Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30035285
Length (bp)2014
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30035285) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30035285) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035285

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30035285SMESG000018940.1 SMESG000018949.1 SMESG000018943.1 PL08003B1E09_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 133.65 bits (335), Expect = 6.999e-33
Identity = 95/290 (32.76%), Postives = 147/290 (50.69%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMS-----LDDALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V     +   + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        +   H FFR I+W  L+   ++PP
Sbjct:   99 KGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPP 368          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 133.65 bits (335), Expect = 9.485e-33
Identity = 95/290 (32.76%), Postives = 147/290 (50.69%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMS-----LDDALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V     +   + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        +   H FFR I+W  L+   ++PP
Sbjct:   46 KGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPP 315          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 133.65 bits (335), Expect = 1.719e-32
Identity = 95/290 (32.76%), Postives = 147/290 (50.69%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMS-----LDDALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V     +   + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        +   H FFR I+W  L+   ++PP
Sbjct:   99 KGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPP 368          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 128.257 bits (321), Expect = 8.135e-31
Identity = 87/275 (31.64%), Postives = 137/275 (49.82%), Query Frame = 1
Query:  637 FWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMS-----LDDALHHQFFRQIHWSSLVY--IKPP 1440
            F +        +   M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        +   H FFR I+W  L+   ++PP
Sbjct:   91 FELLRVLGKGGYGKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPP 345          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: RPS6KB2 (ribosomal protein S6 kinase B2 [Source:HGNC Symbol;Acc:HGNC:10437])

HSP 1 Score: 126.331 bits (316), Expect = 3.002e-30
Identity = 88/298 (29.53%), Postives = 143/298 (47.99%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALKM--KLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAA---YLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK--------ISNHCQSFLENMLRFNPNSRMS-----LDDALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V   + +   + +A+K+  K +  ++       R E  +L+ ++H FIV L + ++T G +++ +E L GG L++H+ ++G   E    +Y A I  AL HLH + I+YRDLK ENI+L S G  KL DFG+ K                E+ H  A  + +     Y+APEI  R S  N  +D W LG ++ ++L G   F +           +N K   D  I+        ++   +  ++  L+ NP+ R+        D   H FFR ++W  L+   + PP
Sbjct:   75 KGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCK----------------ESIHEGAVTHTFCGTIEYMAPEILVR-SGHNRAVDWWSLGALMYDMLTGSPPFTA-----------ENRKKTMDKIIRGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPP 344          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: rsks-1 (Ribosomal protein S6 kinase beta [Source:UniProtKB/Swiss-Prot;Acc:Q9NAH6])

HSP 1 Score: 124.79 bits (312), Expect = 8.728e-30
Identity = 88/294 (29.93%), Postives = 148/294 (50.34%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTK---NSRHFALKMK-----LRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK--------ISNHCQSFLENMLRFNPNSRM--SLDDALH---HQFFRQIHWSSLVYIK 1434
            +GG G VF V  T    N + FA+K+      +R+ K  +    ER    +L+ ++  FI +L + ++T G +++ +EYL GG L+ H+ ++G   E+   +Y + I+ +L HLHQ+ I+YRDLK ENI+LD+YG  KL DFG+ K+             D++   +  T      Y+APEI  R       +D W LG ++ ++L G   F +           +N +   D  +K        +SN  +  ++ +L+ + ++R+   L DA     H FF+   W +LVY +
Sbjct:   91 KGGYGKVFQVRKTTGSDNGQIFAMKVLQKATIVRNQKDTAHTKAER---NILEAVKSPFICDLLYAFQTGGKLYLILEYLSGGELFMHLEREGMFMENVAKFYLSEIVVSLEHLHQQGIIYRDLKPENILLDAYGHVKLTDFGLCKE---------EIEGDQKTHTFCGT----IEYMAPEILMRCGHGKA-VDWWSLGALMFDMLTGGPPFTA-----------ENRRKTIDKILKGRLTLPAYLSNEARDLIKKLLKRHVDTRLGAGLSDAEEIKSHAFFKTTDW-NLVYAR 355          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: R04A9.7 (pep chromosome:WBcel235:X:391360:394828:-1 gene:WBGene00044281.1 transcript:R04A9.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R04A9.7)

HSP 1 Score: 114.39 bits (285), Expect = 4.656e-27
Identity = 76/286 (26.57%), Postives = 141/286 (49.30%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNSRH---FALKM--KLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSI----KISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V           +A+K+  K + + +       R E ++L+ I   F+ +L++ ++T   +++ +E+L GG L++ + +K   PE Y  +Y + I+ A+ HLH  +IVYRDLK +N++L+  G   L DFG+ K       + + +   E+   +  T      Y+APE+  R    +  +D W LG ++ ++ +G   F        G    D  K    G +    K+S   +  ++ +++ +P  R+++ D   H+FF +I W  L+    +PP
Sbjct:   57 EGGYGKVFQVRKQTGEDKGTIYAMKVITKRKVTGTEKDLRHARDERKILETINSPFLCDLHYAFQTNEKLYLVLEFLHGGELYTLLERKSDWPEEYARFYLSEIILAIEHLHGHDIVYRDLKPDNVMLNLAGHVVLTDFGLCK-------YKLKKG--EKTLTFCGTH----EYMAPEMI-RKVGHDHAVDVWALGILMYDMFMGGPPF-------TGETPADKDKSILKGKVRLPPKLSASGKDLIKRIIKRDPTLRITIPDIKEHEFFEEIDWDKLMAHDFEPP 321          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: sgk-1 (Serine/threonine-protein kinase sgk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q2PJ68])

HSP 1 Score: 114.775 bits (286), Expect = 6.375e-27
Identity = 95/356 (26.69%), Postives = 163/356 (45.79%), Query Frame = 1
Query:  562 SEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRD--SKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMS----LDDALHHQFFRQIHWSSLVYIKPPDLSVFRRRTKGSGIIQAVPN--DISNVSTIFEFCDLQLPDPLLTPSFNNQCNATYVD 1605
            SE  +  +   +Y  T  +G  G V+ V   +  + +A+K+  ++   K N    +    + ++   +H F+V+L+  ++    ++  +++L+GG L+SH+ ++    ES + +Y+A I  AL +LH+KNI+YRDLK EN++LD  G   L DFG+ K+             D +     +T      YLAPEI  +     T +D W LG V+ E++ G   F S    ++  D+  N       +I +   C   +  +L+ + + R+       D   H FF  + W  L+            R   +  I  V N  D SN+S   EF ++Q+    L P    Q   T+ D
Sbjct:  115 SERKTATANDFDYLTTIGKGSFGRVYQVRHKETKKIYAMKILSKEHIRKKNEVKHVMAERNVLINNFKHPFLVSLHFSFQNKEKLYFVLDHLNGGELFSHLQREKHFSESRSRFYAAEIACALGYLHEKNIIYRDLKPENLLLDDKGYLVLTDFGLCKE-------------DMQGSKTTSTFCGTPEYLAPEIILKKPYDKT-VDWWCLGSVLYEMIFGLPPFYSKDHNEM-YDKIINQPLRLKHNISVP--CSELITGLLQKDRSKRLGHRNDFRDIRDHPFFLPVDWDKLL-----------NRELKAPFIPKVKNAMDTSNISK--EFVEIQIDPSSLAPQ---QLAVTHRD 437          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: sgk-1 (Serine/threonine-protein kinase sgk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q2PJ68])

HSP 1 Score: 114.39 bits (285), Expect = 8.309e-27
Identity = 92/344 (26.74%), Postives = 159/344 (46.22%), Query Frame = 1
Query:  562 SEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRD--SKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMS----LDDALHHQFFRQIHWSSLVYIKPPDLSVFRRRTKGSGIIQAVPN--DISNVSTIFEFCDLQLPDPLLTP 1569
            SE  +  +   +Y  T  +G  G V+ V   +  + +A+K+  ++   K N    +    + ++   +H F+V+L+  ++    ++  +++L+GG L+SH+ ++    ES + +Y+A I  AL +LH+KNI+YRDLK EN++LD  G   L DFG+ K+             D +     +T      YLAPEI  +     T +D W LG V+ E++ G   F S    ++  D+  N       +I +   C   +  +L+ + + R+       D   H FF  + W  L+            R   +  I  V N  D SN+S   EF ++Q+    L P
Sbjct:  125 SERKTATANDFDYLTTIGKGSFGRVYQVRHKETKKIYAMKILSKEHIRKKNEVKHVMAERNVLINNFKHPFLVSLHFSFQNKEKLYFVLDHLNGGELFSHLQREKHFSESRSRFYAAEIACALGYLHEKNIIYRDLKPENLLLDDKGYLVLTDFGLCKE-------------DMQGSKTTSTFCGTPEYLAPEIILKKPYDKT-VDWWCLGSVLYEMIFGLPPFYSKDHNEM-YDKIINQPLRLKHNISVP--CSELITGLLQKDRSKRLGHRNDFRDIRDHPFFLPVDWDKLL-----------NRELKAPFIPKVKNAMDTSNISK--EFVEIQIDPSSLAP 438          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 115.546 bits (288), Expect = 1.762e-26
Identity = 88/307 (28.66%), Postives = 147/307 (47.88%), Query Frame = 1
Query:  580 DSFKLEYPNTCIQGGQGVVFWV--FDTKNSRH-FALK------MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK----ISNHCQSFLENMLRFNPNSRM-----SLDDALHHQFFRQIHWSSLV--YIKPP 1440
            D  + E      QG  G VF V     ++S H +A+K      +K+RD +        + E  +L  I H FIV L++ ++T G +++ +++L GG L++ ++K+    E    +Y A +  AL HLH   IVYRDLK ENI+LD+ G  K+ DFG++K+             D E + Y         Y+APE+ +R    +   D W LG ++ E+L G+     +P++  G D+ D         +     ++   QS L  + + N  +R+      +++   H FF +I +  L+   I PP
Sbjct:   43 DPRQFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDRQRT------KLERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAI-----------DSEKKTYSFCG--TVEYMAPEVINR-RGHSMAADFWSLGVLMFEMLTGH-----LPFQ--GRDRNDTMTQILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAKIDFVKLLNKEIDPP 322          

HSP 2 Score: 92.4337 bits (228), Expect = 3.234e-19
Identity = 69/241 (28.63%), Postives = 106/241 (43.98%), Query Frame = 1
Query:  742 MLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTL-PESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLD-SYGRP---KLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMP-------WEKVGADQRDNWKFNFDGSIK--------ISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQ 1404
            +L+   H F+V L+ VYE   A++M  E  +GG L   +  K +L  E       A +LNA+ +LH + + +RDL A NI+     G P   +++DFG AKQ    N   +             T  Y A ++APE+  R    +   D W LG ++  +L G   F   P        ++VG           DG I         IS+  +  +  ML  +PN R++   AL H++  Q
Sbjct:  442 LLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLM-------------TPCYTAQFVAPEVL-RKQGYDRSCDVWSLGVLLHTMLTGCTPFAMGPNDTPDQILQRVG-----------DGKISMTHPVWDTISDEAKDLVRKMLDVDPNRRVTAKQALQHKWIGQ 657          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: S6k (gene:FBgn0283472 transcript:FBtr0077114)

HSP 1 Score: 127.102 bits (318), Expect = 8.231e-31
Identity = 113/412 (27.43%), Postives = 186/412 (45.15%), Query Frame = 1
Query:  481 EPCICINTEQLLYHQSTDVIYEWH----KFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKN---SRHFALKMKLRDS--KSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAA--YLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRM--SLDDALH---HQFFRQIHWSSLVY--IKPP---------DLSVFRRRTKGSGIIQAVPNDISNVSTIFEFCDLQLPD-PLLTPS-FNNQCNATYVDVASPKDTP 1629
            EP +CIN  Q    Q T  + E +    K K  P        E      +GG G VF V  T     +++FA+K+  + S   +       R E  +L+ ++H FIV L + ++T G +++ +EYL GG L+ H+ ++G   E  T +Y + I+ AL HLH+  I+YRDLK ENI+LD+ G  KL DFG+ K               E  +    T  +     Y+APEI +R S     +D W LG ++ ++L G   F +   +K   +     K N      ++   +  +  +++     R+    +DA     H FF+ ++W  ++   ++PP         D+S F  R       + +P D  + +T+ E  +L       + PS   +   A  +   SP+ TP
Sbjct:   41 EPELCINLHQDTEGQETIQLCEENVNPGKIKLGPKDF-----ELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCK---------------EHIQEGIVTHTFCGTIEYMAPEILTR-SGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKT-IETILKAKLNLPAY--LTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTR-----FTRQIPVDSPDDTTLSESANLIFQGFTYVAPSILEDMHRANRMPARSPRRTP 423          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: S6k (gene:FBgn0283472 transcript:FBtr0333264)

HSP 1 Score: 127.102 bits (318), Expect = 8.231e-31
Identity = 113/412 (27.43%), Postives = 186/412 (45.15%), Query Frame = 1
Query:  481 EPCICINTEQLLYHQSTDVIYEWH----KFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKN---SRHFALKMKLRDS--KSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAA--YLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRM--SLDDALH---HQFFRQIHWSSLVY--IKPP---------DLSVFRRRTKGSGIIQAVPNDISNVSTIFEFCDLQLPD-PLLTPS-FNNQCNATYVDVASPKDTP 1629
            EP +CIN  Q    Q T  + E +    K K  P        E      +GG G VF V  T     +++FA+K+  + S   +       R E  +L+ ++H FIV L + ++T G +++ +EYL GG L+ H+ ++G   E  T +Y + I+ AL HLH+  I+YRDLK ENI+LD+ G  KL DFG+ K               E  +    T  +     Y+APEI +R S     +D W LG ++ ++L G   F +   +K   +     K N      ++   +  +  +++     R+    +DA     H FF+ ++W  ++   ++PP         D+S F  R       + +P D  + +T+ E  +L       + PS   +   A  +   SP+ TP
Sbjct:   41 EPELCINLHQDTEGQETIQLCEENVNPGKIKLGPKDF-----ELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCK---------------EHIQEGIVTHTFCGTIEYMAPEILTR-SGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKT-IETILKAKLNLPAY--LTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTR-----FTRQIPVDSPDDTTLSESANLIFQGFTYVAPSILEDMHRANRMPARSPRRTP 423          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: S6kII (gene:FBgn0262866 transcript:FBtr0333715)

HSP 1 Score: 110.153 bits (274), Expect = 1.585e-24
Identity = 89/330 (26.97%), Postives = 149/330 (45.15%), Query Frame = 1
Query:  532 DVIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWV-----------FDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDN--WKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLD-----DALHHQFFRQIHWSSLV--YIKPPDLSVFRR 1461
            +VI E H  K++P+  +  ++       +G  G VF V           +  K  +   LK+K R   +N        E ++L  + H FIV L++ ++TPG +++ +++L GG L++ ++K+    E    +Y A +  A+ HLH   I+YRDLK ENI+LD +G   L DFG++KQ            +  +   +  T      Y+APEI +R    +   D W  G ++ E+L G     ++P+      +  N   +        +S   QS L  + + NP +R+        D   H FF  I W  L    ++PP +    R
Sbjct:  185 EVIKEGHD-KADPSQFELLRV-----LGEGSFGKVFLVRKIIGKDAGTLYAMKVLKKATLKVKDRVRSTN--------ERKILADVGHAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKPENILLDEHGHIALTDFGLSKQPL----------DGSKTYSFCGT----VEYMAPEIVNR-KGHDFAADWWSFGVLMYEMLTG-----NLPFHGQTRQETMNQILRSKLGMPENLSPEAQSLLRALFKRNPQNRLGAGAQGILDIKAHCFFATIDWVRLERKQVRPPFIPAVSR 480          

HSP 2 Score: 92.4337 bits (228), Expect = 4.604e-19
Identity = 70/232 (30.17%), Postives = 102/232 (43.97%), Query Frame = 1
Query:  742 MLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRP----KLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMP-------WEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQ 1404
            ML+   H  IV LY VYE  G+ ++ ME L GG L   I   G + ES        I +A+ +LH+  +V+RDLK  N++  S  +     KL D G AKQ+   N   +             T  Y A ++APE+  R    +   D W LG ++  +L G   F S P        +++G+ Q D   F       IS   +  L  ML   P +R +    L H + R+
Sbjct:  622 MLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLRTIASAVAYLHEHGVVHRDLKPSNMIYASMRQTPETLKLCDLGFAKQLRADNGLLM-------------TPCYTANFVAPEVLKR-QGYDLACDIWSLGVLLYIMLSGRTPFASTPNDSPDVILKRIGSGQID---FTSSRWALISVPAKELLRQMLHIVPENRPTAARILEHDWLRE 836          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: S6kII (gene:FBgn0262866 transcript:FBtr0077360)

HSP 1 Score: 110.153 bits (274), Expect = 1.585e-24
Identity = 89/330 (26.97%), Postives = 149/330 (45.15%), Query Frame = 1
Query:  532 DVIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWV-----------FDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDN--WKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLD-----DALHHQFFRQIHWSSLV--YIKPPDLSVFRR 1461
            +VI E H  K++P+  +  ++       +G  G VF V           +  K  +   LK+K R   +N        E ++L  + H FIV L++ ++TPG +++ +++L GG L++ ++K+    E    +Y A +  A+ HLH   I+YRDLK ENI+LD +G   L DFG++KQ            +  +   +  T      Y+APEI +R    +   D W  G ++ E+L G     ++P+      +  N   +        +S   QS L  + + NP +R+        D   H FF  I W  L    ++PP +    R
Sbjct:  185 EVIKEGHD-KADPSQFELLRV-----LGEGSFGKVFLVRKIIGKDAGTLYAMKVLKKATLKVKDRVRSTN--------ERKILADVGHAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKPENILLDEHGHIALTDFGLSKQPL----------DGSKTYSFCGT----VEYMAPEIVNR-KGHDFAADWWSFGVLMYEMLTG-----NLPFHGQTRQETMNQILRSKLGMPENLSPEAQSLLRALFKRNPQNRLGAGAQGILDIKAHCFFATIDWVRLERKQVRPPFIPAVSR 480          

HSP 2 Score: 92.4337 bits (228), Expect = 4.604e-19
Identity = 70/232 (30.17%), Postives = 102/232 (43.97%), Query Frame = 1
Query:  742 MLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRP----KLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMP-------WEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQ 1404
            ML+   H  IV LY VYE  G+ ++ ME L GG L   I   G + ES        I +A+ +LH+  +V+RDLK  N++  S  +     KL D G AKQ+   N   +             T  Y A ++APE+  R    +   D W LG ++  +L G   F S P        +++G+ Q D   F       IS   +  L  ML   P +R +    L H + R+
Sbjct:  622 MLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLRTIASAVAYLHEHGVVHRDLKPSNMIYASMRQTPETLKLCDLGFAKQLRADNGLLM-------------TPCYTANFVAPEVLKR-QGYDLACDIWSLGVLLYIMLSGRTPFASTPNDSPDVILKRIGSGQID---FTSSRWALISVPAKELLRQMLHIVPENRPTAARILEHDWLRE 836          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: aPKC (gene:FBgn0261854 transcript:FBtr0303434)

HSP 1 Score: 108.997 bits (271), Expect = 1.720e-24
Identity = 88/298 (29.53%), Postives = 137/298 (45.97%), Query Frame = 1
Query:  760 HNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDN-------WKFNFDGSIKI----SNHCQSFLENMLRFNPNSRM------SLDDALHHQFFRQIHWSSLV--YIKPP---------DLSVFRRRTKGSGIIQAVPNDISNVSTI--FEFCDLQLPDPLL 1563
            H F+V L+  ++TP  +F  +E++ GG L  H+ ++  LPE +  +Y+A I  AL  LH+K I+YRDLK +N++LD  G  KL D+GM K+          R  D       +T      Y+APEI  R       +D W LG ++ E+L G       P++  GA +  +       ++   + +I+I    S    S L+  L  NP  R+      +  D + H FF+ + W  L    + PP         DL+ F     G   +Q  P+D   +  I   EF   +  +PLL
Sbjct:  322 HPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGI--------RPGDTT-----STFCGTPNYIAPEIL-RGEDYGFSVDWWALGVLLYEMLAGRS-----PFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNPADRLGCHRESAFMDIVSHPFFKNMDWELLERKQVTPPFKPRLDSDRDLANFPPEFTGEA-VQLTPDDDHVIDNIDQSEFEGFEYVNPLL 599          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: rps6kb1b (ribosomal protein S6 kinase b, polypeptide 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2038])

HSP 1 Score: 133.265 bits (334), Expect = 1.115e-32
Identity = 95/290 (32.76%), Postives = 150/290 (51.72%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSL--DDALH---HQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V     +   + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L++ G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ + +SR+     DA     H FFR ++W  L+   ++PP
Sbjct:   73 KGGYGKVFQVRKVSGAATGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFRHVNWDDLLARKVEPP 342          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: rps6kb1a (ribosomal protein S6 kinase b, polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-091113-52])

HSP 1 Score: 131.724 bits (330), Expect = 3.682e-32
Identity = 95/290 (32.76%), Postives = 147/290 (50.69%), Query Frame = 1
Query:  616 QGGQGVVFWV---FDTKNSRHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLD-----DALHHQFFRQIHWSSLVYIK--PP 1440
            +GG G VF V       + + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T   +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI +R S  N  +D W LG ++ ++L G   F +   +K   D+    K N      ++   +  L+ +L+ N + R+        D   H FFR I+W  L+  K  PP
Sbjct:   73 KGGYGKVFQVRKVAGAASGKIFAMKVLKKAMIVRNAKDTAHTKAER---SILEEVKHPFIVDLIYAFQTGEKLYLILEYLSGGELFMQLEREGIFLEDTACFYLAEISLALGHLHQKGIIYRDLKPENIMLNYNGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILTR-SGHNRAVDWWSLGALMYDMLTGAPPFTAENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNASVRIGASPRDVLDIQRHSFFRHINWDDLLAFKIDPP 342          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: BX000486.1 (ribosomal protein S6 kinase b, polypeptide 1a [Source:NCBI gene;Acc:562242])

HSP 1 Score: 131.724 bits (330), Expect = 3.866e-32
Identity = 95/290 (32.76%), Postives = 147/290 (50.69%), Query Frame = 1
Query:  616 QGGQGVVFWV---FDTKNSRHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLD-----DALHHQFFRQIHWSSLVYIK--PP 1440
            +GG G VF V       + + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T   +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI +R S  N  +D W LG ++ ++L G   F +   +K   D+    K N      ++   +  L+ +L+ N + R+        D   H FFR I+W  L+  K  PP
Sbjct:   74 KGGYGKVFQVRKVAGAASGKIFAMKVLKKAMIVRNAKDTAHTKAER---SILEEVKHPFIVDLIYAFQTGEKLYLILEYLSGGELFMQLEREGIFLEDTACFYLAEISLALGHLHQKGIIYRDLKPENIMLNYNGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILTR-SGHNRAVDWWSLGALMYDMLTGAPPFTAENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNASVRIGASPRDVLDIQRHSFFRHINWDDLLAFKIDPP 343          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: prkg3 (protein kinase cGMP-dependent 3 [Source:ZFIN;Acc:ZDB-GENE-030131-4745])

HSP 1 Score: 126.331 bits (316), Expect = 2.171e-31
Identity = 88/320 (27.50%), Postives = 155/320 (48.44%), Query Frame = 1
Query:  535 VIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALK----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRM-----SLDDALHHQFFRQIHWSSLVY--IKPPDLSVFRR 1461
            V+Y+   ++ +P +L             GG G V  V   ++ ++FA+K      +   K  +  ++E++   +L+ I+ +FIV L+  ++    ++M ME+  GG +W+ + + G   E   V+ +AC++ A  +LH K I+YRDLK EN++LDS G  KL+DFG AK++S            E+   +  T      Y++PEI       +   D W LG ++ E+L+G   F S   +K+ A   D    NF     +    +S +  + R  P  R+      + D  HH++F  I+W  L    ++ P + + R+
Sbjct:   20 VLYQEGSYQGDPVTLGI-----------GGFGKVELVTTLEHRKYFAMKRISKQHVVAKKQEAHILLEKK---ILQAIRCDFIVRLHAAFKDSRYVYMIMEFCPGGEIWTKLKEAGRFEEKIAVFITACVVEAYAYLHNKGILYRDLKPENLMLDSKGYVKLVDFGFAKELS----------RGEKTYSFCGT----PEYISPEIIQN-QGHDIAADFWSLGVLIYELLVGSPPFSSSEPQKIYAKILDG-VLNFPSY--MGEGAKSIISKLCRLRPGQRLGNTKNGIKDVRHHRWFNSINWHKLRMGQLEAPTVRLIRK 307          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: prkg3 (protein kinase cGMP-dependent 3 [Source:ZFIN;Acc:ZDB-GENE-030131-4745])

HSP 1 Score: 128.642 bits (322), Expect = 8.999e-31
Identity = 88/320 (27.50%), Postives = 155/320 (48.44%), Query Frame = 1
Query:  535 VIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALK----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRM-----SLDDALHHQFFRQIHWSSLVY--IKPPDLSVFRR 1461
            V+Y+   ++ +P +L             GG G V  V   ++ ++FA+K      +   K  +  ++E++   +L+ I+ +FIV L+  ++    ++M ME+  GG +W+ + + G   E   V+ +AC++ A  +LH K I+YRDLK EN++LDS G  KL+DFG AK++S            E+   +  T      Y++PEI       +   D W LG ++ E+L+G   F S   +K+ A   D    NF     +    +S +  + R  P  R+      + D  HH++F  I+W  L    ++ P + + R+
Sbjct:  256 VLYQEGSYQGDPVTLGI-----------GGFGKVELVTTLEHRKYFAMKRISKQHVVAKKQEAHILLEKK---ILQAIRCDFIVRLHAAFKDSRYVYMIMEFCPGGEIWTKLKEAGRFEEKIAVFITACVVEAYAYLHNKGILYRDLKPENLMLDSKGYVKLVDFGFAKELS----------RGEKTYSFCGT----PEYISPEIIQN-QGHDIAADFWSLGVLIYELLVGSPPFSSSEPQKIYAKILDGV-LNFPSY--MGEGAKSIISKLCRLRPGQRLGNTKNGIKDVRHHRWFNSINWHKLRMGQLEAPTVRLIRK 543          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 136.346 bits (342), Expect = 1.011e-33
Identity = 96/290 (33.10%), Postives = 146/290 (50.34%), Query Frame = 1
Query:  616 QGGQGVVFWV---FDTKNSRHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLD-----DALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V         + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        D   H FFR I+W  L+   ++PP
Sbjct:   44 KGGYGKVFQVRKVIGAHTGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFRHINWEELLARKVEPP 313          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 136.346 bits (342), Expect = 1.377e-33
Identity = 96/290 (33.10%), Postives = 146/290 (50.34%), Query Frame = 1
Query:  616 QGGQGVVFWV---FDTKNSRHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLD-----DALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V         + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        D   H FFR I+W  L+   ++PP
Sbjct:   73 KGGYGKVFQVRKVIGAHTGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFRHINWEELLARKVEPP 342          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 135.961 bits (341), Expect = 1.429e-33
Identity = 96/290 (33.10%), Postives = 146/290 (50.34%), Query Frame = 1
Query:  616 QGGQGVVFWV---FDTKNSRHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLD-----DALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V         + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        D   H FFR I+W  L+   ++PP
Sbjct:   52 KGGYGKVFQVRKVIGAHTGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFRHINWEELLARKVEPP 321          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 136.346 bits (342), Expect = 1.479e-33
Identity = 96/290 (33.10%), Postives = 146/290 (50.34%), Query Frame = 1
Query:  616 QGGQGVVFWV---FDTKNSRHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLD-----DALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V         + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        D   H FFR I+W  L+   ++PP
Sbjct:   66 KGGYGKVFQVRKVIGAHTGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFRHINWEELLARKVEPP 335          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 136.732 bits (343), Expect = 1.646e-33
Identity = 96/290 (33.10%), Postives = 146/290 (50.34%), Query Frame = 1
Query:  616 QGGQGVVFWV---FDTKNSRHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLD-----DALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V         + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        D   H FFR I+W  L+   ++PP
Sbjct:   99 KGGYGKVFQVRKVIGAHTGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFRHINWEELLARKVEPP 368          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Rps6kb1 (ribosomal protein S6 kinase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1270849])

HSP 1 Score: 133.65 bits (335), Expect = 1.357e-32
Identity = 95/290 (32.76%), Postives = 147/290 (50.69%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMS-----LDDALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V     +   + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        +   H FFR I+W  L+   ++PP
Sbjct:   99 KGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPP 368          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 126.331 bits (316), Expect = 5.614e-31
Identity = 94/299 (31.44%), Postives = 143/299 (47.83%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALKMKLRDSK---SNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAA---YLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK--------ISNHCQSFLENMLRFNPNSRM--SLDDAL---HHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V   + +   + +A+K+ LR +K   S       R E  +L+ ++H FIV L + ++T G +++ +E L GG L++H+ ++G   E    +Y A I  AL HLH   I+YRDLK ENI+L S G  KL DFG+ K                E+ H  A  + +     Y+APEI  R +  N  +D W LG ++ ++L G   F +           +N K   D  IK        ++   +   +  L+ NP  R+   L DA     H FFR I+W  L+   + PP
Sbjct:   75 KGGYGKVFQVRKVQGTNLGKIYAMKV-LRKAKIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCK----------------ESIHEGAITHTFCGTIEYMAPEILVR-TGHNRAVDWWSLGALMYDMLTGSPPFTA-----------ENRKKTMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFRHINWDDLLARRVDPP 344          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 126.331 bits (316), Expect = 5.614e-31
Identity = 94/299 (31.44%), Postives = 143/299 (47.83%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALKMKLRDSK---SNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAA---YLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK--------ISNHCQSFLENMLRFNPNSRM--SLDDAL---HHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V   + +   + +A+K+ LR +K   S       R E  +L+ ++H FIV L + ++T G +++ +E L GG L++H+ ++G   E    +Y A I  AL HLH   I+YRDLK ENI+L S G  KL DFG+ K                E+ H  A  + +     Y+APEI  R +  N  +D W LG ++ ++L G   F +           +N K   D  IK        ++   +   +  L+ NP  R+   L DA     H FFR I+W  L+   + PP
Sbjct:   75 KGGYGKVFQVRKVQGTNLGKIYAMKV-LRKAKIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCK----------------ESIHEGAITHTFCGTIEYMAPEILVR-TGHNRAVDWWSLGALMYDMLTGSPPFTA-----------ENRKKTMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFRHINWDDLLARRVDPP 344          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 127.872 bits (320), Expect = 6.081e-31
Identity = 94/299 (31.44%), Postives = 143/299 (47.83%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALKMKLRDSK---SNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAA---YLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK--------ISNHCQSFLENMLRFNPNSRM--SLDDAL---HHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V   + +   + +A+K+ LR +K   S       R E  +L+ ++H FIV L + ++T G +++ +E L GG L++H+ ++G   E    +Y A I  AL HLH   I+YRDLK ENI+L S G  KL DFG+ K                E+ H  A  + +     Y+APEI  R +  N  +D W LG ++ ++L G   F +           +N K   D  IK        ++   +   +  L+ NP  R+   L DA     H FFR I+W  L+   + PP
Sbjct:   75 KGGYGKVFQVRKVQGTNLGKIYAMKV-LRKAKIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCK----------------ESIHEGAITHTFCGTIEYMAPEILVR-TGHNRAVDWWSLGALMYDMLTGSPPFTA-----------ENRKKTMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFRHINWDDLLARRVDPP 344          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 127.872 bits (320), Expect = 6.081e-31
Identity = 94/299 (31.44%), Postives = 143/299 (47.83%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALKMKLRDSK---SNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAA---YLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK--------ISNHCQSFLENMLRFNPNSRM--SLDDAL---HHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V   + +   + +A+K+ LR +K   S       R E  +L+ ++H FIV L + ++T G +++ +E L GG L++H+ ++G   E    +Y A I  AL HLH   I+YRDLK ENI+L S G  KL DFG+ K                E+ H  A  + +     Y+APEI  R +  N  +D W LG ++ ++L G   F +           +N K   D  IK        ++   +   +  L+ NP  R+   L DA     H FFR I+W  L+   + PP
Sbjct:   75 KGGYGKVFQVRKVQGTNLGKIYAMKV-LRKAKIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCK----------------ESIHEGAITHTFCGTIEYMAPEILVR-TGHNRAVDWWSLGALMYDMLTGSPPFTA-----------ENRKKTMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFRHINWDDLLARRVDPP 344          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8MYF1|Y2070_DICDI (Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277449 PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 3.788e-32
Identity = 95/309 (30.74%), Postives = 154/309 (49.84%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNSRHFALK-MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFV----SMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLDDALH---HQFFRQIHWSSL--VYIKPPDLSVFRRRTKGSGIIQAVPNDISN 1512
            +GG G VF V      + +ALK +K     +  S +    E  +LKKI H FIVNL++ ++    +++ M++++GG L+ H+ K+    E    +Y A ++ AL HLH  NIV+RDLK ENI+LDS G   L DFG+AK         +  NN  E   +  T      Y+APE+    ++    +D W +G ++ ++++G   F     ++  EK+ +++    KF       +S+  +S +  +L  +P  R+  + A+    H FF+ I W  +    I PP    F   TKG        +DISN
Sbjct:  136 KGGFGKVFQVVHVDTQKVYALKVIKKNHIIAKKSVVNTLAEKDILKKISHPFIVNLHYAFQNEKKLYLVMDFVNGGQLFYHLQKEAIFSEDQVRFYMAELILALEHLHDSNIVHRDLKPENILLDSQGHCILTDFGLAK-------LEVKTNN--ETFSFAGT----LEYMAPEMIQH-ATCGKAVDWWSIGILMYDMMIGKPPFEHKNRALMQEKIISEKAKFPKF-------VSSSARSLINGLLTKDPTKRLGANGAIEIKRHPFFKSIQWRKIENKEITPP----FVPSTKGI-------DDISN 412          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P67998|KS6B1_RABIT (Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus OX=9986 GN=RPS6KB1 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.111e-32
Identity = 95/290 (32.76%), Postives = 147/290 (50.69%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMS-----LDDALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V     +   + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        +   H FFR I+W  L+   ++PP
Sbjct:   99 KGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPP 368          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6TJY3|KS6B1_BOVIN (Ribosomal protein S6 kinase beta-1 OS=Bos taurus OX=9913 GN=RPS6KB1 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.755e-32
Identity = 95/290 (32.76%), Postives = 147/290 (50.69%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMS-----LDDALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V     +   + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        +   H FFR I+W  L+   ++PP
Sbjct:   99 KGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPP 368          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P67999|KS6B1_RAT (Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus OX=10116 GN=Rps6kb1 PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 8.101e-32
Identity = 95/290 (32.76%), Postives = 147/290 (50.69%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMS-----LDDALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V     +   + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        +   H FFR I+W  L+   ++PP
Sbjct:   99 KGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPP 368          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P23443|KS6B1_HUMAN (Ribosomal protein S6 kinase beta-1 OS=Homo sapiens OX=9606 GN=RPS6KB1 PE=1 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 8.253e-32
Identity = 95/290 (32.76%), Postives = 147/290 (50.69%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMS-----LDDALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V     +   + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ N  SR+        +   H FFR I+W  L+   ++PP
Sbjct:   99 KGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPP 368          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A504YSA7 (Serine threonine protein kinase nrc OS=Fasciola gigantica OX=46835 GN=FGIG_08254 PE=4 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 2.545e-109
Identity = 182/409 (44.50%), Postives = 248/409 (60.64%), Query Frame = 1
Query:  349 IVKYSSISNEIKSN--ITKTTSRSQSDKSKTYYDCPTGRHSNVKTDEPCICINTEQLLYHQSTDVIYEWH---------KFKSEPT---------------------SLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNN-------DEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEK-VGADQRDNWKFNF--DGSIKISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQIHWSSLVYIKPPDLS 1449
            + + +S  N  KS+  + K   +     S+  + CPTGRH +VK D+PCICI  ++++  QS  V+Y WH         + KS  T                     SL +F+L  P   ++GGQG V WV      +++ALK K RD +S+S+W IERRE+++L+  +H+FIV LYH+YET   +FM +E+L+GGCLW+HIA+ GT+PE Y VYY +CIL AL +LH K IVYRD+KAENIVLD  GRPKLIDFGMAK+ S        R +       D E    P T+YY+AAYLAPEIY    +   +ID WGLGY++ E++LGYG+F+ MPWEK  G    +NWK +   D S K+S  C+ FL  ML   P  R++L+ A  H  F ++ WS+L YI+ PDLS
Sbjct:  475 VARVNSKKNSFKSSAEVKKPVKQGALPASRDLHQCPTGRHPDVKVDKPCICIMVKRMVLAQSKPVLYSWHCQPVKNTNSQTKSPMTGEYSDSKNTNPGPSNPRTLAPSLPNFQLARPTRMVRGGQGTVAWVSHIGTGQYYALKFKQRDGRSDSTWEIERREAKLLRFARHDFIVRLYHIYETEETLFMALEWLEGGCLWNHIARLGTMPECYAVYYGSCILAALRYLHSKCIVYRDMKAENIVLDQRGRPKLIDFGMAKRFSKPTGDPDDRESAVDDSLLDSEDFAQPPTRYYFAAYLAPEIYDPSETTGQFIDSWGLGYILVEMILGYGIFLPMPWEKEPGQHLSENWKLSLPGDASTKMSVICEDFLYKMLIRRPEERLTLEQATKHGLFVRVPWSNLAYIRGPDLS 883          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A4E0RWR3 (Serine threonine protein kinase nrc OS=Fasciola hepatica OX=6192 GN=D915_003160 PE=4 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 6.566e-109
Identity = 187/429 (43.59%), Postives = 257/429 (59.91%), Query Frame = 1
Query:  349 IVKYSSISNEIKSN--ITKTTSRSQSDKSKTYYDCPTGRHSNVKTDEPCICINTEQLLYHQSTDVIYEWH---------KFKSEPT---------------------SLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNN-------DEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEK-VGADQRDNWKFNFDG--SIKISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQIHWSSLVYIKPPDLSVFRRRTKGSGIIQAVPNDIS 1509
            + + +S  N  KS+  + K   +     S+  + CPTGRH +VK D+PCICI  ++++  QS  V+Y WH         + KS  T                     SL +F+L  P   ++GGQG V WV      +++ALK K +D +S+S+W IERRE+++L+  +H+FIV LYH+YET   +FM +E+L+GGCLW+HIA+ GT+PE Y VYY +CIL AL +LH K IVYRD+KAENIVLD  GRPKLIDFGMAK+ S   S    R +       D E    P T+YY+AAYLAPEIY    +   +ID WGLGY++ E++LGYG+F+ MPWEK  G    +NWK +  G  S K+S  C+ FL  ML   P  R++L+ A  H  F Q+ WS+L YI+ PDLS  +   K +   Q+ PN  +
Sbjct:  627 VARVNSKKNSCKSSAEVKKPVKQGALPASRDLHQCPTGRHPDVKVDKPCICIMVKRMVLAQSKPVLYSWHCQPVKNTNGQTKSPMTGEYSDGKNTNPGPSNPRTLAPSLPNFQLARPTRMVRGGQGTVAWVSHIGTGQYYALKFKQKDGRSDSTWEIERREAKLLRYARHDFIVRLYHIYETEETLFMALEWLEGGCLWNHIARLGTMPECYAVYYGSCILAALRYLHSKCIVYRDMKAENIVLDQRGRPKLIDFGMAKRFSKPTSDPDDRESAVDDSLLDSEDFAQPPTRYYFAAYLAPEIYDPSETTGQFIDSWGLGYILVEMILGYGIFLPMPWEKEPGQHLSENWKLSLPGEASTKMSVTCEDFLYKMLIRRPEERLTLEQATKHGLFVQVPWSNLAYIRGPDLS--KCPPKSTNPTQSGPNSTT 1053          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A183A8A5 (Protein kinase domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3190 PE=4 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 2.663e-107
Identity = 173/386 (44.82%), Postives = 239/386 (61.92%), Query Frame = 1
Query:  427 SKTYYDCPTGRHSNVKTDEPCICINTEQLLYHQSTDVIYEWHK------------------------------FKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDE----------EAEHY--PATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEK-VGADQRDNWKFNF--DGSIKISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQIHWSSLVYIKPPDLS 1449
            S+  + CPTGRH +VK D+PCICI  ++++  QS  V+Y WH                                K+   +L +F+L  P   ++GGQG V WV      + +ALK K R+ +S+S+W IERRE+++L+  +H FIV L+H+YET   +FM +E+LDGGCLW+HIA+ GT+PE Y +YY +CIL AL +LH K IVYRD+KAENIVLD  GRPKLIDFGMAK+ S        RN D+          ++E +  P T+YY+AAYLAPEIY +  + N +ID WGLGY++ E++LGYG+F+ MPWEK  G    +NWK     D S K+S  C+ FL  ML   P  R++L+ A  H  F ++ WS+L++I+ PDLS
Sbjct:  414 SRDLHQCPTGRHPDVKVDKPCICIMVKRMVLAQSKPVLYSWHSQLNKNLTSQTKSLITGENSDAKCVTAGPSTTKTHVPNLPNFQLARPTRMVRGGQGTVAWVNHVGTGQFYALKFKQREGRSDSTWEIERREAKLLRFARHEFIVRLFHIYETEETLFMALEWLDGGCLWNHIARLGTMPECYAIYYGSCILAALRYLHTKCIVYRDMKAENIVLDHRGRPKLIDFGMAKRFS-----KPMRNQDDHDVTLDDSLHDSEDFDQPPTRYYFAAYLAPEIYDQSEATNQFIDSWGLGYILVEMILGYGIFLPMPWEKDPGQHLSENWKLTLPSDASSKMSVVCEDFLFKMLLRRPEERLTLEQASKHGLFARVPWSNLIHIRGPDLS 794          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1S8X8R9 (Kinase domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_00993 PE=4 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 5.091e-105
Identity = 173/389 (44.47%), Postives = 237/389 (60.93%), Query Frame = 1
Query:  427 SKTYYDCPTGRHSNVKTDEPCICINTEQLLYHQSTDVIYEWHKFKSEPT-------------------------------------SLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRN--------NDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEK-VGADQRDNWKFNF--DGSIKISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQIHWSSLVYIKPPDLS 1449
            S  + +CPTGRHS++K D+PCIC+  ++++  QS  V+Y WH    +P                                      SL +F+L  P   ++GGQG V WV +    + +ALK K R+ +S+S+W IERRE+++L+  +H+FIV L+H+YET   +FM +E+LDGGCLW+HIA+ GTLPE Y  YY+ACIL AL +LH  +IVYRD+KAEN+VLD  GRPKLIDFGMAK+    +S  + +N        ND E    P T+YY+AAYLAPEIY    S   +ID WGLGY++ E+LLGYG+F+ MPWEK  G     +WK N   D + ++S+ C  F+  ML   P  RM+L+ A  H FF ++ WS L  I+ PDLS
Sbjct:  560 SNDHNECPTGRHSDIKPDKPCICLLVKRMVIAQSKPVLYSWHLPLKKPVTNPRLSRSTSGKPTGFSAEAEHRGETPSISAGKTLVPSLPNFQLARPTRMVRGGQGTVAWVTNVSTGQFYALKFKQREGRSDSTWAIERREAKLLRHARHDFIVRLFHIYETEDTLFMALEWLDGGCLWNHIARTGTLPECYATYYAACILCALRYLHSISIVYRDMKAENVVLDQRGRPKLIDFGMAKRFR--SSTEVDQNHDSLEEGSNDSEDFDQPPTRYYFAAYLAPEIYDHSQSTCHFIDSWGLGYILVEMLLGYGIFLPMPWEKEPGQHLSVDWKLNLPNDSNSRLSHICGDFVHRMLLRLPEERMTLEQAEKHAFFARVSWSRLGTIRGPDLS 946          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A075A4H2 (Protein kinase domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_00116 PE=4 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 7.145e-105
Identity = 173/389 (44.47%), Postives = 237/389 (60.93%), Query Frame = 1
Query:  427 SKTYYDCPTGRHSNVKTDEPCICINTEQLLYHQSTDVIYEWHKFKSEPT-------------------------------------SLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRN--------NDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEK-VGADQRDNWKFNF--DGSIKISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQIHWSSLVYIKPPDLS 1449
            S  + +CPTGRHS++K D+PCIC+  ++++  QS  V+Y WH    +P                                      SL +F+L  P   ++GGQG V WV +    + +ALK K R+ +S+S+W IERRE+++L+  +H+FIV L+H+YET   +FM +E+LDGGCLW+HIA+ GTLPE Y  YY+ACIL AL +LH  +IVYRD+KAEN+VLD  GRPKLIDFGMAK+    +S  + +N        ND E    P T+YY+AAYLAPEIY    S   +ID WGLGY++ E+LLGYG+F+ MPWEK  G     +WK N   D + ++S+ C  F+  ML   P  RM+L+ A  H FF ++ WS L  I+ PDLS
Sbjct:  602 SNDHNECPTGRHSDIKPDKPCICLLVKRMVIAQSKPVLYSWHLPLKKPVTNPRLSRSTSGKPTGFSAEAEHRGETPSISAGKTLVPSLPNFQLARPTRMVRGGQGTVAWVTNVSTGQFYALKFKQREGRSDSTWAIERREAKLLRHARHDFIVRLFHIYETEDTLFMALEWLDGGCLWNHIARTGTLPECYATYYAACILCALRYLHSISIVYRDMKAENVVLDQRGRPKLIDFGMAKRFR--SSTEVDQNHDSLEEGSNDSEDFDQPPTRYYFAAYLAPEIYDHSQSTCHFIDSWGLGYILVEMLLGYGIFLPMPWEKEPGQHLSVDWKLNLPNDSNSRLSHICGDFVHRMLLRLPEERMTLEQAEKHAFFARVSWSRLGTIRGPDLS 988          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: rps6kb1b (ribosomal protein S6 kinase B1 [Source:NCBI gene;Acc:103035647])

HSP 1 Score: 133.265 bits (334), Expect = 9.719e-33
Identity = 96/290 (33.10%), Postives = 149/290 (51.38%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSL--DDALH---HQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V         + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L++ G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ + +SR+     DA     H FFR I+W  L+   ++PP
Sbjct:   73 KGGYGKVFQVRKVTGGGSGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFRHINWDDLLARKVEPP 342          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: rps6kb1b (ribosomal protein S6 kinase B1 [Source:NCBI gene;Acc:103035647])

HSP 1 Score: 133.265 bits (334), Expect = 9.826e-33
Identity = 96/290 (33.10%), Postives = 149/290 (51.38%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSL--DDALH---HQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V         + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L++ G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+ + +SR+     DA     H FFR I+W  L+   ++PP
Sbjct:   70 KGGYGKVFQVRKVTGGGSGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFRHINWDDLLARKVEPP 339          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000004157.2 (ribosomal protein S6 kinase B2 [Source:NCBI gene;Acc:103031203])

HSP 1 Score: 131.724 bits (330), Expect = 2.251e-32
Identity = 96/313 (30.67%), Postives = 153/313 (48.88%), Query Frame = 1
Query:  562 SEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRH---FALKM--KLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK--------ISNHCQSFLENMLRFNPNSRMS-----LDDALHHQFFRQIHWSSLVY--IKPP 1440
            SE    D F+L       +GG G VF V   + S+    FA+K+  K +  ++       R E ++L+ ++H FIV+L++ ++T G +++ +E L GG L+  + K+G   E    +Y A I  AL HLH   I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI +R S  N  +D W LG ++ +++ G   F             +N K   D  +K        ++   +  ++ +L+ NP+ R+        D   H FFR I+W  L++  ++PP
Sbjct:   48 SERVGPDCFELL--TVLGKGGYGKVFQVRKVQGSQMGKIFAMKVLRKAKIVRNAKDTAHTRAEREILETVRHPFIVDLWYAFQTGGKLYLILECLSGGELFMQLEKEGIFMEDTACFYLAEITLALGHLHSNGIIYRDLKPENIMLNHEGHIKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILNR-SGHNRAVDWWSLGALMFDMMTGSPPFTG-----------ENRKKTIDKILKCKICLPPYLTPDARDLIKKLLKKNPSQRLGSGKGDCADIQKHPFFRHINWDDLLHKRVEPP 333          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: rps6ka2 (ribosomal protein S6 kinase A2 [Source:NCBI gene;Acc:103036630])

HSP 1 Score: 128.257 bits (321), Expect = 2.026e-30
Identity = 87/308 (28.25%), Postives = 155/308 (50.32%), Query Frame = 1
Query:  559 KSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNS---RHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK----ISNHCQSFLENMLRFNPNSRM-----SLDDALHHQFFRQIHWSSLVY--IKPP 1440
            K++P+  +  K+       QG  G VF V   K S   + +A+K+  + +      +  + E  +L ++ H FIV L++ ++T G +++ +++L GG L++ ++K+    E    +Y A +  AL HLH   I+YRDLK ENI+LD  G  K+ DFG++K+           ++D+ A  +  T      Y+APE+ +R     +  D W  G ++ E+L G     S+P++  G D+++         +     +S+  QS L  + + NP++R+      +++   H FF  I W+ L    IKPP
Sbjct:   53 KADPSQFELLKV-----LGQGSYGKVFLVRKIKGSDTGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEDGHIKITDFGLSKEAI---------DHDKRAYSFCGT----IEYMAPEVVNRRGHTQS-ADWWSFGVLMFEMLTG-----SLPFQ--GKDRKETMALILKAKLGMPQFLSSEVQSLLRALFKRNPSNRLGAGPDGVEEIKRHHFFATIDWNKLYRKEIKPP 334          

HSP 2 Score: 80.8777 bits (198), Expect = 2.119e-15
Identity = 66/255 (25.88%), Postives = 115/255 (45.10%), Query Frame = 1
Query:  658 NSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIV-LDSYGRP---KLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMP-------WEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLDDALHH 1389
             S  +A+K+ +  SK + S  IE     +L+  QH  I+ L  VY+    +++ ME + GG L   I ++    E         I   + +LH + +V+RDLK  NI+ +D  G P   ++ DFG AKQ+   N   +             T  Y A ++APE+  +    +   D W LG ++  +L G+  F + P         ++G+ +      N+D    +S+  +  +  ML  +P+ R++    L H
Sbjct:  437 TSVEYAVKI-IEKSKKDPSEEIE----ILLRYGQHPNIITLKDVYDDGKFVYLVMELMRGGELLDRILRQKGFSEREASAVLCTITKTVEYLHSQGVVHRDLKPSNILYVDETGDPESIRICDFGFAKQLRAENGLLM-------------TPCYTANFVAPEVLKK-QGYDAACDIWSLGILLYTMLAGFTPFANGPDDTPEEILARIGSGKYILSGGNWD---TVSDAAKDIVTKMLHVDPHQRLTAPLVLRH 669          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: rps6ka1 (ribosomal protein S6 kinase a, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-060929-516])

HSP 1 Score: 123.25 bits (308), Expect = 8.148e-29
Identity = 94/346 (27.17%), Postives = 162/346 (46.82%), Query Frame = 1
Query:  457 RHSNVKTDEPCICINTEQLLYHQSTDVIYEW---HKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTK---NSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQ-ISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK----ISNHCQSFLENMLRFNPNSRM-----SLDDALHHQFFRQIHWSSLVY--IKPP 1440
            + S +K ++ C+ +        Q  DVI E    H  K      D  + E      QG  G VF V       +++ +A+K+  + +      +  + E  +L  + H F+V L++ ++T G +++ +++L GG L++ ++K+    E    +Y A +   L HLH   I+YRDLK ENI+LD  G  KL DFG+ K+ I L          +++A  +  T      Y+APE+ +R    ++  D W  G ++ E+L G     S+P++  G D+++         +     +S   QS L  + + NP +R+       ++   H FF  I W+ L    IKPP
Sbjct:    3 KASFIKPNQKCVLL--------QDDDVIKEINITHVVKEGAEKADPSQFELLKVLGQGSFGKVFLVRKITPPDSNQLYAMKVLRKATLKVRDRVRTKMERNILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLCKEAIDL----------EKKAYSFCGT----VEYMAPEVVNRQGHIHS-ADWWSFGVLMFEMLTG-----SLPFQ--GKDRKETMNLILKARLGMPQFLSAEAQSLLRALFKRNPTNRLGSGADGAEEIKRHAFFFTIDWNKLFRREIKPP 318          

HSP 2 Score: 58.5362 bits (140), Expect = 1.565e-8
Identity = 57/227 (25.11%), Postives = 92/227 (40.53%), Query Frame = 1
Query:  742 MLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIV-LDSYGRP---KLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCW-----GLGYVVSEIL--LGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLDDALHH 1389
            +L+  QH  I+ L  VY+    +++  E + GG L   I K+    E         I   + +LH + +V+RDLK  NI+ +D  G P   ++ DFG AKQ+   N   +             T  Y A ++APE+        ++  C+     G      EIL  +G G F              NW         +S+  +  +  ML  +P+ R++    L H
Sbjct:  433 LLRYGQHPNIITLKDVYDNGKQVYVVTELMRGGELLDRILKQKFFSEREASAVLHTITKTVEYLHSQGVVHRDLKPSNILYVDESGNPESLRICDFGFAKQLRADNGLLM-------------TPCYTANFVAPEVIFFSLFFKSFY-CFTPFANGPEDTPEEILSRIGSGHFTVT---------GGNWD-------AVSDSAKELVSKMLHVDPHQRLTAKQVLKH 629          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 6.106e-26
Identity = 77/249 (30.92%), Postives = 128/249 (51.41%), Query Frame = 1
Query:  700 KSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKI----SNHCQSFLENMLRFNPNSRM-SLDDAL---HHQFFRQIHWSSL 1422
            K     M ER  + ++K ++H F+V L++ +++   ++  M+Y++GG L+ H+ ++G+ PES   +Y+A I +A+ +LH  NIVYRDLK ENI+LD  G   L DFG+ K+       + H            T      YLAPE+  +     T +D W LG V+ E+L G   F S        + +  ++      +++    +N   S LE +L  +P+ R+ +  D L   +H FF  I+W+ L
Sbjct:  132 KEEKHIMAER--NVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKE-----GIDPHSTT--------CTFCGTPEYLAPEVLKKHPYDRT-VDWWCLGCVLYEMLYGLPPFYS-------KNLKQMYESILHQPLQLRPCTTNAAISVLEGLLHKDPHQRLGATSDILEIKNHVFFSTINWNDL 357          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 2.808e-25
Identity = 86/302 (28.48%), Postives = 148/302 (49.01%), Query Frame = 1
Query:  592 LEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRD---SKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLH-QKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAA---YLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK----ISNHCQSFLENMLRFNPNSRM--SLDDA---LHHQFFRQIHWSSLVY---IKPP 1440
             +Y     +G  G V  V +    +++A+K+  ++   +K   +  +   E+++L+  +H F+  L + ++T   +   MEY++GG L+ H++++    E  T +Y A I++AL +LH +KN+VYRDLK EN++LD  G  K+ DFG+ K                E     AT   +     YLAPE+    +     +D WGLG V+ E++ G   F +   EK+       ++      I+    +SN  ++ L  +L+ +P  R+   +DDA   + H FF  I W   VY   + PP
Sbjct:  150 FDYLKLLGKGTFGKVILVREKATGQYYAMKILKKEVIVAKDEVAHTLT--ENRVLQTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCK----------------EGITDGATMKTFCGTPEYLAPEVLE-DNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKL-------FELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQD-VYDRKMTPP 424          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002200.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.449 bits (254), Expect = 5.785e-24
Identity = 82/298 (27.52%), Postives = 130/298 (43.62%), Query Frame = 1
Query:  568 PTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERR-------ESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSM-PWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRM-----SLDDALHHQFFRQIHWSSL 1422
            PTS     ++   T   GG G V  V    +   FALK           +++E R       E ++L++    FIV  Y  +     +F+ ME   GG LWS +   G   E    +  AC++ AL +LH + I+YRDLK EN++LD+ G  K+ DFG AK+++             +A  +  T      Y+ PE+       +   DCW LG +V E+L G   F    P +   A      + +F    ++    +  +  + R NP+ R+      + D   H++F+   W SL
Sbjct:   26 PTSDPRAHMDVIATLGVGGFGRVQLVKLKDSDVTFALKC------LKKKFVVESRQQEHVYSEKRILQECSCPFIVRFYRTFRDQKFVFLLMEACLGGELWSVLRDSGGFQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDARGYIKMADFGFAKKLAC----------GRKAWTFCGT----PEYVCPEMIVN-RGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVHFPN--EVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDWESL 300          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 100.138 bits (248), Expect = 8.717e-24
Identity = 70/222 (31.53%), Postives = 106/222 (47.75%), Query Frame = 1
Query:  760 HNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLDDAL-HHQFFRQIHWSSL 1422
            H ++ +LY  ++T   +   MEYL+GG L  HI  KG        +Y+A I++ L  LH + I+YRDLK +NI+LD  G  K+ DFGM K+       NI    D  A  +  T      Y+APEI       N  +D W  G ++ E+L+G   F     E++    R +  +       I+   +  L  +L   P  R+ +   +  H FFR I+W +L
Sbjct:   47 HPYLAHLYSTFQTKEHLMFVMEYLNGGDLMFHIQVKGRFEIDRATFYAAEIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKE-------NI--VGDVRAGTFCGT----PDYIAPEIVI-GQKYNCSVDWWSFGVLLYEMLIGQSPFRGDDEEELFESIRTSVPYY---PRWITKDSRDILPLLLEREPMKRLGVTGEIRQHPFFRTINWEAL 251          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: mast2 (microtubule associated serine/threonine kinase 2 [Source:ZFIN;Acc:ZDB-GENE-050309-150])

HSP 1 Score: 105.916 bits (263), Expect = 9.373e-24
Identity = 81/287 (28.22%), Postives = 129/287 (44.95%), Query Frame = 1
Query:  619 GGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQ-------MLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEE--AEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLG-YGVFVSMPWEKVGADQRDN--WKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLDDAL---HHQFFRQIHWSSLVYIK 1434
            G  G V+ V   +  + FA+K      K N   +I R + Q       +L   ++ F+V ++  +ET   + M MEY++GG   + +   G LP      Y A  + AL +LH   IV+RDLK +N+++ S G  KL DFG++K   +  + N++  + E+   E           Y+APE+  R       +D W +G ++ E L+G    F   P E  G    D   W    +G   + +  Q  +  +L  NP  R+    A     HQFF  + W  L+  K
Sbjct:  223 GAYGAVYLVRHKETRQRFAMK------KINKQNLILRNQIQQAFVERDILTFAENPFVVGMFCSFETKRHLCMVMEYVEGGDCATLLKNLGALPVDMAQLYFAETVLALEYLHNYGIVHRDLKPDNLLITSMGHVKLTDFGLSKIGLMSLTTNLYEEHIEKDTREFLDKQVCGTPEYIAPEVILRQGYGKP-VDWWAMGVILYEFLVGCVPFFGDTPEELFGQVISDEIVWP---EGEDALPSDVQDLITGLLERNPLERLGTGGAFEVKQHQFFHSLDWDGLLRQK 499          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 111.309 bits (277), Expect = 7.586e-27
Identity = 67/209 (32.06%), Postives = 110/209 (52.63%), Query Frame = 1
Query:  607 TCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERR--ESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVF 1227
            T   G  G V  V    N R++A+K+ L+  +      +E    E +MLK ++H F++ ++  ++    +FM M+Y++GG L+S + K    P     +Y+A ++ AL +LH  NI+YRDLK ENI+LD  G  K+ DFG AK++  + ++ +    D               Y+APE+ +     N  +D W LG ++ E+L GY  F
Sbjct:   75 TLGTGSFGRVHLVRSVHNGRYYAIKV-LKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTV-TWTLCGTPD---------------YIAPEVITT-KPYNKSVDWWSLGVLIYEMLAGYTPF 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SCH9 (AGC family protein kinase; functional ortholog of mammalian S6 kinase; phosphorylated by Tor1p and required for TORC1-mediated regulation of ribosome biogenesis, translation initiation, and entry into G0 phase; involved in transactivation of osmostress-responsive genes; regulates G1 progression, cAPK activity and nitrogen activation of the FGM pathway; integrates nutrient signals and stress signals from sphingolipids to regulate lifespan [Source:SGD;Acc:S000001248])

HSP 1 Score: 113.62 bits (283), Expect = 1.628e-26
Identity = 91/318 (28.62%), Postives = 147/318 (46.23%), Query Frame = 1
Query:  526 STDVIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKM---KLRDSKSNSSWMIERRESQMLKKIQHN-FIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK-----ISNHCQSFLENMLRFNPNSRM-SLDDALH---HQFFRQIHWSSLVYIKPP 1440
            S D++ +W   +++         E      +G  G V+ V      R +A+K+   K+   K+  +  I  R   +    + + FIV L   ++TP  +++  +Y+ GG L+ H+ K+G   E    +Y A ++ AL HLH  +IVYRDLK ENI+LD+ G   L DFG++K   L +  N      E              YLAPE+    +     +D W LG ++ E+  G+  F +        +Q+   K  F G +K     +S   +SF++ +L  NP  R+ ++DD      H FF  I W +L   K P
Sbjct:  390 SGDILIKWTYKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSK-ADLKDRTNTFCGTTE--------------YLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAE------NNQKMYQKIAF-GKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWEALKQKKIP 685          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 108.612 bits (270), Expect = 5.852e-26
Identity = 86/291 (29.55%), Postives = 137/291 (47.08%), Query Frame = 1
Query:  574 SLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERR--ESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVF----VSMPWEKV-GADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQIHWSSLV 1425
            SL  F++    T   G  G V  +    N R++A+K+ L+         +E    E  ML  + H FI+ ++  ++    +FM M+Y++GG L+S + K    P     +Y+A +  AL +LH K+I+YRDLK ENI+LD  G  K+ DFG AK +  + ++ +    D               Y+APE+ S     N  ID W  G ++ E+L GY  F        +EK+  A+ R    FN D    +S      L   L    N +   +D  +H +F+++ W  L+
Sbjct:   83 SLQDFQI--LRTLGTGSFGRVHLIRSRHNGRYYAMKV-LKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDV-TYTLCGTPD---------------YIAPEVVST-KPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLSQRL---GNLQNGTEDVKNHPWFKEVVWEKLL 350          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 108.612 bits (270), Expect = 6.878e-26
Identity = 93/349 (26.65%), Postives = 159/349 (45.56%), Query Frame = 1
Query:  454 GRHSNVKTDEPC--ICINTEQLLYHQSTDVIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALK-------MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNH----CQSFLENMLRFNPNSRM-----SLDDALHHQFFRQIHWSSLV--YIKPP 1440
            GR+S    +E    IC+  + +L ++ T   Y          SL  F++    T   G  G V  +    N R +ALK       +KL+  +  +    ERR   ML  + H FI+ ++  ++    +FM M+Y++GG L+S + K    P     +Y+A +  AL +LH K+I+YRDLK ENI+LD  G  K+ DFG AK +  + ++ +    D               Y+APE+ S     N  +D W  G ++ E+L GY  F +       ++    ++   +  +K         Q  L+ ++  + + R+       +D  +H +F ++ W  L+  YI+ P
Sbjct:   52 GRNSGKLKEEASAGICLVKKPMLQYRDTSGKY----------SLSDFQIL--RTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTND---ERR---MLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDV-TYTLCGTPD---------------YIAPEVVST-KPYNKSVDWWSFGVLIYEMLAGYTPFYN-------SNTMKTYENILNAELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETP 358          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: FPK1 (Ser/Thr protein kinase; phosphorylates several aminophospholipid translocase family members, regulating phospholipid translocation and membrane asymmetry; phosphorylates and inhibits upstream inhibitory kinase, Ypk1p; localizes to the cytoplasm, early endosome/TGN compartments and thplasma membrane; localizes to the shmoo tip where it has a redundant role in the cellular response to mating pheromone; FPK1 has a paralog, KIN82, that arose from the whole genome duplication [Source:SGD;Acc:S000005330])

HSP 1 Score: 107.842 bits (268), Expect = 1.072e-24
Identity = 86/310 (27.74%), Postives = 144/310 (46.45%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERR-------ESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGT--LPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGM--------------AKQISLINS---FNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSR----MSLDDALHHQFFRQIHWSSLVYIKPPDLSVF 1455
            QG  G VF V + K +R +ALK+  +D       MI+R        E ++L    H FIV LYH +++   +++ MEY  GG  +  +  + T  + E    +Y++ +  AL +LH    +YRDLK ENI+L   G   L DF +              + Q +L+++    +  R N      +  T+     Y+APE+  R +     +D W LG ++ E+L G+  F      +   +   N + +F  + +IS  C+  ++ +L  N + R    M   D   H FF+++ WS L   +PP + V 
Sbjct:  504 QGDVGKVFLVREKKTNRVYALKVLSKDE------MIKRNKIKRVLTEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLSIQAKDSKVPVVKGSAQSTLVDTKICSDGFRTNS-----FVGTE----EYIAPEVI-RGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNETFTNILKN-EVSFPNNNEISRTCKDLIKKLLTKNESKRLGCKMGAADVKKHPFFKKVQWSLLRNQEPPLIPVL 796          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 130.954 bits (328), Expect = 6.320e-33
Identity = 98/316 (31.01%), Postives = 152/316 (48.10%), Query Frame = 1
Query:  559 KSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRH-----FALKMKLRDS--KSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK--------ISNHCQSFLENMLRFNPNSRMS--LDDA---LHHQFFRQIHWSSLVY--IKPP 1440
            K E    +SF+L       +GG G VF V   KN  H     FA+K+  + +  +S       + E  +L+ ++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y + I  AL HLH++ IVYRDLK ENI+LD+ G  KL DFG+ K+    NS                T      Y+APEI +R S     +D W LG ++ ++L G   F +           DN K   D  +K        ++   + F+  +L+ +P +R+     DA     H FFR I W  L+   ++PP
Sbjct:   56 KDEKVGPESFELL--KVLGKGGYGKVFLV--KKNHGHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNILECVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTACFYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLT-------------HTFCGTIEYMAPEILTR-SGHGKAVDWWSLGALMYDMLTGTPPFCA-----------DNRKKTIDKILKGKLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFRHICWEDLLAKKVEPP 342          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO31895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWM6])

HSP 1 Score: 122.094 bits (305), Expect = 3.690e-29
Identity = 90/311 (28.94%), Postives = 149/311 (47.91%), Query Frame = 1
Query:  559 KSEPTSLDSFKLEYPNTCIQGGQGVVFWV---FDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAA--YLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK----ISNHCQSFLENMLRFNPNSR-----MSLDDALHHQFFRQIHWSSLVY---IKPP 1440
            K++P+  +  K+       QG  G VF V           +A+K+  + +      M   +E  +L  +QH FIV L + ++T G +++ +++L GG L++ ++K+    E    +Y A +  AL HLH   I+YRDLK ENI+LD+ G   L DFG++K                E+EH   T  +     Y+APE+ +R   +    D W  G ++ E+L G     S+P++  G D++D         +     ++   QS L  + + NP +R     + ++D   H FF  I+W  L+Y   IKPP
Sbjct:    3 KADPSQFELLKV-----LGQGSFGKVFLVRKVIGADAGTLYAMKVLKKATLKVRDRMRTMKERDILVDVQHPFIVRLNYAFQTEGKVYLILDFLRGGDLFTRLSKEIMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPENILLDASGHVALTDFGLSK----------------ESEHDQKTYSFCGTVEYMAPEVVNRRGHSQA-ADWWSYGVLMFEMLTG-----SLPFQ--GKDRKDTMNMILKAKLGMPQFLTPEAQSLLRQLFKRNPLNRLGAGDLGIEDIKKHPFFSTINW-ELLYKREIKPP 283          

HSP 2 Score: 70.0922 bits (170), Expect = 1.456e-12
Identity = 54/198 (27.27%), Postives = 88/198 (44.44%), Query Frame = 1
Query:  658 NSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIV-LDSYGRP---KLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMP 1239
            + + +A+K+  +  K  S  M       +L+   H  IV+L   YE    +++ ME + GG L   I K   L E         + + +  LH++ +V+RDLK  NI+  D  G P   +++DFG AKQ+   N   +             T  Y A ++APE+  +    +   D W LG ++  +L G   F   P
Sbjct:  378 DGKEYAVKIFEKPKKDPSEEM-----EILLRFGHHPNIVHLRDAYEAGKQVYIVMELMRGGELLDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPESLRIVDFGFAKQMRATNGLLM-------------TPCYTANFVAPEVLKK-QGYDAACDIWSLGVLLYTMLSGLTPFAVGP 556          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 119.013 bits (297), Expect = 7.965e-29
Identity = 85/285 (29.82%), Postives = 142/285 (49.82%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNSRHFALKMKLRDS--KSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFN-FDGSIKISNHCQSFLENMLRFNPNSRMS-----LDDALHHQFFRQIHWSSLVY--IKPP 1440
            +G  G VF   + +  + +A+K+  + +  K N +  I    + +++ + H F+V L++ ++T   ++  ++Y++GG L+ H+ ++   PES   +Y+A I +A+ +LH   I+YRDLK ENI+LDS G   L DFG+ K+        I R+         +T      YLAPE+  R    +  +D W LG V+ E++ G   F S    +  A+  DN           IS   +  LE +L+ +   R+       +D   H FFR I+W  LV   I+PP
Sbjct:   82 KGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKE-------GIDRSGTT------STFCGTPEYLAPEVL-RKQDYDKSVDWWCLGAVLYEMMYGLPPFYS----RDTAEMYDNILHKPLRLRTNISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRSINWQQLVARGIEPP 348          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO47578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLB8])

HSP 1 Score: 111.309 bits (277), Expect = 9.148e-26
Identity = 88/310 (28.39%), Postives = 146/310 (47.10%), Query Frame = 1
Query:  544 EWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALK-MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGT--LPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDG---SIKISNHCQSFLENMLRFNPNSRMSL---DDALHHQFFRQIHWSSLV--YIKPP 1440
            +W   + +P +  +F+  +     +GG G V       + + +A+K ++ +  K      +   E  +L+KI   F+V+L + YET  A+ M +  ++GG L  H+   G     E   V+Y+A +   L HLH + IVYRDLK EN++LD YG  ++ D G+A QI           N E       T      Y+APE+        +  D WGLG ++ E++ G   F +   EKV  ++ +  +   D    S K +++ +S     L+ +P +R+     +D  +H FFR + W  L    I PP
Sbjct:  162 QWKWLERQPVTKKTFR--HYRVLGKGGFGEVCACQSKISGKMYAMKKLEKKRIKRRKGEAMALNEKTLLEKIDSIFVVSLAYAYETKDALCMVLTLMNGGDLKFHVHNMGNPGFEEERAVFYAAQVTLGLIHLHSQRIVYRDLKPENLLLDDYGHVRISDLGLAVQI----------RNGETIRGRVGT----IGYMAPEVVKNERYTFS-PDWWGLGCLIYEMIQGKSPFRARK-EKVKREEVER-RVKEDQETYSDKFTSYARSICVQTLQKDPTNRLGCKEDEDIRNHPFFRSVLWKQLEAGLIPPP 452          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO44938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU22])

HSP 1 Score: 110.923 bits (276), Expect = 1.521e-25
Identity = 102/352 (28.98%), Postives = 157/352 (44.60%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNSRHFALKM---KLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVG-ADQRDN------WKFNFDGSIKI----SNHCQSFLENMLRFNPNSRM------SLDDALHHQFFRQIHWSSLVY--IKPPDLSVFRRRTKGS-GI-----------IQAVPNDISNVSTI--FEFCDLQLPDPLL 1563
            +G    V  V   K  R +A+K+   +L +   +  W ++  +    +   H F+V L+  ++T   +F  +EY+ GG L  H+ ++  LPE +  +YSA I  AL  LH+K ++YRDLK +N++LDS G  KL D+GM K+          R  D       +T      Y+APEI  R       +D W LG ++ E+L G       P++ VG AD  D       ++   +  I+I    S    S L+  L  NP  R+         D   H FFR + W  L    + PP    F+ R +   G+           +Q  P+D   + TI   EF   +  +PLL
Sbjct:  230 RGSYAKVMLVELKKTKRIYAMKVVKKELVNDDEDIDW-VQTEKHVFEQASNHPFLVGLHSCFQTSSRLFFVIEYVSGGDLMYHMQRQRRLPEDHARFYSAEICCALNFLHEKGVIYRDLKLDNVLLDSDGHIKLTDYGMCKEGI--------RPGD-----VTSTFCGTPNYIAPEIL-RGEDYGFSVDWWALGVLLYEMLAGRS-----PFDIVGSADNPDQNTEDYLFQVILEKPIRIPRSLSVKAASILKGYLNKNPTERLGCHPQTGFADITSHAFFRTVSWEQLEARQVTPP----FKPRQEDPYGLENFDPQFTNEDVQFTPDDPKMLETIDQTEFEGFEYINPLL 557          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: rps6kb1b (ribosomal protein S6 kinase beta-1-like [Source:NCBI gene;Acc:101174764])

HSP 1 Score: 135.576 bits (340), Expect = 1.191e-33
Identity = 97/290 (33.45%), Postives = 148/290 (51.03%), Query Frame = 1
Query:  616 QGGQGVVFWV---FDTKNSRHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSL--DDALH---HQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V         + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+S G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+   +SR+     DA     H FFR I+W  L+   ++PP
Sbjct:   51 KGGYGKVFQVRKVVGAAAGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNSQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKRLLKRTASSRLGAGPGDATEVQAHPFFRHINWEDLLARKVEPP 320          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: rps6kb1b (ribosomal protein S6 kinase beta-1-like [Source:NCBI gene;Acc:101174764])

HSP 1 Score: 134.42 bits (337), Expect = 4.668e-33
Identity = 97/290 (33.45%), Postives = 148/290 (51.03%), Query Frame = 1
Query:  616 QGGQGVVFWV---FDTKNSRHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSL--DDALH---HQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V         + FA+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+S G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F     +K   D+    K N      ++   +  L+ +L+   +SR+     DA     H FFR I+W  L+   ++PP
Sbjct:   78 KGGYGKVFQVRKVVGAAAGKIFAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNSQGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKT-IDKILKCKLNL--PPYLTQEARDLLKRLLKRTASSRLGAGPGDATEVQAHPFFRHINWEDLLARKVEPP 347          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: prkg3 (protein kinase cGMP-dependent 3 [Source:ZFIN;Acc:ZDB-GENE-030131-4745])

HSP 1 Score: 128.642 bits (322), Expect = 3.107e-32
Identity = 92/348 (26.44%), Postives = 167/348 (47.99%), Query Frame = 1
Query:  472 KTDEPCICINTEQLLYHQSTDVIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERR-------ESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK----ISNHCQSFLENMLRFNPNSRM-----SLDDALHHQFFRQIHWSSLVY--IKPPDLSVFRR 1461
            + + P   + +  L +     V+Y+  +F+ +P +L             GG G V  +   K+ +++A+K   R SK     ++ +R       E ++LK IQ +FIV LY  ++    ++M M++  GG +W+ + + G   E   V+ +AC++ A  +LH+KNI+YRDLK EN++LD  G  KL+DFG AK++             ++   +  T      Y+APEI  +    +  +D W LG ++ E+L G   F S   +K+ A          DG +K    ++   +S +  + R  P  R+      + +  HH++F  ++W  L    ++ P + + R+
Sbjct:    3 EAETPAKSLPSSTLRFKDLVPVLYQEGRFQGDPVTLGV-----------GGFGRVELMTTIKHGKYYAMK---RVSKKQ---IVAKRQEEHMLFEKKILKAIQCDFIVRLYSTFKDTRYIYMVMDFCSGGEIWTKLKEVGRFDEPIAVFCTACVVEAYAYLHKKNIMYRDLKPENLMLDQRGYIKLVDFGFAKELM----------RGDKTYSFVGT----PEYMAPEII-KNQGHDFAVDFWSLGILIFELLAGSPPFSSSEPQKIYAK-------ILDGELKYPPYMNEAAKSIISKLCRPRPGQRLGNTKNGIKEVRHHRWFGNMNWHKLRLGQLEAPTVRLIRK 311          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: rps6kb1a (ribosomal protein S6 kinase beta-1 [Source:NCBI gene;Acc:101174287])

HSP 1 Score: 130.568 bits (327), Expect = 7.059e-32
Identity = 95/298 (31.88%), Postives = 149/298 (50.00%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK--------ISNHCQSFLENMLRFNPNSRM--SLDDALH---HQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V     +   + +A+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F             +N K   D  +K        ++   +  L+ +L+ + +SR+     DA     H FFR I+W  L+   ++PP
Sbjct:   47 KGGYGKVFQVRKVSGASSGKIYAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNDSGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTG-----------ENRKKTIDKILKCKLSLPPYLTQEARDLLKKLLKRSASSRLGGGPGDAAEVQVHPFFRHINWDDLLARKVEPP 316          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: rps6kb1a (ribosomal protein S6 kinase beta-1 [Source:NCBI gene;Acc:101174287])

HSP 1 Score: 130.183 bits (326), Expect = 1.035e-31
Identity = 95/298 (31.88%), Postives = 149/298 (50.00%), Query Frame = 1
Query:  616 QGGQGVVFWVFDTKNS---RHFALK-----MKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIK--------ISNHCQSFLENMLRFNPNSRM--SLDDALH---HQFFRQIHWSSLVY--IKPP 1440
            +GG G VF V     +   + +A+K     M +R++K  +    ER    +L++++H FIV+L + ++T G +++ +EYL GG L+  + ++G   E    +Y A I  AL HLHQK I+YRDLK ENI+L+  G  KL DFG+ K+       +IH   D    H   T      Y+APEI  R S  N  +D W LG ++ ++L G   F             +N K   D  +K        ++   +  L+ +L+ + +SR+     DA     H FFR I+W  L+   ++PP
Sbjct:   57 KGGYGKVFQVRKVSGASSGKIYAMKVLKKAMIVRNAKDTAHTKAER---NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNDSGHVKLTDFGLCKE-------SIH---DGTVTH---TFCGTIEYMAPEILMR-SGHNRAVDWWSLGALMYDMLTGAPPFTG-----------ENRKKTIDKILKCKLSLPPYLTQEARDLLKKLLKRSASSRLGGGPGDAAEVQVHPFFRHINWDDLLARKVEPP 326          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000018940.1 (SMESG000018940.1)

HSP 1 Score: 826.239 bits (2133), Expect = 0.000e+0
Identity = 397/397 (100.00%), Postives = 397/397 (100.00%), Query Frame = 1
Query:   34 MNSFQNLSKRIRKRIQNSVKRLFTSKSSFDDNNIPSNVFINDSTAGDKRQSSIDSGKSFSSVDQEHDEKIQRLNKKGLSLTKSNRQCAPVQSGEEISIKEIRKSDIVKYSSISNEIKSNITKTTSRSQSDKSKTYYDCPTGRHSNVKTDEPCICINTEQLLYHQSTDVIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGV 1224
            MNSFQNLSKRIRKRIQNSVKRLFTSKSSFDDNNIPSNVFINDSTAGDKRQSSIDSGKSFSSVDQEHDEKIQRLNKKGLSLTKSNRQCAPVQSGEEISIKEIRKSDIVKYSSISNEIKSNITKTTSRSQSDKSKTYYDCPTGRHSNVKTDEPCICINTEQLLYHQSTDVIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGV
Sbjct:    1 MNSFQNLSKRIRKRIQNSVKRLFTSKSSFDDNNIPSNVFINDSTAGDKRQSSIDSGKSFSSVDQEHDEKIQRLNKKGLSLTKSNRQCAPVQSGEEISIKEIRKSDIVKYSSISNEIKSNITKTTSRSQSDKSKTYYDCPTGRHSNVKTDEPCICINTEQLLYHQSTDVIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGV 397          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000018940.1 (SMESG000018940.1)

HSP 1 Score: 822.002 bits (2122), Expect = 0.000e+0
Identity = 396/400 (99.00%), Postives = 396/400 (99.00%), Query Frame = 1
Query:   25 TINMNSFQNLSKRIRKRIQNSVKRLFTSKSSFDDNNIPSNVFINDSTAGDKRQSSIDSGKSFSSVDQEHDEKIQRLNKKGLSLTKSNRQCAPVQSGEEISIKEIRKSDIVKYSSISNEIKSNITKTTSRSQSDKSKTYYDCPTGRHSNVKTDEPCICINTEQLLYHQSTDVIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGV 1224
             I   SFQNLSKRIRKRIQNSVKRLFTSKSSFDDNNIPSNVFINDSTAGDKRQSSIDSGKSFSSVDQEHDEKIQRLNKKGLSLTKSNRQCAPVQSGEEISIKEIRKSDIVKYSSISNEIKSNITKTTSRSQSDKSKTYYDCPTGRHSNVKTDEPCICINTEQLLYHQSTDVIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGV
Sbjct:   38 VIVTKSFQNLSKRIRKRIQNSVKRLFTSKSSFDDNNIPSNVFINDSTAGDKRQSSIDSGKSFSSVDQEHDEKIQRLNKKGLSLTKSNRQCAPVQSGEEISIKEIRKSDIVKYSSISNEIKSNITKTTSRSQSDKSKTYYDCPTGRHSNVKTDEPCICINTEQLLYHQSTDVIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGVVFWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGV 437          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000018943.1 (SMESG000018943.1)

HSP 1 Score: 342.813 bits (878), Expect = 6.180e-115
Identity = 165/180 (91.67%), Postives = 167/180 (92.78%), Query Frame = 1
Query: 1234 MPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQIHWSSLVYIKPPDLSVFRRRTKGSGIIQAVPNDISNVSTIFEFCDLQLPDPLLTPSFNNQCNATYVDVASPKDTPINPNAPSIRMPILVKKENYNYIKYNRISNNFKYDIYRTINIHSAQKKK 1773
            MPWEKVGADQRDNWKFNFDGSIKI      F ENMLRFNPNSRMSLDDALHHQFFRQIHWSSLVYIKPPDLSVFRRRTKGSGIIQAVPNDISNVSTIFEFCDLQLPDPLLTPSFNNQCNATYVDVASPKDTPINPNAPSIRMPILVKKENYNYIKYNRISNNFKYDIYRTI      +K+
Sbjct:    1 MPWEKVGADQRDNWKFNFDGSIKIRIIANRFFENMLRFNPNSRMSLDDALHHQFFRQIHWSSLVYIKPPDLSVFRRRTKGSGIIQAVPNDISNVSTIFEFCDLQLPDPLLTPSFNNQCNATYVDVASPKDTPINPNAPSIRMPILVKKENYNYIKYNRISNNFKYDIYRTIQYSQCPEKE 180          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000018949.1 (SMESG000018949.1)

HSP 1 Score: 317.005 bits (811), Expect = 2.232e-105
Identity = 149/149 (100.00%), Postives = 149/149 (100.00%), Query Frame = 1
Query: 1234 MPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQIHWSSLVYIKPPDLSVFRRRTKGSGIIQAVPNDISNVSTIFEFCDLQLPDPLLTPSFNNQCNATYVDVASPKDTPINPNAPSIRMPILVKKE 1680
            MPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQIHWSSLVYIKPPDLSVFRRRTKGSGIIQAVPNDISNVSTIFEFCDLQLPDPLLTPSFNNQCNATYVDVASPKDTPINPNAPSIRMPILVKKE
Sbjct:    1 MPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLDDALHHQFFRQIHWSSLVYIKPPDLSVFRRRTKGSGIIQAVPNDISNVSTIFEFCDLQLPDPLLTPSFNNQCNATYVDVASPKDTPINPNAPSIRMPILVKKE 149          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000068122.1 (SMESG000068122.1)

HSP 1 Score: 134.035 bits (336), Expect = 1.797e-33
Identity = 92/295 (31.19%), Postives = 151/295 (51.19%), Query Frame = 1
Query:  616 QGGQGVVFW---VFDTKNSRHFALKM----KLRDSKSNSS--WMIERRESQMLKKIQHNFIVNLYHVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHLHQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEAEHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVSMPWEKVGADQRDNWKFNFDGSIKI----SNHCQSFLENMLRFNPNSRMS-----LDDALHHQFFRQIHWSSLVY--IKPP 1440
            +GG G VF    V       +FA+K+    +L  +K N +   M ER    +L+ + H F+V LY  ++T  ++F+ +EYL GG L+  + ++ TL E    +Y A    AL HLH   ++YRDLK+EN++LD YG  KL DFG++K+          RN+DE    +  T      Y+APEI  R     + +D W +G ++ ++L+G   F       VG ++    +   +  +KI    ++  +  L+N+L  NP +R+      +++   H FFR I+W   +   +KPP
Sbjct:   77 KGGYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTER---NILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKE----------RNDDELTHSFCGT----VEYMAPEILQRRGHGPS-VDWWSMGILLYDMLIGNSPF-------VGGNRSQVIQKVTNAKLKIPRFLTDSGKHLLKNLLNKNPKARLGGGEKDVEEIKRHFFFRSINWDKALARELKPP 346          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPS6KB16.999e-3332.76ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
RPS6KB19.485e-3332.76ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
RPS6KB11.719e-3232.76ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
RPS6KB18.135e-3131.64ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
RPS6KB23.002e-3029.53ribosomal protein S6 kinase B2 [Source:HGNC Symbol... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsks-18.728e-3029.93Ribosomal protein S6 kinase beta [Source:UniProtK... [more]
R04A9.74.656e-2726.57pep chromosome:WBcel235:X:391360:394828:-1 gene:WB... [more]
sgk-16.375e-2726.69Serine/threonine-protein kinase sgk-1 [Source:Uni... [more]
sgk-18.309e-2726.74Serine/threonine-protein kinase sgk-1 [Source:Uni... [more]
rskn-11.762e-2628.66Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
S6k8.231e-3127.43gene:FBgn0283472 transcript:FBtr0077114[more]
S6k8.231e-3127.43gene:FBgn0283472 transcript:FBtr0333264[more]
S6kII1.585e-2426.97gene:FBgn0262866 transcript:FBtr0333715[more]
S6kII1.585e-2426.97gene:FBgn0262866 transcript:FBtr0077360[more]
aPKC1.720e-2429.53gene:FBgn0261854 transcript:FBtr0303434[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps6kb1b1.115e-3232.76ribosomal protein S6 kinase b, polypeptide 1b [Sou... [more]
rps6kb1a3.682e-3232.76ribosomal protein S6 kinase b, polypeptide 1a [Sou... [more]
BX000486.13.866e-3232.76ribosomal protein S6 kinase b, polypeptide 1a [Sou... [more]
prkg32.171e-3127.50protein kinase cGMP-dependent 3 [Source:ZFIN;Acc:Z... [more]
prkg38.999e-3127.50protein kinase cGMP-dependent 3 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l3hypdh1.011e-3333.10L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh1.377e-3333.10L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh1.429e-3333.10L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh1.479e-3333.10L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh1.646e-3333.10L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rps6kb11.357e-3232.76ribosomal protein S6 kinase, polypeptide 1 [Source... [more]
Rps6kb25.614e-3131.44ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
Rps6kb25.614e-3131.44ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
Rps6kb26.081e-3131.44ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
Rps6kb26.081e-3131.44ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8MYF1|Y2070_DICDI3.788e-3230.74Probable serine/threonine-protein kinase DDB_G0277... [more]
sp|P67998|KS6B1_RABIT7.111e-3232.76Ribosomal protein S6 kinase beta-1 OS=Oryctolagus ... [more]
sp|Q6TJY3|KS6B1_BOVIN7.755e-3232.76Ribosomal protein S6 kinase beta-1 OS=Bos taurus O... [more]
sp|P67999|KS6B1_RAT8.101e-3232.76Ribosomal protein S6 kinase beta-1 OS=Rattus norve... [more]
sp|P23443|KS6B1_HUMAN8.253e-3232.76Ribosomal protein S6 kinase beta-1 OS=Homo sapiens... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YSA72.545e-10944.50Serine threonine protein kinase nrc OS=Fasciola gi... [more]
A0A4E0RWR36.566e-10943.59Serine threonine protein kinase nrc OS=Fasciola he... [more]
A0A183A8A52.663e-10744.82Protein kinase domain-containing protein OS=Echino... [more]
A0A1S8X8R95.091e-10544.47Kinase domain protein OS=Opisthorchis viverrini OX... [more]
A0A075A4H27.145e-10544.47Protein kinase domain-containing protein OS=Opisth... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps6kb1b9.719e-3333.10ribosomal protein S6 kinase B1 [Source:NCBI gene;A... [more]
rps6kb1b9.826e-3333.10ribosomal protein S6 kinase B1 [Source:NCBI gene;A... [more]
ENSAMXT00000004157.22.251e-3230.67ribosomal protein S6 kinase B2 [Source:NCBI gene;A... [more]
rps6ka22.026e-3028.25ribosomal protein S6 kinase A2 [Source:NCBI gene;A... [more]
rps6ka18.148e-2927.17ribosomal protein S6 kinase a, polypeptide 1 [Sour... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006766.16.106e-2630.92pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
ENSPMAT00000008480.12.808e-2528.48pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
ENSPMAT00000002200.15.785e-2427.52pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 ... [more]
PRKCD8.717e-2431.53protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
mast29.373e-2428.22microtubule associated serine/threonine kinase 2 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK27.586e-2732.06cAMP-dependent protein kinase catalytic subunit; p... [more]
SCH91.628e-2628.62AGC family protein kinase; functional ortholog of ... [more]
TPK15.852e-2629.55cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK36.878e-2626.65cAMP-dependent protein kinase catalytic subunit; p... [more]
FPK11.072e-2427.74Ser/Thr protein kinase; phosphorylates several ami... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO411666.320e-3331.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318953.690e-2928.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378007.965e-2929.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475789.148e-2628.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449381.521e-2528.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps6kb1b1.191e-3333.45ribosomal protein S6 kinase beta-1-like [Source:NC... [more]
rps6kb1b4.668e-3333.45ribosomal protein S6 kinase beta-1-like [Source:NC... [more]
prkg33.107e-3226.44protein kinase cGMP-dependent 3 [Source:ZFIN;Acc:Z... [more]
rps6kb1a7.059e-3231.88ribosomal protein S6 kinase beta-1 [Source:NCBI ge... [more]
rps6kb1a1.035e-3131.88ribosomal protein S6 kinase beta-1 [Source:NCBI ge... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018940.10.000e+0100.00SMESG000018940.1[more]
SMESG000018940.10.000e+099.00SMESG000018940.1[more]
SMESG000018943.16.180e-11591.67SMESG000018943.1[more]
SMESG000018949.12.232e-105100.00SMESG000018949.1[more]
SMESG000068122.11.797e-3331.19SMESG000068122.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035285 ID=SMED30035285|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2014bp
TAATTAAAACTATCTATTACATTTACAATTAATATGAATAGTTTTCAAAA
CCTGAGTAAGCGGATAAGGAAAAGAATACAAAATTCTGTTAAACGACTTT
TTACATCTAAGTCATCATTCGACGACAATAACATACCCTCAAACGTTTTC
ATTAACGATAGCACTGCTGGAGATAAAAGACAGTCTAGTATTGACAGTGG
TAAAAGTTTCTCTTCCGTTGATCAGGAGCATGATGAAAAAATTCAAAGAC
TTAACAAAAAAGGATTAAGTTTGACAAAATCTAATAGACAATGTGCTCCT
GTGCAGTCAGGCGAAGAAATCAGCATCAAAGAAATTAGAAAAAGTGATAT
TGTCAAATATTCATCTATATCAAATGAGATAAAATCAAACATAACTAAAA
CAACATCAAGATCTCAGAGCGATAAATCTAAAACGTACTATGACTGTCCA
ACTGGTCGTCATTCAAATGTAAAAACGGATGAACCTTGTATTTGCATTAA
CACTGAACAATTATTGTATCACCAGTCGACTGATGTCATTTACGAATGGC
ACAAATTCAAAAGTGAACCAACATCATTGGATTCATTCAAACTGGAATAT
CCAAATACTTGCATACAAGGTGGTCAAGGTGTTGTTTTTTGGGTTTTTGA
TACGAAAAATAGTCGGCACTTTGCATTGAAAATGAAACTTCGTGATAGTA
AAAGCAATAGCTCGTGGATGATTGAAAGAAGAGAATCTCAAATGCTGAAA
AAAATACAACATAATTTCATTGTCAACTTATACCATGTTTATGAAACTCC
AGGTGCAATGTTTATGACTATGGAATATTTAGACGGGGGATGCCTATGGA
GCCACATTGCTAAAAAAGGCACATTACCAGAAAGTTACACAGTTTACTAT
TCTGCGTGCATTTTAAACGCCCTCTATCATTTACACCAAAAGAATATAGT
TTATAGAGATTTAAAAGCGGAAAATATTGTCTTGGATTCATATGGTCGAC
CAAAATTAATTGACTTTGGAATGGCAAAACAAATTTCACTTATAAATAGT
TTCAATATCCATAGAAATAATGATGAAGAAGCTGAGCACTACCCAGCGAC
GCAGTACTATTATGCTGCCTACTTGGCACCCGAAATATATTCAAGGCCCA
GTAGTGCTAATACATACATTGATTGCTGGGGCCTTGGTTATGTAGTTTCC
GAAATTTTGCTAGGATATGGAGTTTTTGTGTCAATGCCATGGGAAAAAGT
TGGTGCCGATCAAAGAGATAATTGGAAATTTAATTTTGATGGTAGTATTA
AAATTTCGAATCATTGCCAATCGTTTCTTGAAAACATGCTCAGATTCAAT
CCGAATTCCAGGATGTCGCTAGATGATGCACTTCACCATCAATTCTTCAG
ACAAATTCATTGGTCGTCTTTGGTCTATATCAAACCTCCTGATCTCTCAG
TTTTCCGTCGAAGAACGAAAGGCTCCGGAATTATTCAAGCCGTTCCAAAT
GACATTAGCAACGTGTCAACGATCTTTGAGTTCTGCGATTTACAGCTTCC
TGATCCTTTGCTAACGCCGAGTTTCAACAATCAATGCAATGCCACTTATG
TTGATGTTGCGTCACCAAAAGATACTCCAATTAATCCAAATGCACCTTCG
ATTCGAATGCCAATTTTAGTGAAAAAAGAAAACTACAATTACATAAAGTA
CAACAGAATTTCCAACAACTTCAAGTACGACATCTACCGGACAATCAATA
TTCACAGTGCCCAGAAAAAGAAATTCGATGTTGATACGATCAGCAATTTG
AGGCCCCTTAAAAGATATTGAAATGAAGAAAACACCAAAAATATTTTAGA
AAAAAATGTGAATCAATTTTTTAATTGATATATAAAATAGCGCGGTTTTT
AATCATTTCATTAATTATGAATTCATTGAAAATAGTCATTTGAAACCTCT
GTATTTTATCTGTGGAAATTCTTTCAAATGATAAAATTAACCTTAAATGT
TATTTTTATCGATA
back to top

protein sequence of SMED30035285-orf-1

>SMED30035285-orf-1 ID=SMED30035285-orf-1|Name=SMED30035285-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=596bp
MNSFQNLSKRIRKRIQNSVKRLFTSKSSFDDNNIPSNVFINDSTAGDKRQ
SSIDSGKSFSSVDQEHDEKIQRLNKKGLSLTKSNRQCAPVQSGEEISIKE
IRKSDIVKYSSISNEIKSNITKTTSRSQSDKSKTYYDCPTGRHSNVKTDE
PCICINTEQLLYHQSTDVIYEWHKFKSEPTSLDSFKLEYPNTCIQGGQGV
VFWVFDTKNSRHFALKMKLRDSKSNSSWMIERRESQMLKKIQHNFIVNLY
HVYETPGAMFMTMEYLDGGCLWSHIAKKGTLPESYTVYYSACILNALYHL
HQKNIVYRDLKAENIVLDSYGRPKLIDFGMAKQISLINSFNIHRNNDEEA
EHYPATQYYYAAYLAPEIYSRPSSANTYIDCWGLGYVVSEILLGYGVFVS
MPWEKVGADQRDNWKFNFDGSIKISNHCQSFLENMLRFNPNSRMSLDDAL
HHQFFRQIHWSSLVYIKPPDLSVFRRRTKGSGIIQAVPNDISNVSTIFEF
CDLQLPDPLLTPSFNNQCNATYVDVASPKDTPINPNAPSIRMPILVKKEN
YNYIKYNRISNNFKYDIYRTINIHSAQKKKFDVDTISNLRPLKRY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity