAAATAGG
GACATGGGAACCACACCTATTTTCTACTGTTCTAATCTCTGCATTCCCGA
TTCAAAAGACAAATCAAGTTCTAGTAACATGTTCCTTGAATCTGCTTCGA
GAAGCATGAGTCCATTAGTAGAAAATCAAATGAACATTAAAGATTTCAGT
CGCAAGTCAATTGTGAACCCTGACAATAATTATTACTGTAAATATTTCAC
TGATCATTCCTCAAATATAACCATTTCAGAGTCACCTACTCAAATTGCAG
AATTCTTAAATATTCCGAAACATAAAAACAAAAAACATCAAAGCAGCTTT
GTATAAAACGAATTTGTTTTATTCATGATTGAGTTTTCATTTGTAAAGGC
GTAATTATTTTTTATAACTTATTTACCGGTTTCATCAATTATTTTCATTT
TATTTTATTTACGAAGAGGCTTTTTATAAAATTGTATTTATGTAAATAAT
TTCCTATCTTACAC
back to top

protein sequence of SMED30035286-orf-1

>SMED30035286-orf-1 ID=SMED30035286-orf-1|Name=SMED30035286-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=967bp
MNSLLWWSIFALIDIEGLSSNKIYRIKEETEIGYVIDYIKPNDQNNLKIF
NTNDNGVNCFELESSTGKLFITRRIDREEICPTNRLLKSNNQQCEVTIKL
THQNINFVQRLSIIIEDVNDNAPIWTTDKAIVSFNENSPIGSRRSLPEAT
DIDIGSNGQVIYRMESKYRNSFRLFQDNGLYIENTQMLDREKKNVYEIII
IAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTV
ILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHFLVRPTGEVEIKSKIDYD
SDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPD
SATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPII
AIGTNEPNEFNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILD
VNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIES
PGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVY
VHIKDVNDNPVIITPLINQFYISENKQRSLLGVIKATDFDNQTIYYLIDN
KSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDSLHTASTTVTVVV
VDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILK
KSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQGQPNQCT
IFSGLEIQWTTNRNEPASRESDKSKKSSYDQFLNENVLIAAISGLLVLMI
IIMIAFIVFKQKSIFFARIPSRSNFSHQKKHMNPSVTCYRDNFVTPDYHC
STELENLETDLRQNRDMGTTPIFYCSNLCIPDSKDKSSSSNMFLESASRS
MSPLVENQMNIKDFSRKSIVNPDNNYYCKYFTDHSSNITISESPTQIAEF
LNIPKHKNKKHQSSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 479..496
score: 41.95
coord: 293..306
score: 35.12
coord: 46..65
score: 41.15
coord: 448..474
score: 31.27
coord: 32..44
score: 39.02
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 208..293
e-value: 3.0E-8
score: 43.4
coord: 318..398
e-value: 1.6E-20
score: 84.2
coord: 421..495
e-value: 1.3E-20
score: 84.5
coord: 91..177
e-value: 4.1E-12
score: 56.3
coord: 1..65
e-value: 9.7E-6
score: 35.1
coord: 519..603
e-value: 1.7
score: 1.5
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 77..170
e-value: 2.6E-9
score: 37.4
coord: 300..390
e-value: 1.1E-13
score: 51.4
coord: 5..57
e-value: 5.5E-9
score: 36.3
coord: 406..487
e-value: 1.4E-13
score: 51.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 190..291
e-value: 2.8E-12
score: 49.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 401..494
e-value: 1.2E-18
score: 69.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 495..605
e-value: 7.2E-15
score: 57.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 1..65
e-value: 3.3E-15
score: 58.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 292..400
e-value: 7.3E-27
score: 96.1
coord: 66..178
e-value: 4.7E-22
score: 80.6
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 320..720
coord: 22..399
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 296..404
score: 22.366
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 9..67
score: 17.346
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 401..497
score: 21.774
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 498..605
score: 9.3
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 77..179
score: 19.867
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 187..295
score: 15.0
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 77..174
e-value: 9.20886E-20
score: 82.7465
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 194..291
e-value: 3.68048E-13
score: 63.8717
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 9..63
e-value: 2.68341E-12
score: 61.5605
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 299..396
e-value: 1.98719E-24
score: 96.2285
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 503..583
e-value: 9.06507E-9
score: 51.5454
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 406..493
e-value: 1.01307E-14
score: 68.4941
NoneNo IPR availableTMHMMTMhelixcoord: 624..646
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 283..293
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 55..65
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 485..495
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 283..412
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 190..295
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 394..497
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 55..204
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 485..606
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 7..67