RING-type domain-containing protein

Overview
NameRING-type domain-containing protein
Smed IDSMED30035284
Length (bp)762
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-type domain-containing protein (SMED30035284) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30035284) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-type domain-containing protein (SMED30035284) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30035284) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035284

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 29

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30035284h1SMcG0001679 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30035284h1SMcG0001679 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30035284h1SMcG0001679 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035284h1SMcG0001679 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30035284h1SMcG0001677 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30035284h1SMcG0001677 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30035284h1SMcG0001677 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035284h1SMcG0001677 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30035284h1SMcG0001680 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30035284h1SMcG0001680 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30035284h1SMcG0001680 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035284h1SMcG0001680 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30035284h1SMcG0001678 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30035284h1SMcG0001678 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30035284h1SMcG0001678 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035284h1SMcG0001678 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30035284h1SMcG0001676 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30035284h1SMcG0001676 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30035284h1SMcG0001676 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035284h1SMcG0001676 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30035284h1SMcG0001675 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30035284h1SMcG0001675 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30035284h1SMcG0001675 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035284h1SMcG0001675 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30035284h1SMcG0008328 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30035284h1SMcG0008328 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30035284h1SMcG0008328 Contig651uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035284h1SMcG0008328 Contig651newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30035284h1SMcG0008328 dd_Smed_v4_5906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RLIM (ring finger protein, LIM domain interacting [Source:HGNC Symbol;Acc:HGNC:13429])

HSP 1 Score: 55.4546 bits (132), Expect = 2.960e-8
Identity = 25/71 (35.21%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  349 RVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVV 561
            R +T EQID+L         +  ++CS+C +E+TE    ++ L C H++H  C+ +WL +   CP+CR  V
Sbjct:  546 RGLTKEQIDNLAMRSFGEN-DALKTCSVCITEYTEG-NKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAV 614          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RLIM (ring finger protein, LIM domain interacting [Source:HGNC Symbol;Acc:HGNC:13429])

HSP 1 Score: 55.4546 bits (132), Expect = 2.960e-8
Identity = 25/71 (35.21%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  349 RVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVV 561
            R +T EQID+L         +  ++CS+C +E+TE    ++ L C H++H  C+ +WL +   CP+CR  V
Sbjct:  546 RGLTKEQIDNLAMRSFGEN-DALKTCSVCITEYTEG-NKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAV 614          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RNF139 (ring finger protein 139 [Source:HGNC Symbol;Acc:HGNC:17023])

HSP 1 Score: 55.4546 bits (132), Expect = 3.130e-8
Identity = 31/87 (35.63%), Postives = 46/87 (52.87%), Query Frame = 1
Query:  343 LNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFS--TKTNNNNDN 597
            +NR    ++I+SLP I  S     ++ C+IC+ EFT +    ++  C H FH  CL+KWL  +  CP+C   V      K N+N  N
Sbjct:  520 MNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSA---RITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSN 603          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: ZNRF3 (zinc and ring finger 3 [Source:HGNC Symbol;Acc:HGNC:18126])

HSP 1 Score: 54.299 bits (129), Expect = 7.760e-8
Identity = 18/44 (40.91%), Postives = 30/44 (68.18%), Query Frame = 1
Query:  424 CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRH 555
            C+IC  ++ +   +++++ C H+FH+ C+  WLLQ H CP CRH
Sbjct:  293 CAICLEKYIDG-EELRVIPCTHRFHRKCVDPWLLQHHTCPHCRH 335          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: ZNRF3 (zinc and ring finger 3 [Source:HGNC Symbol;Acc:HGNC:18126])

HSP 1 Score: 54.299 bits (129), Expect = 8.158e-8
Identity = 18/44 (40.91%), Postives = 30/44 (68.18%), Query Frame = 1
Query:  424 CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRH 555
            C+IC  ++ +   +++++ C H+FH+ C+  WLLQ H CP CRH
Sbjct:  193 CAICLEKYIDG-EELRVIPCTHRFHRKCVDPWLLQHHTCPHCRH 235          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: plr-1 (Probable E3 ubiquitin-protein ligase plr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2B7])

HSP 1 Score: 56.225 bits (134), Expect = 6.179e-9
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = 1
Query:  376 SLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCR 552
            SL ++  S+  +  E C IC  E+ E   ++++L CGH+FH  C+  WLL K  CP+C+
Sbjct:  301 SLTSVAQSSSHSAQERCVICLEEYEEG-TELRVLFCGHEFHPKCVDPWLLSKRRCPLCQ 358          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: rnf-145 (RiNg Finger protein [Source:UniProtKB/TrEMBL;Acc:Q95Y82])

HSP 1 Score: 52.7582 bits (125), Expect = 9.839e-8
Identity = 28/81 (34.57%), Postives = 41/81 (50.62%), Query Frame = 1
Query:  307 NRLFQTGNFTNNLNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVC 549
             RL  T +F  N N  +  + I+ L   D+      ++ C+ICF E  E   + ++  C H FH  CL+KWL  K  CP+C
Sbjct:  555 KRLEHTVSFIKNRNAAV--KNINRLSKADVVQLREREDVCAICFIEMKE---EARITPCKHYFHGPCLRKWLAVKMVCPLC 630          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: hrdl-1 (E3 ubiquitin-protein ligase hrd-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P90859])

HSP 1 Score: 49.6766 bits (117), Expect = 9.558e-7
Identity = 21/51 (41.18%), Postives = 26/51 (50.98%), Query Frame = 1
Query:  400 NCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCR 552
             C N D+ C +C+    E +   + L C HQFH  CL  WL Q   CP CR
Sbjct:  342 KCANGDDRCVVCW----ELLGTSRRLPCSHQFHDWCLMWWLAQDSSCPTCR 388          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: trul-1 (pep chromosome:WBcel235:II:279128:282576:-1 gene:WBGene00015194.1 transcript:B0432.13.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:trul-1)

HSP 1 Score: 48.1358 bits (113), Expect = 2.915e-6
Identity = 19/47 (40.43%), Postives = 27/47 (57.45%), Query Frame = 1
Query:  421 SCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVV 561
            SCSICF +  +    I  + CGH +H  C+ +W+  K +CP CR  V
Sbjct:   12 SCSICFEDLKQN-DKISAIVCGHIYHHGCISQWIATKRQCPSCRRTV 57          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: trul-1 (pep chromosome:WBcel235:II:278621:282576:-1 gene:WBGene00015194.1 transcript:B0432.13.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:trul-1)

HSP 1 Score: 48.1358 bits (113), Expect = 2.915e-6
Identity = 19/47 (40.43%), Postives = 27/47 (57.45%), Query Frame = 1
Query:  421 SCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVV 561
            SCSICF +  +    I  + CGH +H  C+ +W+  K +CP CR  V
Sbjct:   12 SCSICFEDLKQN-DKISAIVCGHIYHHGCISQWIATKRQCPSCRRTV 57          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: Trc8 (gene:FBgn0039668 transcript:FBtr0333188)

HSP 1 Score: 58.151 bits (139), Expect = 2.087e-9
Identity = 23/74 (31.08%), Postives = 39/74 (52.70%), Query Frame = 1
Query:  367 QIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNN 588
            +I +LP    +    +D+ C+IC+ E        K+  C H FH  CL+KWL  +  CP+C  ++ ++ K + N
Sbjct:  597 KISALPEATPAQLQAFDDVCAICYQEMYSA----KITRCRHFFHGVCLRKWLYVQDRCPLCHEIMMYTDKADEN 666          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: Trc8 (gene:FBgn0039668 transcript:FBtr0085430)

HSP 1 Score: 58.151 bits (139), Expect = 2.087e-9
Identity = 23/74 (31.08%), Postives = 39/74 (52.70%), Query Frame = 1
Query:  367 QIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNN 588
            +I +LP    +    +D+ C+IC+ E        K+  C H FH  CL+KWL  +  CP+C  ++ ++ K + N
Sbjct:  597 KISALPEATPAQLQAFDDVCAICYQEMYSA----KITRCRHFFHGVCLRKWLYVQDRCPLCHEIMMYTDKADEN 666          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: Trc8 (gene:FBgn0039668 transcript:FBtr0085429)

HSP 1 Score: 58.151 bits (139), Expect = 2.087e-9
Identity = 23/74 (31.08%), Postives = 39/74 (52.70%), Query Frame = 1
Query:  367 QIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNN 588
            +I +LP    +    +D+ C+IC+ E        K+  C H FH  CL+KWL  +  CP+C  ++ ++ K + N
Sbjct:  597 KISALPEATPAQLQAFDDVCAICYQEMYSA----KITRCRHFFHGVCLRKWLYVQDRCPLCHEIMMYTDKADEN 666          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: Trc8 (gene:FBgn0039668 transcript:FBtr0085432)

HSP 1 Score: 58.151 bits (139), Expect = 2.090e-9
Identity = 23/74 (31.08%), Postives = 39/74 (52.70%), Query Frame = 1
Query:  367 QIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNN 588
            +I +LP    +    +D+ C+IC+ E        K+  C H FH  CL+KWL  +  CP+C  ++ ++ K + N
Sbjct:  602 KISALPEATPAQLQAFDDVCAICYQEMYSA----KITRCRHFFHGVCLRKWLYVQDRCPLCHEIMMYTDKADEN 671          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: mura (gene:FBgn0037705 transcript:FBtr0082116)

HSP 1 Score: 54.299 bits (129), Expect = 4.125e-8
Identity = 27/70 (38.57%), Postives = 40/70 (57.14%), Query Frame = 1
Query:  349 RVITDEQIDSLPTIDISNCV-NYDES-CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCR 552
            R +T  +ID LP+   +  V N D+S C +C  +F E    +++L C H+FH  C+ KWL     CP+CR
Sbjct:  745 RGLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDF-ELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICR 813          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: rnf139 (ring finger protein 139 [Source:ZFIN;Acc:ZDB-GENE-080401-4])

HSP 1 Score: 57.7658 bits (138), Expect = 3.222e-9
Identity = 32/97 (32.99%), Postives = 53/97 (54.64%), Query Frame = 1
Query:  343 LNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNNNDNEKRTFSSILNNG 633
            +NR    ++I+SLP +  S   + ++ C+IC+ EF  +    ++  C H FH  CL+KWL  +  CP+C   V        ++ +E+ TFS+  NNG
Sbjct:  510 INRRTAVKKINSLPEVRGSRLRDIEDVCAICYQEFGSSA---RITPCSHYFHALCLRKWLYIQDTCPMCHQRVYI-----EDDTSERSTFSN--NNG 596          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: rlim (ring finger protein, LIM domain interacting [Source:ZFIN;Acc:ZDB-GENE-120809-2])

HSP 1 Score: 57.7658 bits (138), Expect = 3.331e-9
Identity = 29/80 (36.25%), Postives = 44/80 (55.00%), Query Frame = 1
Query:  349 RVITDEQIDSLPTIDISNCVNYDES-----CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFST 573
            R +T EQID+L      +  N+ ES     CS+C +E+ E    ++ L C H++H  C+ +WL +   CP+CR  V  ST
Sbjct:  560 RGLTKEQIDNL------SMRNFGESDAFKTCSVCITEYAEG-NKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLIST 632          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: rlim (ring finger protein, LIM domain interacting [Source:ZFIN;Acc:ZDB-GENE-120809-2])

HSP 1 Score: 57.7658 bits (138), Expect = 3.331e-9
Identity = 29/80 (36.25%), Postives = 44/80 (55.00%), Query Frame = 1
Query:  349 RVITDEQIDSLPTIDISNCVNYDES-----CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFST 573
            R +T EQID+L      +  N+ ES     CS+C +E+ E    ++ L C H++H  C+ +WL +   CP+CR  V  ST
Sbjct:  560 RGLTKEQIDNL------SMRNFGESDAFKTCSVCITEYAEG-NKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLIST 632          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: znrf3 (zinc and ring finger 3 [Source:NCBI gene;Acc:556813])

HSP 1 Score: 55.0694 bits (131), Expect = 3.308e-8
Identity = 21/53 (39.62%), Postives = 33/53 (62.26%), Query Frame = 1
Query:  424 CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTN 582
            C+IC  ++ +   +++++ C H+FHK C+  WLLQ H CP CRH +    K N
Sbjct:  265 CAICLEKYIDG-EELRVIPCAHRFHKKCVDPWLLQHHTCPHCRHNIIDQKKGN 316          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: znrf3 (zinc and ring finger 3 [Source:NCBI gene;Acc:556813])

HSP 1 Score: 54.299 bits (129), Expect = 5.446e-8
Identity = 21/53 (39.62%), Postives = 33/53 (62.26%), Query Frame = 1
Query:  424 CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTN 582
            C+IC  ++ +   +++++ C H+FHK C+  WLLQ H CP CRH +    K N
Sbjct:  150 CAICLEKYIDG-EELRVIPCAHRFHKKCVDPWLLQHHTCPHCRHNIIDQKKGN 201          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: fbxo30 (F-box protein 30 [Source:Xenbase;Acc:XB-GENE-5934558])

HSP 1 Score: 58.5362 bits (140), Expect = 2.857e-9
Identity = 34/76 (44.74%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  358 TDEQIDSLPTIDIS---NCVNYDESCSICFSEFTETIAD--IKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFS 570
            T E ID LP I I    N V  ++ C+IC SE+   I D  +  L C H FHK C+  WL +   CPVCRHV++ S
Sbjct:  622 TKESIDCLPQIIIGEDHNIVGQEQCCAICCSEY---IKDEILTELPCHHLFHKPCVTLWLQKSGTCPVCRHVLASS 694          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: fbxo30 (F-box protein 30 [Source:Xenbase;Acc:XB-GENE-5934558])

HSP 1 Score: 58.5362 bits (140), Expect = 3.169e-9
Identity = 34/76 (44.74%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  358 TDEQIDSLPTIDIS---NCVNYDESCSICFSEFTETIAD--IKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFS 570
            T E ID LP I I    N V  ++ C+IC SE+   I D  +  L C H FHK C+  WL +   CPVCRHV++ S
Sbjct:  681 TKESIDCLPQIIIGEDHNIVGQEQCCAICCSEY---IKDEILTELPCHHLFHKPCVTLWLQKSGTCPVCRHVLASS 753          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: gnrh1 (gonadotropin releasing hormone 1 [Source:Xenbase;Acc:XB-GENE-960286])

HSP 1 Score: 57.3806 bits (137), Expect = 6.816e-9
Identity = 26/71 (36.62%), Postives = 43/71 (60.56%), Query Frame = 1
Query:  349 RVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVV 561
            R +T EQID+L T +     +  ++CS+C +E+TE    ++ L C H++H  C+ +WL +   CP+CR  V
Sbjct:  530 RGLTKEQIDNLSTRNFGEN-DALKTCSVCITEYTEG-NKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAV 598          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: gnrh1 (gonadotropin releasing hormone 1 [Source:Xenbase;Acc:XB-GENE-960286])

HSP 1 Score: 57.3806 bits (137), Expect = 7.145e-9
Identity = 26/71 (36.62%), Postives = 43/71 (60.56%), Query Frame = 1
Query:  349 RVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVV 561
            R +T EQID+L T +     +  ++CS+C +E+TE    ++ L C H++H  C+ +WL +   CP+CR  V
Sbjct:  549 RGLTKEQIDNLSTRNFGEN-DALKTCSVCITEYTEG-NKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAV 617          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: ssr2 (signal sequence receptor, beta (translocon-associated protein beta) [Source:Xenbase;Acc:XB-GENE-970408])

HSP 1 Score: 54.6842 bits (130), Expect = 6.095e-8
Identity = 19/44 (43.18%), Postives = 30/44 (68.18%), Query Frame = 1
Query:  424 CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRH 555
            C+IC  ++ +   +++++ C H+FHK C+  WLLQ H CP CRH
Sbjct:  266 CAICLEKYIDG-EELRVIPCTHRFHKRCVDPWLLQNHTCPHCRH 308          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf139 (ring finger protein 139 [Source:MGI Symbol;Acc:MGI:1923091])

HSP 1 Score: 58.5362 bits (140), Expect = 2.098e-9
Identity = 29/84 (34.52%), Postives = 47/84 (55.95%), Query Frame = 1
Query:  343 LNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNNND 594
            +NR    ++I+SLP I  S+    D+ C+IC+ EFT +    ++  C H FH  CL+KWL  +  CP+C   V    +  +N++
Sbjct:  520 MNRRTAVKKINSLPEIKGSHLQEIDDVCAICYHEFTTSA---RITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDEIKDNSN 600          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: 4930595M18Rik (RIKEN cDNA 4930595M18 gene [Source:MGI Symbol;Acc:MGI:3045300])

HSP 1 Score: 55.8398 bits (133), Expect = 1.895e-8
Identity = 29/77 (37.66%), Postives = 49/77 (63.64%), Query Frame = 1
Query:  337 NNLNRVITDEQIDSLPTIDISNCVNYDES-CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCR-HVV 561
            NN  + +T+EQI++LP I    C N + S CSIC +++ +  + I++L C H++H  C+ +WL     CP+CR H++
Sbjct:  747 NNHPKGLTEEQINNLPVIYF--CENDEISHCSICLTQYIKN-SKIRVLPCFHEYHDKCIDRWLSDNSTCPICRKHII 820          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rlim (ring finger protein, LIM domain interacting [Source:MGI Symbol;Acc:MGI:1342291])

HSP 1 Score: 55.4546 bits (132), Expect = 2.455e-8
Identity = 25/71 (35.21%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  349 RVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVV 561
            R +T EQID+L         +  ++CS+C +E+TE    ++ L C H++H  C+ +WL +   CP+CR  V
Sbjct:  522 RGLTKEQIDNLAMRSFGEN-DALKTCSVCITEYTEG-NKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAV 590          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rlim (ring finger protein, LIM domain interacting [Source:MGI Symbol;Acc:MGI:1342291])

HSP 1 Score: 55.4546 bits (132), Expect = 2.455e-8
Identity = 25/71 (35.21%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  349 RVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVV 561
            R +T EQID+L         +  ++CS+C +E+TE    ++ L C H++H  C+ +WL +   CP+CR  V
Sbjct:  522 RGLTKEQIDNLAMRSFGEN-DALKTCSVCITEYTEG-NKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAV 590          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Znrf3 (zinc and ring finger 3 [Source:MGI Symbol;Acc:MGI:3039616])

HSP 1 Score: 54.299 bits (129), Expect = 6.727e-8
Identity = 18/44 (40.91%), Postives = 30/44 (68.18%), Query Frame = 1
Query:  424 CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRH 555
            C+IC  ++ +   +++++ C H+FH+ C+  WLLQ H CP CRH
Sbjct:  290 CAICLEKYIDG-EELRVIPCTHRFHRKCVDPWLLQHHTCPHCRH 332          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q940T5|RDUF2_ARATH (E3 ubiquitin-protein ligase RDUF2 OS=Arabidopsis thaliana OX=3702 GN=DURF2 PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.405e-9
Identity = 34/116 (29.31%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  346 NRVITDEQIDSLPTIDISNC-VNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCR-HVVSFSTKTNNNNDNEKRTFSSILNNGR*IQKYGYSVMKYNLFGR 687
            N   +   I+SLP ++IS+C +  + +C++C +E  ET  + + + C H FH  C+  WL  ++ CPVCR  + S   + +NNN+ +     +I      +   G++V ++N   R
Sbjct:  172 NPPASKSAIESLPRVEISDCHIGSEANCAVC-TEIFETETEAREMPCKHLFHDDCIVPWLSIRNSCPVCRFELPSEPNRRSNNNEEDNAVGMTIWR----LPGGGFAVGRFNAAMR 282          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9LQX2|MPSR1_ARATH (E3 ubiquitin-protein ligase MPSR1 OS=Arabidopsis thaliana OX=3702 GN=MPSR1 PE=1 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 8.575e-9
Identity = 38/130 (29.23%), Postives = 65/130 (50.00%), Query Frame = 1
Query:  280 IFMTRNSNINRLFQTGNFTNNLNRV-ITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVS-----FSTKTNNNNDNEKRTFSSILNNGR*IQKY 651
            I +  +S +N L ++   +    R   +   ID++P ++I  C   +  C IC  E+ ++   +K + C H+FH  C++KWL     CPVCR+ +         K N+ N+   R FS   N+GR I+ +
Sbjct:   67 IVLEGSSGMNPLLRSLLESREEGRPPASKASIDAMPIVEIDGC---EGECVICLEEW-KSEETVKEMPCKHRFHGGCIEKWLGFHGSCPVCRYEMPVDGDEIGKKRNDGNEIWVR-FS--FNDGRRIRDF 189          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7TMV1|RN139_MOUSE (E3 ubiquitin-protein ligase RNF139 OS=Mus musculus OX=10090 GN=Rnf139 PE=1 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.481e-8
Identity = 29/84 (34.52%), Postives = 47/84 (55.95%), Query Frame = 1
Query:  343 LNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNNND 594
            +NR    ++I+SLP I  S+    D+ C+IC+ EFT +    ++  C H FH  CL+KWL  +  CP+C   V    +  +N++
Sbjct:  520 MNRRTAVKKINSLPEIKGSHLQEIDDVCAICYHEFTTSA---RITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDEIKDNSN 600          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7T037|RF12B_XENLA (E3 ubiquitin-protein ligase RNF12-B OS=Xenopus laevis OX=8355 GN=rnf12-b PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.862e-8
Identity = 29/76 (38.16%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  349 RVITDEQIDSLPTIDISNCVNYDE-----SCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVV 561
            R +T EQID+L T       NY E     +CS+C +E+TE    ++ L C H++H  C+ +WL +   CP+CR  V
Sbjct:  679 RGLTKEQIDNLST------RNYGENDALKTCSVCITEYTEG-NKLRKLPCSHEYHIHCIDRWLSENSTCPICRRAV 747          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7KRW1|TRC8_DROME (Protein TRC8 homolog OS=Drosophila melanogaster OX=7227 GN=Trc8 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 2.095e-8
Identity = 23/74 (31.08%), Postives = 39/74 (52.70%), Query Frame = 1
Query:  367 QIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNN 588
            +I +LP    +    +D+ C+IC+ E        K+  C H FH  CL+KWL  +  CP+C  ++ ++ K + N
Sbjct:  602 KISALPEATPAQLQAFDDVCAICYQEMYSA----KITRCRHFFHGVCLRKWLYVQDRCPLCHEIMMYTDKADEN 671          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A1J3JAD6 (E3 ubiquitin-protein ligase RING1 OS=Noccaea caerulescens OX=107243 GN=MP_TR9258_c0_g1_i1_g.28309 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.057e-10
Identity = 35/124 (28.23%), Postives = 58/124 (46.77%), Query Frame = 1
Query:  280 IFMTRNSNINRLFQ--TGNFTNNLNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNNNDNEKRTFSSILNNGR*IQ 645
            I +  +S +N LF+   G+     +   +   ID++P +DI  C   +  C IC  E+      +K + C H+FH  C++KWL     CPVCR+ +           N+ R    + + GR I+
Sbjct:   66 IVLDESSGLNPLFRDLLGSGEEG-HPPASKASIDAMPMVDIDGC--REGECVICLEEWKSEETTVKEMPCKHRFHGGCIEKWLGLHGSCPVCRYEMPVDGDEVEKKRNDGREIWVMFDGGRRIR 186          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A1J3FTB9 (E3 ubiquitin-protein ligase RING1 OS=Noccaea caerulescens OX=107243 GN=LC_TR2672_c4_g1_i1_g.10020 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 7.930e-10
Identity = 35/124 (28.23%), Postives = 58/124 (46.77%), Query Frame = 1
Query:  280 IFMTRNSNINRLFQ--TGNFTNNLNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNNNDNEKRTFSSILNNGR*IQ 645
            I +  +S +N LF+   G+     +   +   ID++P +DI  C   +  C IC  E+      +K + C H+FH  C++KWL     CPVCR+ +           N+ R    + + GR I+
Sbjct:   66 IVLDESSGLNPLFRDLLGSGEEG-HPPASKASIDAMPMVDIDGC--REGECVICLEEWKSEETTVKEMPCKHRFHGGCIEKWLGLHGSCPVCRYEMPVDGDEVEKKRNDGREIWVMFDGGRRIR 186          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A1J3CQH6 (E3 ubiquitin-protein ligase RING1 OS=Noccaea caerulescens OX=107243 GN=GA_TR13174_c0_g1_i1_g.41863 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.114e-9
Identity = 35/124 (28.23%), Postives = 58/124 (46.77%), Query Frame = 1
Query:  280 IFMTRNSNINRLFQ--TGNFTNNLNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNNNDNEKRTFSSILNNGR*IQ 645
            I +  +S +N LF+   G+     +   +   ID++P +DI  C   +  C IC  E+      +K + C H+FH  C++KWL     CPVCR+ +           N+ R    + + GR I+
Sbjct:   66 IVLDESSGLNPLFRDLLGSGEEG-HPPASKASIDAMPMVDIDGC--REGECVICLEEWKSEETTVKEMPCKHRFHGGCIEKWLGLHGSCPVCRYEMPVDGDEVEKKINDGREIWVMFDGGRRIR 186          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A2G9I2T1 (Ubiquitin--protein ligase OS=Handroanthus impetiginosus OX=429701 GN=CDL12_03193 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.943e-9
Identity = 36/114 (31.58%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  280 IFMTRNSN------INRLFQTGNFTNNLN--RVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNNNDN 597
            +F+   SN       N LF  GN  +  N  R  +   ID++P+++I      DE C +C  E+ E     + + CGH+FH  C++KWL  +  CPVCR+ +         N N
Sbjct:   74 MFLMETSNDSPSLGFNSLF--GNLFSGKNDQRPASKASIDAMPSVEIEKGEKDDEQCVVCLEEW-ENGEKAQEMPCGHRFHGDCIEKWLKIRASCPVCRYEMPVDEDGEAGNKN 184          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: H3BEH3 (Ring finger protein 6 OS=Latimeria chalumnae OX=7897 GN=RNF6 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.390e-9
Identity = 32/81 (39.51%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  349 RVITDEQIDSLPTIDISNCV---NYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTN 582
            R +T EQID+LPT +  +C       ++CS+C +E+      +K L C H+FH  C+ +WL +   CP+CR  VS S K N
Sbjct:  619 RGLTKEQIDNLPTRNYGDCSLECEISKTCSVCINEYA-AGNKLKRLPCAHEFHIHCIDRWLSENSTCPICRQRVSRSDKKN 698          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: rnf139 (ring finger protein 139 [Source:NCBI gene;Acc:103046007])

HSP 1 Score: 57.7658 bits (138), Expect = 2.857e-9
Identity = 31/94 (32.98%), Postives = 49/94 (52.13%), Query Frame = 1
Query:  283 FMTRNSNINRLFQTGN-FTNNLNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVV 561
             M  ++  N   Q  N +   +NR    ++I+SLP +  S   + ++ C+IC+ EF   IA  ++  C H FH  CL+KWL  +  CP+C   V
Sbjct:  496 MMCLHAYFNIYLQAKNGWKTFINRRTAVKKINSLPEVKGSELRDVEDVCAICYQEF---IASARITPCRHYFHALCLRKWLYIQDTCPMCHQKV 586          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: rnf139 (ring finger protein 139 [Source:NCBI gene;Acc:103046007])

HSP 1 Score: 57.7658 bits (138), Expect = 3.379e-9
Identity = 38/118 (32.20%), Postives = 59/118 (50.00%), Query Frame = 1
Query:  286 MTRNSNINRLFQTGN-FTNNLNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNNNDNEKRT-FSSILNNG 633
            M  ++  N   Q  N +   +NR    ++I+SLP +  S   + ++ C+IC+ EF   IA  ++  C H FH  CL+KWL  +  CP+C        K    +D+  R  FS+  NNG
Sbjct:  497 MCLHAYFNIYLQAKNGWKTFINRRTAVKKINSLPEVKGSELRDVEDVCAICYQEF---IASARITPCRHYFHALCLRKWLYIQDTCPMCHQ------KVYVEDDSRDRAPFSN--NNG 603          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: pja2 (E3 ubiquitin-protein ligase Praja-2 [Source:NCBI gene;Acc:103023611])

HSP 1 Score: 56.6102 bits (135), Expect = 7.184e-9
Identity = 30/67 (44.78%), Postives = 41/67 (61.19%), Query Frame = 1
Query:  370 IDSLP-TIDISNCVNYDESCSICFSEFT-ETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVS 564
            IDSLP  I + +    ++SC+IC SE+  E +A    L C H FHK C+  WL +   CPVCRHV++
Sbjct:  556 IDSLPHIIVLDDHRGQEQSCAICCSEYVNEEVA--TQLPCRHMFHKLCVTLWLRKSGTCPVCRHVLT 620          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: pja2 (E3 ubiquitin-protein ligase Praja-2 [Source:NCBI gene;Acc:103023611])

HSP 1 Score: 56.6102 bits (135), Expect = 7.184e-9
Identity = 30/67 (44.78%), Postives = 41/67 (61.19%), Query Frame = 1
Query:  370 IDSLP-TIDISNCVNYDESCSICFSEFT-ETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVS 564
            IDSLP  I + +    ++SC+IC SE+  E +A    L C H FHK C+  WL +   CPVCRHV++
Sbjct:  556 IDSLPHIIVLDDHRGQEQSCAICCSEYVNEEVA--TQLPCRHMFHKLCVTLWLRKSGTCPVCRHVLT 620          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: pja2 (E3 ubiquitin-protein ligase Praja-2 [Source:NCBI gene;Acc:103023611])

HSP 1 Score: 56.6102 bits (135), Expect = 7.246e-9
Identity = 30/71 (42.25%), Postives = 44/71 (61.97%), Query Frame = 1
Query:  358 TDEQIDSLP-TIDISNCVNYDESCSICFSEFT-ETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVS 564
            +++ IDSLP  I + +    ++SC+IC SE+  E +A    L C H FHK C+  WL +   CPVCRHV++
Sbjct:  484 SEQIIDSLPHIIVLDDHRGQEQSCAICCSEYVNEEVA--TQLPCRHMFHKLCVTLWLRKSGTCPVCRHVLT 552          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: rnf111 (ring finger protein 111 [Source:ZFIN;Acc:ZDB-GENE-070808-2])

HSP 1 Score: 51.9878 bits (123), Expect = 5.098e-8
Identity = 19/46 (41.30%), Postives = 28/46 (60.87%), Query Frame = 1
Query:  415 DESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCR 552
            +E C+IC S   E   D++ L C H FH+ C+ +WL    +CP+CR
Sbjct:  845 EEKCTICLSVLEEE-EDVRRLPCMHLFHQVCVDQWLTTNKKCPICR 889          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: rnf145b (ring finger protein 145b [Source:NCBI gene;Acc:327056])

HSP 1 Score: 50.8322 bits (120), Expect = 1.019e-7
Identity = 28/91 (30.77%), Postives = 44/91 (48.35%), Query Frame = 1
Query:  301 NINRLFQTGNFTNNLNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFST 573
            N+ R  Q G + + L R     +I+++P           + CSIC+ +    +    +  CGH FH  CL+KWL  +  CP+C  V+  ST
Sbjct:  404 NVWRRAQHG-WRSFLRRREAVSRINAMPIATEPQLRALQDVCSICYQDMESAV----LTPCGHYFHAGCLRKWLYLQETCPMCHQVLGGST 489          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003771.1 (pep scaffold:Pmarinus_7.0:GL488469:4:5386:-1 gene:ENSPMAG00000003449.1 transcript:ENSPMAT00000003771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.2838 bits (103), Expect = 1.389e-6
Identity = 20/60 (33.33%), Postives = 36/60 (60.00%), Query Frame = 1
Query:  424 CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHE-CPVCRHVVSFSTKTNNNNDNE 600
            C+IC  E+ E    +++L C H FH  C+  WL Q+ + CPVC+  V  S  +++ ++++
Sbjct:    7 CAICLEEYEEG-ERLRVLPCAHAFHCKCVDPWLTQQRKNCPVCKRKVVRSHGSDSESESD 65          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: si:ch1073-392o20.1 (ring finger protein 122 [Source:HGNC Symbol;Acc:HGNC:21147])

HSP 1 Score: 43.5134 bits (101), Expect = 1.556e-6
Identity = 17/50 (34.00%), Postives = 31/50 (62.00%), Query Frame = 1
Query:  415 DESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVS 564
            +++C++C  +F E   ++ +  C H FH+ CL KWL  ++ CP+C   V+
Sbjct:   14 EQTCAVCLEDFREK-DELAVCPCKHAFHRKCLVKWLEIRNACPMCNKPVA 62          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: RNF115 (ring finger protein 115 [Source:HGNC Symbol;Acc:HGNC:18154])

HSP 1 Score: 45.8246 bits (107), Expect = 3.658e-6
Identity = 25/77 (32.47%), Postives = 36/77 (46.75%), Query Frame = 1
Query:  325 GNFTNNLNRVITDEQIDSLPTIDISN-CVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCR 552
            G   N        E+I SLP I I+   +N    C++C  +++     ++ L C H FH  C+  WL     CPVCR
Sbjct:  170 GQLDNTGPPPADKEKISSLPRITIAQEHLNCSMECAVCKEDYS-VGESVRQLPCLHLFHSNCIVPWLEMHDSCPVCR 245          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO45479 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSU5])

HSP 1 Score: 46.595 bits (109), Expect = 4.733e-7
Identity = 23/70 (32.86%), Postives = 37/70 (52.86%), Query Frame = 1
Query:  358 TDEQIDSLPTIDISNCVNYDE----SCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRH 555
            + E + +LP + +++  +  E    SC IC  ++ E     K + C H FH  C+  WL + + CPVCRH
Sbjct:    4 SKEAVQALPAVKVTD-KHLKELSTSSCPICLGDY-EKGESTKQMPCDHLFHPGCILPWLEKTNSCPVCRH 71          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO29210 (pep supercontig:ASM20922v1:NEMVEscaffold_1403:17060:20569:-1 gene:NEMVEDRAFT_v1g145359 transcript:EDO29210 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 4.780e-7
Identity = 23/70 (32.86%), Postives = 37/70 (52.86%), Query Frame = 1
Query:  358 TDEQIDSLPTIDISNCVNYDE----SCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRH 555
            + E + +LP + +++  +  E    SC IC  ++ E     K + C H FH  C+  WL + + CPVCRH
Sbjct:    4 SKEAVQALPAVKVTD-KHLKELSTSSCPICLGDY-EKGESTKQMPCDHLFHPGCILPWLEKTNSCPVCRH 71          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO49300 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH66])

HSP 1 Score: 45.4394 bits (106), Expect = 2.669e-6
Identity = 18/56 (32.14%), Postives = 31/56 (55.36%), Query Frame = 1
Query:  418 ESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNN 585
            + C+IC  +F     ++ M  CGH +H  C+ KWL  ++ CP+C+      ++ NN
Sbjct:   82 DMCTICLEDFINK-EEVNMCKCGHAYHNKCIMKWLEVRNSCPICQR--GLQSRANN 134          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: zmp:0000000662 (RING finger protein 145-like [Source:NCBI gene;Acc:101166429])

HSP 1 Score: 59.3066 bits (142), Expect = 9.173e-10
Identity = 31/103 (30.10%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  319 QTGNFTNNLNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNNNDNEKRTFSSILN 627
            Q+G + + L R    ++I SLP         +D+ CSICF + +  +       CGH FH  CL+KWL  +  CP+C   V  +     + ++E+ + S + N
Sbjct:  500 QSG-WRSFLLRRAAAKKISSLPAASEQQLQQHDDVCSICFQDMSSAVVT----SCGHFFHGNCLRKWLYVQETCPMCHQPVQPAPSPQRDTESEQNSDSPVTN 597          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: znrf3 (zinc and ring finger 3 [Source:NCBI gene;Acc:101158028])

HSP 1 Score: 56.225 bits (134), Expect = 1.084e-8
Identity = 21/53 (39.62%), Postives = 33/53 (62.26%), Query Frame = 1
Query:  424 CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTN 582
            C+IC  ++ +   +++++ C H+FHK C+  WLLQ H CP CRH +    K N
Sbjct:  268 CAICLEKYMDG-EELRVIPCAHRFHKRCVDPWLLQHHTCPHCRHNIIEQKKGN 319          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: znrf3 (zinc and ring finger 3 [Source:NCBI gene;Acc:101158028])

HSP 1 Score: 56.225 bits (134), Expect = 1.192e-8
Identity = 21/53 (39.62%), Postives = 33/53 (62.26%), Query Frame = 1
Query:  424 CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTN 582
            C+IC  ++ +   +++++ C H+FHK C+  WLLQ H CP CRH +    K N
Sbjct:  243 CAICLEKYMDG-EELRVIPCAHRFHKRCVDPWLLQHHTCPHCRHNIIEQKKGN 294          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000013927.3 (ring finger protein 43 [Source:NCBI gene;Acc:101168566])

HSP 1 Score: 55.8398 bits (133), Expect = 1.324e-8
Identity = 21/65 (32.31%), Postives = 36/65 (55.38%), Query Frame = 1
Query:  424 CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNNNDNEKRTFSS 618
            C+IC  EF +    ++++ C H+FHK C+  WLLQ   CP+C H +  + +    N  ++ +  S
Sbjct:  261 CAICLEEFQDG-QHLRIISCAHEFHKACVDPWLLQHRTCPLCMHNIMGTERQAQRNRAQQNSEQS 324          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000035375.1 (ring finger protein 43 [Source:NCBI gene;Acc:101168566])

HSP 1 Score: 55.8398 bits (133), Expect = 1.409e-8
Identity = 21/65 (32.31%), Postives = 36/65 (55.38%), Query Frame = 1
Query:  424 CSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNNNDNEKRTFSS 618
            C+IC  EF +    ++++ C H+FHK C+  WLLQ   CP+C H +  + +    N  ++ +  S
Sbjct:  289 CAICLEEFQDG-QHLRIISCAHEFHKACVDPWLLQHRTCPLCMHNIMGTERQAQRNRAQQNSEQS 352          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000055935.1 (SMESG000055935.1)

HSP 1 Score: 167.933 bits (424), Expect = 1.901e-53
Identity = 80/81 (98.77%), Postives = 80/81 (98.77%), Query Frame = 1
Query:  286 MTRNSNINRLFQTGNFTNNLNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQ 528
            MTRNSNINRLFQTGNFTNNLN VITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQ
Sbjct:    1 MTRNSNINRLFQTGNFTNNLNLVITDEQIDSLPTIDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQ 81          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000036540.1 (SMESG000036540.1)

HSP 1 Score: 55.4546 bits (132), Expect = 5.020e-9
Identity = 47/202 (23.27%), Postives = 89/202 (44.06%), Query Frame = 1
Query:    7 ATSNSSEFYCYKCDSYFTLSSIENPTCKYCRDSFVISSKEHRLIEPDNDEYEEFGD-DLIKVGKSNNRGRNESYIXXXXXXXXXXXXXXXXXIFMT-------RNSNINRLFQTGNFTNNLNRVITD-EQIDSLPT-------IDISNCVNYDESCSICFSEFTETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVS 564
            AT N+  ++C+KC+    +S  ++  C  C D F+   +    +E D+D    F     I  G + N      +I     + R ++     +           R+   + +F   +F N + R++   EQ    P        + ++     +++CSIC S++ E   ++  L C H++H  CL+ WL++   CP+CR  +S
Sbjct:    2 ATINTDNYFCHKCNRDVHIS--QDGKCVTCNDGFIERIESDNSMESDDDALNVFHIIRHIPSGSTTNETDGSFFITPRDHDNRNSVFGQLISNLFGGLLPLDFRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEANDTCSICLSDY-EVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLS 200          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000003171.1 (SMESG000003171.1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.502e-8
Identity = 24/55 (43.64%), Postives = 34/55 (61.82%), Query Frame = 1
Query:  391 DISNCVNYDESCSICFSEFT--ETIADIKMLHCGHQFHKTCLQKWLLQKHECPVC 549
            D+     +++ C+ICFSE +  +    +K   C H FHK CL+KWLL KH CP+C
Sbjct:  594 DVEEISRFEDVCAICFSELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMC 648          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000003171.1 (SMESG000003171.1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.552e-8
Identity = 24/55 (43.64%), Postives = 34/55 (61.82%), Query Frame = 1
Query:  391 DISNCVNYDESCSICFSEFT--ETIADIKMLHCGHQFHKTCLQKWLLQKHECPVC 549
            D+     +++ C+ICFSE +  +    +K   C H FHK CL+KWLL KH CP+C
Sbjct:  583 DVEEISRFEDVCAICFSELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMC 637          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000059381.1 (SMESG000059381.1)

HSP 1 Score: 53.1434 bits (126), Expect = 7.882e-8
Identity = 29/77 (37.66%), Postives = 43/77 (55.84%), Query Frame = 1
Query:  355 ITDEQIDSLPT---IDISNCVNYD------ESCSICFSEFTETIAD--IKMLHCGHQFHKTCLQKWLLQKHECPVCR 552
            IT +++D++PT   I  +N +NY       + C IC  +F   + D  I+ML C H FH  C++KWL     CP+CR
Sbjct:  521 ITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDF---MPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCR 594          
The following BLAST results are available for this feature:
BLAST of RING-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RLIM2.960e-835.21ring finger protein, LIM domain interacting [Sourc... [more]
RLIM2.960e-835.21ring finger protein, LIM domain interacting [Sourc... [more]
RNF1393.130e-835.63ring finger protein 139 [Source:HGNC Symbol;Acc:HG... [more]
ZNRF37.760e-840.91zinc and ring finger 3 [Source:HGNC Symbol;Acc:HGN... [more]
ZNRF38.158e-840.91zinc and ring finger 3 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plr-16.179e-938.98Probable E3 ubiquitin-protein ligase plr-1 [Sourc... [more]
rnf-1459.839e-834.57RiNg Finger protein [Source:UniProtKB/TrEMBL;Acc:... [more]
hrdl-19.558e-741.18E3 ubiquitin-protein ligase hrd-like protein 1 [S... [more]
trul-12.915e-640.43pep chromosome:WBcel235:II:279128:282576:-1 gene:W... [more]
trul-12.915e-640.43pep chromosome:WBcel235:II:278621:282576:-1 gene:W... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trc82.087e-931.08gene:FBgn0039668 transcript:FBtr0333188[more]
Trc82.087e-931.08gene:FBgn0039668 transcript:FBtr0085430[more]
Trc82.087e-931.08gene:FBgn0039668 transcript:FBtr0085429[more]
Trc82.090e-931.08gene:FBgn0039668 transcript:FBtr0085432[more]
mura4.125e-838.57gene:FBgn0037705 transcript:FBtr0082116[more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1393.222e-932.99ring finger protein 139 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rlim3.331e-936.25ring finger protein, LIM domain interacting [Sourc... [more]
rlim3.331e-936.25ring finger protein, LIM domain interacting [Sourc... [more]
znrf33.308e-839.62zinc and ring finger 3 [Source:NCBI gene;Acc:55681... [more]
znrf35.446e-839.62zinc and ring finger 3 [Source:NCBI gene;Acc:55681... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo302.857e-944.74F-box protein 30 [Source:Xenbase;Acc:XB-GENE-59345... [more]
fbxo303.169e-944.74F-box protein 30 [Source:Xenbase;Acc:XB-GENE-59345... [more]
gnrh16.816e-936.62gonadotropin releasing hormone 1 [Source:Xenbase;A... [more]
gnrh17.145e-936.62gonadotropin releasing hormone 1 [Source:Xenbase;A... [more]
ssr26.095e-843.18signal sequence receptor, beta (translocon-associa... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnf1392.098e-934.52ring finger protein 139 [Source:MGI Symbol;Acc:MGI... [more]
4930595M18Rik1.895e-837.66RIKEN cDNA 4930595M18 gene [Source:MGI Symbol;Acc:... [more]
Rlim2.455e-835.21ring finger protein, LIM domain interacting [Sourc... [more]
Rlim2.455e-835.21ring finger protein, LIM domain interacting [Sourc... [more]
Znrf36.727e-840.91zinc and ring finger 3 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q940T5|RDUF2_ARATH1.405e-929.31E3 ubiquitin-protein ligase RDUF2 OS=Arabidopsis t... [more]
sp|Q9LQX2|MPSR1_ARATH8.575e-929.23E3 ubiquitin-protein ligase MPSR1 OS=Arabidopsis t... [more]
sp|Q7TMV1|RN139_MOUSE1.481e-834.52E3 ubiquitin-protein ligase RNF139 OS=Mus musculus... [more]
sp|Q7T037|RF12B_XENLA1.862e-838.16E3 ubiquitin-protein ligase RNF12-B OS=Xenopus lae... [more]
sp|Q7KRW1|TRC8_DROME2.095e-831.08Protein TRC8 homolog OS=Drosophila melanogaster OX... [more]
back to top
BLAST of RING-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1J3JAD66.057e-1028.23E3 ubiquitin-protein ligase RING1 OS=Noccaea caeru... [more]
A0A1J3FTB97.930e-1028.23E3 ubiquitin-protein ligase RING1 OS=Noccaea caeru... [more]
A0A1J3CQH61.114e-928.23E3 ubiquitin-protein ligase RING1 OS=Noccaea caeru... [more]
A0A2G9I2T12.943e-931.58Ubiquitin--protein ligase OS=Handroanthus impetigi... [more]
H3BEH33.390e-939.51Ring finger protein 6 OS=Latimeria chalumnae OX=78... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1392.857e-932.98ring finger protein 139 [Source:NCBI gene;Acc:1030... [more]
rnf1393.379e-932.20ring finger protein 139 [Source:NCBI gene;Acc:1030... [more]
pja27.184e-944.78E3 ubiquitin-protein ligase Praja-2 [Source:NCBI g... [more]
pja27.184e-944.78E3 ubiquitin-protein ligase Praja-2 [Source:NCBI g... [more]
pja27.246e-942.25E3 ubiquitin-protein ligase Praja-2 [Source:NCBI g... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1115.098e-841.30ring finger protein 111 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf145b1.019e-730.77ring finger protein 145b [Source:NCBI gene;Acc:327... [more]
ENSPMAT00000003771.11.389e-633.33pep scaffold:Pmarinus_7.0:GL488469:4:5386:-1 gene:... [more]
si:ch1073-392o20.11.556e-634.00ring finger protein 122 [Source:HGNC Symbol;Acc:HG... [more]
RNF1153.658e-632.47ring finger protein 115 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO454794.733e-732.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292104.780e-732.86pep supercontig:ASM20922v1:NEMVEscaffold_1403:1706... [more]
EDO493002.669e-632.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zmp:00000006629.173e-1030.10RING finger protein 145-like [Source:NCBI gene;Acc... [more]
znrf31.084e-839.62zinc and ring finger 3 [Source:NCBI gene;Acc:10115... [more]
znrf31.192e-839.62zinc and ring finger 3 [Source:NCBI gene;Acc:10115... [more]
ENSORLT00000013927.31.324e-832.31ring finger protein 43 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000035375.11.409e-832.31ring finger protein 43 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055935.11.901e-5398.77SMESG000055935.1[more]
SMESG000036540.15.020e-923.27SMESG000036540.1[more]
SMESG000003171.11.502e-843.64SMESG000003171.1[more]
SMESG000003171.11.552e-843.64SMESG000003171.1[more]
SMESG000059381.17.882e-837.66SMESG000059381.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035284 ID=SMED30035284|Name=RING-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=762bp
ATGTCAGCTACTTCAAATAGTTCTGAGTTTTATTGTTATAAATGCGATTC
ATATTTTACATTATCAAGCATCGAGAATCCTACATGTAAATATTGTCGTG
ATTCTTTTGTAATATCTTCGAAAGAACATAGATTAATAGAACCAGATAAT
GATGAATACGAAGAATTTGGAGATGATTTAATTAAAGTTGGTAAATCTAA
CAATAGAGGACGCAATGAAAGTTATATTTTAAATCATCAACCAAATCAAC
GACGTAATCTTTTAAATTTAGGAAATAATATATTTATGACAAGAAATTCT
AATATAAATAGGTTATTCCAAACCGGAAATTTTACTAATAATCTTAATCG
GGTAATAACTGATGAACAAATAGACAGCCTACCTACAATTGATATATCGA
ATTGTGTCAATTATGATGAATCATGTTCAATTTGCTTTTCTGAATTTACT
GAAACCATTGCTGATATAAAAATGCTCCATTGTGGTCATCAGTTTCATAA
AACTTGTCTTCAAAAATGGCTTTTACAAAAACACGAGTGTCCAGTTTGTC
GTCATGTTGTTTCTTTTTCTACAAAAACTAATAATAATAATGACAACGAA
AAAAGAACATTTTCAAGTATTCTTAATAATGGAAGATAAATTCAAAAATA
TGGTTATTCTGTAATGAAATACAACTTATTTGGCCGCTATTTTCAGTTGT
AATTCTCAAACATTTGATACTTTATTGTTATATTATATAATGAATATAGA
ACAGAGTAATTT
back to top

protein sequence of SMED30035284-orf-1

>SMED30035284-orf-1 ID=SMED30035284-orf-1|Name=SMED30035284-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=213bp
MSATSNSSEFYCYKCDSYFTLSSIENPTCKYCRDSFVISSKEHRLIEPDN
DEYEEFGDDLIKVGKSNNRGRNESYILNHQPNQRRNLLNLGNNIFMTRNS
NINRLFQTGNFTNNLNRVITDEQIDSLPTIDISNCVNYDESCSICFSEFT
ETIADIKMLHCGHQFHKTCLQKWLLQKHECPVCRHVVSFSTKTNNNNDNE
KRTFSSILNNGR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
GO:0061630ubiquitin protein ligase activity
GO:0002020protease binding
GO:0004842ubiquitin-protein transferase activity
GO:0016740transferase activity
GO:0019787ubiquitin-like protein transferase activity
Vocabulary: biological process
TermDefinition
GO:0042787protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:0043161proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0060628regulation of ER to Golgi vesicle-mediated transport
GO:0070613regulation of protein processing
GO:2000060positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:0000209protein polyubiquitination
GO:0008285negative regulation of cell proliferation
GO:0016567protein ubiquitination
GO:0017148negative regulation of translation
GO:0031396regulation of protein ubiquitination
GO:0031648protein destabilization
GO:0036503ERAD pathway
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0036513Derlin-1 retrotranslocation complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 142..183
e-value: 1.6E-7
score: 41.0
IPR001841Zinc finger, RING-typePFAMPF13639zf-RING_2coord: 141..184
e-value: 9.2E-12
score: 45.1
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 142..184
score: 13.448
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 106..189
e-value: 5.8E-17
score: 63.1
NoneNo IPR availablePANTHERPTHR45931FAMILY NOT NAMEDcoord: 57..187
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 123..196