Replication factor C subunit 5

Overview
NameReplication factor C subunit 5
Smed IDSMED30035282
Length (bp)1167
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Replication factor C subunit 5 (SMED30035282) t-SNE clustered cells

Violin plots show distribution of expression levels for Replication factor C subunit 5 (SMED30035282) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Replication factor C subunit 5 (SMED30035282) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Replication factor C subunit 5 (SMED30035282) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035282

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035282h1SMcG0014487 SmedASXL_014103SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30035282h1SMcG0014488 SmedASXL_014103SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30035282h1SMcG0014487 dd_Smed_v4_5504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035282h1SMcG0014487 dd_Smed_v4_5504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035282h1SMcG0014487 dd_Smed_v4_5504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035282h1SMcG0014487 dd_Smed_v4_5504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035282h1SMcG0014488 dd_Smed_v4_5504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035282h1SMcG0014488 dd_Smed_v4_5504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035282h1SMcG0014488 dd_Smed_v4_5504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30035282h1SMcG0014488 dd_Smed_v4_5504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Replication factor C subunit 5 vs. Ensembl Human
Match: RFC5 (replication factor C subunit 5 [Source:HGNC Symbol;Acc:HGNC:9973])

HSP 1 Score: 380.563 bits (976), Expect = 6.604e-131
Identity = 186/322 (57.76%), Postives = 246/322 (76.40%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            NLPW+EKYRPQ LNDLISH+DI+ T+Q FI++  LPHLL YGPPGTGKTS+ILA AKQ+Y DK   S+VLELNASDDRGI+++R  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL  E + PRL H++ EEKV+ + DG++AL+ LS+GDMR+A+N+LQ T+M+F  V    VY C G P   D+  IL+ +LN++   + + +TE++T K +AL DI+TE+   + +V+FP      L+ K+ADIE  LS+G ++KIQ  SL++AF + RD I A A
Sbjct:   19 NLPWVEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYGPPGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIIRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA 340          
BLAST of Replication factor C subunit 5 vs. Ensembl Human
Match: RFC5 (replication factor C subunit 5 [Source:HGNC Symbol;Acc:HGNC:9973])

HSP 1 Score: 369.007 bits (946), Expect = 9.307e-127
Identity = 182/318 (57.23%), Postives = 242/318 (76.10%), Query Frame = 3
Query:   39 IEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            +EKYRPQ LNDLISH+DI+ T+Q FI++  LPHLL YGPPGTGKTS+ILA AKQ+Y DK   S+VLELNASDDRGI+++R  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL  E + PRL H++ EEKV+ + DG++AL+ LS+GDMR+A+N+LQ T+M+F  V    VY C G P   D+  IL+ +LN++   + + +TE++T K +AL DI+TE+   + +V+FP      L+ K+ADIE  LS+G ++KIQ  SL++AF + RD I A A
Sbjct:    2 VEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYGPPGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIIRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA 319          
BLAST of Replication factor C subunit 5 vs. Ensembl Human
Match: RFC2 (replication factor C subunit 2 [Source:HGNC Symbol;Acc:HGNC:9970])

HSP 1 Score: 233.802 bits (595), Expect = 2.450e-73
Identity = 112/225 (49.78%), Postives = 159/225 (70.67%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASN-MTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTP 701
            LPW+EKYRP +LN+++ +ED +  L+ F  +GN+P+++  GPPGTGKT+SIL +A+ +    ++  +LELNAS+DRGI+VVR +I  FA   +T+ +G+ K+IILDEAD+MT  AQ AL+R +E YS+ TRF L CN  +KII  IQSRC   R++ L   QI  RL+++I +E+V YT DGLEA+I  + GDMRQA+N LQ T   F  +N+ NV+    +P P
Sbjct:   36 LPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFGFINSENVFKVCDEPHP 260          
BLAST of Replication factor C subunit 5 vs. Ensembl Human
Match: RFC4 (replication factor C subunit 4 [Source:HGNC Symbol;Acc:HGNC:9972])

HSP 1 Score: 213.001 bits (541), Expect = 4.456e-65
Identity = 116/317 (36.59%), Postives = 192/317 (60.57%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKS--------KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQ-CTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVS 950
            +PW+EKYRP+ ++++   E+++  L+  +   +LP+LLFYGPPGTGKTS+ILA A++++   + R  VLELNASD+RGI+VVR ++ NFA  +T+   +S        K++ILDEAD+MT  AQ AL+R +EK S+ TRFCLICNY ++II  + SRC++FRF PL  +  Q RL+ I  +E V  + +G+  L+++S GD+R+AI  LQ  T ++        V   +    P +    +         + ++ + +    +  A + +V +L  ++ + N  D   + +  KLA++++ L+ G  + +Q  SL +
Sbjct:   38 VPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFA-QLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCA 353          
BLAST of Replication factor C subunit 5 vs. Ensembl Human
Match: RFC4 (replication factor C subunit 4 [Source:HGNC Symbol;Acc:HGNC:9972])

HSP 1 Score: 213.001 bits (541), Expect = 4.456e-65
Identity = 116/317 (36.59%), Postives = 192/317 (60.57%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKS--------KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQ-CTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVS 950
            +PW+EKYRP+ ++++   E+++  L+  +   +LP+LLFYGPPGTGKTS+ILA A++++   + R  VLELNASD+RGI+VVR ++ NFA  +T+   +S        K++ILDEAD+MT  AQ AL+R +EK S+ TRFCLICNY ++II  + SRC++FRF PL  +  Q RL+ I  +E V  + +G+  L+++S GD+R+AI  LQ  T ++        V   +    P +    +         + ++ + +    +  A + +V +L  ++ + N  D   + +  KLA++++ L+ G  + +Q  SL +
Sbjct:   38 VPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFA-QLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCA 353          
BLAST of Replication factor C subunit 5 vs. Ensembl Celegans
Match: F44B9.8 (Probable replication factor C subunit 5 [Source:UniProtKB/Swiss-Prot;Acc:P34429])

HSP 1 Score: 337.421 bits (864), Expect = 5.680e-114
Identity = 169/315 (53.65%), Postives = 224/315 (71.11%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYD-KHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKS---------KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTK---KCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQ 932
            NLPW+EKYRP +L++L++HE I+ TL  FI    LPHLLFYGPPGTGKT+++LA A+QMY    + S+VLELNASD+RGI+VVR  I+NFA    +Q   +         KL+ILDEADAMTKDAQNAL+R+IEKY++  RFC+ICNY   I+PAIQSRCTRFRF+PL  + I PRL +I+  E++  TPDG +AL+ +S GDMR  IN LQ T+MSFDTV+   VY C+G+PTP++MK ++  LLN+    S K M  I+TK      AL D++T L   +  ++ PD AM+ +I  L ++E NLS GCS++ Q
Sbjct:   28 NLPWVEKYRPSKLDELVAHEQIVKTLTKFIENRTLPHLLFYGPPGTGKTTTVLAAARQMYSPTKMASMVLELNASDERGIDVVRNTIVNFAQTKGLQAFSTSSNTGTVPFKLVILDEADAMTKDAQNALRRVIEKYTDNVRFCIICNYLASIVPAIQSRCTRFRFAPLDQKLIVPRLEYIVETEQLKMTPDGKDALLIVSKGDMRTVINTLQSTAMSFDTVSENTVYQCIGQPTPKEMKEVVKTLLNDP---SKKCMNTIQTKLFENGYALQDVITHLHDFVFTLDIPDEAMSAIITGLGEVEENLSTGCSNETQ 339          
BLAST of Replication factor C subunit 5 vs. Ensembl Celegans
Match: rfc-2 (RFC (DNA replication factor) family [Source:UniProtKB/TrEMBL;Acc:O44175])

HSP 1 Score: 221.09 bits (562), Expect = 4.253e-69
Identity = 122/311 (39.23%), Postives = 188/311 (60.45%), Query Frame = 3
Query:   33 PWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFA-SNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKV----NFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVS 950
            PW+EKYRP+ L D++ +E+I+  L+    +GN+P+++  GPPG GKT+S+ A+A+++    V+  VLELNASD+RGI+VVR  I  FA + +T+ +G+ K+IILDEAD+MT  AQ AL+R +E Y++ TRF L CN   KII  IQSRC   R++ L   Q+  R+  +   EKVNY   GLEA++  + GDMRQA+N LQ T  +++ VN  NV     +P P  M  +L+   + +   + K + E   +   +  DIV+ L +++  V    N  +    E I ++A     +  G + K+Q   L++
Sbjct:   11 PWVEKYRPKVLADIVGNENIVERLKVIGHEGNVPNIVLSGPPGCGKTTSVWALARELLGDKVKEAVLELNASDERGIDVVRHRIKTFAQTKVTLPEGRHKIIILDEADSMTDGAQQALRRTMEMYTKTTRFALACNQSEKIIEPIQSRCALLRYTKLSPVQLLTRVKEVAKAEKVNYDDGGLEAILFTAQGDMRQALNNLQATVNAYELVNKENVLKVCDEPHPDLMIKMLHYCTDRKFFEASKIIHEFH-RLGFSSDDIVSTLFRVVKTVELSKNVSEQLRMEYIRQIAMCHMRIVQGLTSKLQLSRLIA 320          
BLAST of Replication factor C subunit 5 vs. Ensembl Celegans
Match: rfc-4 (Replication factor C subunit 4 [Source:UniProtKB/Swiss-Prot;Acc:P53016])

HSP 1 Score: 190.274 bits (482), Expect = 4.146e-57
Identity = 99/225 (44.00%), Postives = 147/225 (65.33%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKS-----KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSE-QIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTS--MSFDTVNAANVY 677
            L W EKYRP+ L+D+   ++++  L+  +   +LPHLLFYGPPGTGKTS+ LA  +Q++ K++    VL+LNASD+RGI VVR +I +F+ +      +      K+IILDE DAMT++AQ A++R+IE +S+ TRF LICNY +++IP + SRC +FRF  L +E Q+Q RL  I + E    + D L+ ++  S GD+R+A+  LQ  +  +     NA N Y
Sbjct:   15 LTWTEKYRPKTLDDIAYQDEVVTMLKGALQGRDLPHLLFYGPPGTGKTSAALAFCRQLFPKNIFHDRVLDLNASDERGIAVVRQKIQSFSKSSLGHSHREDVLKLKIIILDEVDAMTREAQAAMRRVIEDFSKTTRFILICNYVSRLIPPVVSRCAKFRFKSLPAEIQVQ-RLRTICDAEGTPMSDDELKQVMEYSEGDLRRAVCTLQSLAPILKSGDDNARNCY 238          
BLAST of Replication factor C subunit 5 vs. Ensembl Celegans
Match: rfc-3 (RFC (DNA replication factor) family [Source:UniProtKB/TrEMBL;Acc:Q18547])

HSP 1 Score: 99.7525 bits (247), Expect = 3.116e-23
Identity = 91/349 (26.07%), Postives = 151/349 (43.27%), Query Frame = 3
Query:   36 WIEKYRPQQLNDLISHEDIIHTLQN-----FISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVL------------------------ELNASD----DRGIEVVRTEILNFASNMTIQ---QGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTK------KCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAF 956
            W++KYRP+   DL+  + + + ++      F+S   +PHLLF GP G GK + I  + +++Y   V    L                        E+  SD    DR   VV+  +   A    I+   Q   K+++L EAD++T+DAQ+ L+R +EKY+   +  L C   ++II  +QSRC          E +   L  +I  E      + L+ ++  S G++R+AI + +   M     N + V   V  P P+    I           S   + ++R +      +CI  + I  +L++ L     P IA  E++ + A  E  L LG          V+AF
Sbjct:    4 WVDKYRPK---DLLGKDGVDYHIEQANHLKFLSADCMPHLLFCGPSGAGKKTRIKCLLRELYGVGVEKTQLIMKSFTSPSNKKLEIQTVSSNYHIEMTPSDVGIYDRV--VVQDLVKEMAQTSQIESTSQRSFKVVVLCEADSLTRDAQHGLRRTMEKYANNCKIVLSCESLSRIIEPLQSRCIIINVPAPTDEDVTKVLRKVIERESFLLPENVLQKIVEKSEGNLRRAILMTEALRME----NESGVAESVVIPVPEWEIYIQETARLILQKQSSDMLLKVRERLYELLSRCIPPTVIFKKLLEHLLPKCPPQIA-REVVSEAAKFEHRLVLGQKAIFHLEGFVAAF 342          
BLAST of Replication factor C subunit 5 vs. Ensembl Celegans
Match: rfc-1 (Replication factor C subunit 1 [Source:UniProtKB/TrEMBL;Acc:Q18841])

HSP 1 Score: 65.4698 bits (158), Expect = 2.675e-11
Identity = 64/249 (25.70%), Postives = 115/249 (46.18%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISH---EDIIHTLQNFI---SKGNL------------PHL-----------LFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQ--GKSK-----------LIILDEADAMTKDAQNA-LKRIIE--KYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTS 641
            L W++KY+P+++ +L+     +  I+ L  +I   +K NL            P +           L  G PG GKT+      +Q+  +     ++E+NASD R  + +  +I   + +  I+Q  G  K           ++I+DE D M+ +   A +  +I+  K S+    C+  + Q+  I  + + C   RF   + E I+ R++ I ++EK+    + L+ +I LS  D+RQ I  LQ  S
Sbjct:  278 LSWVDKYKPKRMGELVGQNGDKSPINKLLEWIKDWAKHNLGEGAKIKKPKPAPWMSSQDGTSFKAALLSGSPGVGKTTCAYMACQQLGLQ-----LVEMNASDVRSKKHLEAKIGELSGSHQIEQFFGAKKCAPQDNQKVHHILIMDEVDGMSGNEDRAGISELIQIIKESKIPIICICNDRQHPKIRTLANYCYDLRFPKPRVETIRSRMMTICSQEKMKIGKEELDEIIELSGHDVRQTIYNLQMRS 521          
BLAST of Replication factor C subunit 5 vs. Ensembl Fly
Match: RfC3 (gene:FBgn0032244 transcript:FBtr0080019)

HSP 1 Score: 364.385 bits (934), Expect = 4.582e-125
Identity = 181/320 (56.56%), Postives = 233/320 (72.81%), Query Frame = 3
Query:   24 VNLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYD-KHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDM-KXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKI 977
            V +PW+EKYRP  L+DLISHE+II T+  FIS+  LPHLLFYGPPGTGKTS+ILA A+Q+Y  +  +S+VLELNASDDRGI +VR +ILNFAS  TI     KLIILDEADAMT DAQNAL+RIIEKY++  RFC+ICNY +KIIPA+QSRCTRFRF+PL  +Q+ PRL  II  E V  T DG  AL+ L+ GDMR+ +NVLQ T M+FDTVN  NVY CVG P  QD+ +++  +L    L +S K +   +  + +AL DI+TEL   + ++  P   M +LI+KLA IE  L+ GC++  Q  +LV+AF++ RD +
Sbjct:    9 VRMPWVEKYRPSGLDDLISHEEIISTITRFISRKQLPHLLFYGPPGTGKTSTILACARQLYSPQQFKSMVLELNASDDRGIGIVRGQILNFASTRTIFCDTFKLIILDEADAMTNDAQNALRRIIEKYTDNVRFCVICNYLSKIIPALQSRCTRFRFAPLSQDQMMPRLEKIIEAEAVQITEDGKRALLTLAKGDMRKVLNVLQSTVMAFDTVNEDNVYMCVGYPLRQDIEQILKALLSGSSLEDSFKTVESAKYARGLALEDIITELHLFVMRLELPMSVMNKLIVKLAQIEERLAKGCTEVAQTAALVAAFFICRDMV 328          
BLAST of Replication factor C subunit 5 vs. Ensembl Fly
Match: RfC4 (gene:FBgn0260985 transcript:FBtr0073264)

HSP 1 Score: 224.172 bits (570), Expect = 4.176e-70
Identity = 115/317 (36.28%), Postives = 191/317 (60.25%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASN-MTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDK 974
            +LPWIEKYRP +  +++ +ED +  L  F ++GN P+++  GPPG GKT++I  +A+ +     +  VLELNAS++RGI+VVR +I  FA   +T+ +G+ K++ILDEAD+MT+ AQ AL+R +E YS  TRF L CN   KII  IQSRC   RF+ L   Q+  +LI +   EK+NYT DGLEA++  + GDMRQ +N LQ T+  F  + A NV+    +P P+ ++ +++     ++  + K + ++  K   +  DI+  + ++  ++N  +    + I ++      +  G +  +Q  +L++   +  +K
Sbjct:   15 HLPWIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQCLARILLGDSYKEAVLELNASNERGIDVVRNKIKMFAQQKVTLPRGRHKIVILDEADSMTEGAQQALRRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAKLIEVAKWEKLNYTEDGLEAIVFTAQGDMRQGLNNLQSTAQGFGDITAENVFKVCDEPHPKLLEEMIHHCAANDIHKAYKILAKL-WKLGYSPEDIIANIFRVCKRINIDEHLKLDFIREIGITHMKIIDGINSLLQLTALLAKLCIAAEK 330          
BLAST of Replication factor C subunit 5 vs. Ensembl Fly
Match: CG8142 (gene:FBgn0030871 transcript:FBtr0074472)

HSP 1 Score: 204.527 bits (519), Expect = 2.484e-62
Identity = 97/207 (46.86%), Postives = 144/207 (69.57%), Query Frame = 3
Query:   33 PWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNF---ASNMTIQQGKS----KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQ 632
            PW+EKYRP+ ++D++   +++  L+  +  G+LP++L YGPPGTGKTS+ILA ++Q++    +  +LELNASD+RGI VVRT+I NF   +++     GK     K+IILDEAD+MT  AQ+AL+R +EK S  TRFCLICNY ++II  I SRC++FRF  L  +++  RL +I   E V    D  ++++++S GD+R+AI  LQ
Sbjct:   31 PWVEKYRPRNVDDVVEQSEVVAVLRKCVEGGDLPNMLLYGPPGTGKTSTILAASRQIFGDMFKDRILELNASDERGINVVRTKIKNFSQLSASSVRPDGKPCPPFKIIILDEADSMTHAAQSALRRTMEKESRSTRFCLICNYVSRIIVPITSRCSKFRFKALGEDKVIDRLKYICEMEGVKIEDDAYKSIVKISGGDLRRAITTLQ 237          
BLAST of Replication factor C subunit 5 vs. Ensembl Fly
Match: RfC38 (gene:FBgn0028700 transcript:FBtr0080225)

HSP 1 Score: 112.464 bits (280), Expect = 1.451e-27
Identity = 68/233 (29.18%), Postives = 119/233 (51.07%), Query Frame = 3
Query:   36 WIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV---RSLVLELNASDDRGIEVV-------------------RTEILNF----ASNMTIQ---QGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMS 647
            W++KYRP++L+ L  H+D    L+N   + + PHL+FYGP G GK + I+ + ++MY   V   RS  +      +R +EV+                   RT +++     A    I+   Q + K+I++ E D +TKDAQ+AL+R +EKY    R  +  N  ++IIPAI+SRC   R +     +I   L +    E +    +  + ++  S  ++R+A+ +L+   ++
Sbjct:    4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLRSETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQIEISGQREFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNETEIVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVA 236          
BLAST of Replication factor C subunit 5 vs. Ensembl Fly
Match: RfC38 (gene:FBgn0028700 transcript:FBtr0344786)

HSP 1 Score: 112.464 bits (280), Expect = 1.451e-27
Identity = 68/233 (29.18%), Postives = 119/233 (51.07%), Query Frame = 3
Query:   36 WIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV---RSLVLELNASDDRGIEVV-------------------RTEILNF----ASNMTIQ---QGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMS 647
            W++KYRP++L+ L  H+D    L+N   + + PHL+FYGP G GK + I+ + ++MY   V   RS  +      +R +EV+                   RT +++     A    I+   Q + K+I++ E D +TKDAQ+AL+R +EKY    R  +  N  ++IIPAI+SRC   R +     +I   L +    E +    +  + ++  S  ++R+A+ +L+   ++
Sbjct:    4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLRSETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQIEISGQREFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNETEIVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVA 236          
BLAST of Replication factor C subunit 5 vs. Ensembl Zebrafish
Match: rfc5 (replication factor C (activator 1) 5 [Source:ZFIN;Acc:ZDB-GENE-040907-1])

HSP 1 Score: 377.481 bits (968), Expect = 5.520e-130
Identity = 185/316 (58.54%), Postives = 241/316 (76.27%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRD 971
            NLPW+EKYRPQ L+DLISH+DI+ T+Q FIS+  LPHLLFYGPPGTGKTS+ILA A+Q+Y DK   S+VLELNASDDRGI+VVR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL   Q+ PRL H+I +E ++ TPDG++A++ LS GDMR+++N+LQ T M++  V    VY C G P   D+  IL+  LN++   +  ++ E++T K +AL DI+TE+  L+ +V+FP      L+IKLADIE  L+ G S+KIQ  S+V+AF  VRD
Sbjct:   13 NLPWVEKYRPQTLDDLISHQDILSTIQKFISEDRLPHLLFYGPPGTGKTSTILACARQLYKDKEFNSMVLELNASDDRGIDVVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLSQNQMIPRLEHVIQQESIDITPDGMKAIVTLSTGDMRRSLNILQSTHMAYGKVTEETVYTCTGHPLRSDIANILDWALNKDFTTAYNQILELKTLKGLALHDILTEVHLLIHRVDFPPSIRMGLLIKLADIEYRLASGTSEKIQLSSMVAAFQAVRD 328          
BLAST of Replication factor C subunit 5 vs. Ensembl Zebrafish
Match: rfc2 (replication factor C (activator 1) 2 [Source:ZFIN;Acc:ZDB-GENE-050306-29])

HSP 1 Score: 233.802 bits (595), Expect = 3.682e-73
Identity = 111/225 (49.33%), Postives = 159/225 (70.67%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASN-MTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTP 701
            LPW+EKYRP +LN+++ +E+ +  L+ F  +GN+P+++  GPPGTGKT+SIL +A+ +    ++  VLELNAS+DRGI+VVR +I  FA   +T+ +G+ K+IILDEAD+MT  AQ AL+R +E YS+ TRF L CN  +KII  IQSRC   R+S L+ EQI  RL  ++ +E ++ T DGLEA+I  + GDMRQA+N LQ T+  F  +N+ NV+    +P P
Sbjct:   66 LPWVEKYRPLKLNEIVGNEETVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPAMKDAVLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYSKLRDEQIMMRLTEVVEKENLHVTNDGLEAIIFTAQGDMRQALNNLQSTNSGFGYINSENVFKVCDEPHP 290          
BLAST of Replication factor C subunit 5 vs. Ensembl Zebrafish
Match: rfc4 (replication factor C (activator 1) 4 [Source:ZFIN;Acc:ZDB-GENE-040824-3])

HSP 1 Score: 189.119 bits (479), Expect = 7.573e-58
Identity = 92/186 (49.46%), Postives = 131/186 (70.43%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFAS---NMTIQQGKS----KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYT 563
            +PW+EKYRP+ ++++   E+++  L+  +   +LP+LLFYGPPGTGKTS+ILA A+++Y   + R  VLELNASD+RGI+VVR ++  FA      T   GK+    K+IILDEAD+MT  AQ AL+R +EK S  TRFCLICNY ++II  + SRC++FRF PL ++  Q R++ I  +E + YT
Sbjct:   33 VPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELYGPDLYRQRVLELNASDERGIQVVREKVKRFAQLTVAGTRPDGKTCPPFKIIILDEADSMTSAAQAALRRTMEKESRTTRFCLICNYVSRIIEPLTSRCSKFRFKPLANDVQQERILEICRKENLKYT 218          
BLAST of Replication factor C subunit 5 vs. Ensembl Zebrafish
Match: rfc4 (replication factor C (activator 1) 4 [Source:ZFIN;Acc:ZDB-GENE-040824-3])

HSP 1 Score: 189.119 bits (479), Expect = 7.573e-58
Identity = 92/186 (49.46%), Postives = 131/186 (70.43%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFAS---NMTIQQGKS----KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYT 563
            +PW+EKYRP+ ++++   E+++  L+  +   +LP+LLFYGPPGTGKTS+ILA A+++Y   + R  VLELNASD+RGI+VVR ++  FA      T   GK+    K+IILDEAD+MT  AQ AL+R +EK S  TRFCLICNY ++II  + SRC++FRF PL ++  Q R++ I  +E + YT
Sbjct:   33 VPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELYGPDLYRQRVLELNASDERGIQVVREKVKRFAQLTVAGTRPDGKTCPPFKIIILDEADSMTSAAQAALRRTMEKESRTTRFCLICNYVSRIIEPLTSRCSKFRFKPLANDVQQERILEICRKENLKYT 218          
BLAST of Replication factor C subunit 5 vs. Ensembl Zebrafish
Match: rfc4 (replication factor C (activator 1) 4 [Source:ZFIN;Acc:ZDB-GENE-040824-3])

HSP 1 Score: 192.586 bits (488), Expect = 1.541e-57
Identity = 97/209 (46.41%), Postives = 140/209 (66.99%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFAS---NMTIQQGKS----KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQ 632
            +PW+EKYRP+ ++++   E+++  L+  +   +LP+LLFYGPPGTGKTS+ILA A+++Y   + R  VLELNASD+RGI+VVR ++  FA      T   GK+    K+IILDEAD+MT  AQ AL+R +EK S  TRFCLICNY ++II  + SRC++FRF PL ++  Q R++ I  +E + YT + ++ L +    DM  A   L 
Sbjct:   33 VPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELYGPDLYRQRVLELNASDERGIQVVREKVKRFAQLTVAGTRPDGKTCPPFKIIILDEADSMTSAAQAALRRTMEKESRTTRFCLICNYVSRIIEPLTSRCSKFRFKPLANDVQQERILEICRKENLKYTTEIIQCLRQKQQLDMTAAATALH 241          
BLAST of Replication factor C subunit 5 vs. Ensembl Xenopus
Match: rfc5 (replication factor C subunit 5 [Source:NCBI gene;Acc:496525])

HSP 1 Score: 380.948 bits (977), Expect = 3.020e-131
Identity = 185/322 (57.45%), Postives = 247/322 (76.71%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            NLPW+EKYRPQ L+DLISH+DI+ T+Q FIS+  LPHLLFYGPPGTGKTS+ILA AKQ+Y D+   S+VLELNASDDRGI++VR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL  E + PRL H++ EE V+ +PDG++AL+ LSNGDMR+++N+LQ T+M++  V    VY C G P   D+  IL+ +LN++  ++ K + E++T K +AL DI+TE+   + +V+FP      L+IK+AD+E  L+ G S+KIQ  SL++AF + RD + A A
Sbjct:   14 NLPWVEKYRPQTLDDLISHQDILSTIQRFISEDKLPHLLFYGPPGTGKTSTILACAKQLYKDREFNSMVLELNASDDRGIDIVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLSPEMMVPRLEHVVKEECVDISPDGMKALVTLSNGDMRRSLNILQSTNMAYGKVTEDTVYTCTGHPLRSDIANILDWMLNKDFTSAYKNIMELKTLKGLALHDILTEVHLYVHRVDFPASVRMHLLIKMADVEYRLASGTSEKIQLSSLIAAFQVARDMVAAEA 335          
BLAST of Replication factor C subunit 5 vs. Ensembl Xenopus
Match: rfc5 (replication factor C subunit 5 [Source:NCBI gene;Acc:496525])

HSP 1 Score: 371.703 bits (953), Expect = 2.572e-127
Identity = 182/320 (56.88%), Postives = 244/320 (76.25%), Query Frame = 3
Query:   33 PWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            P +EKYRPQ L+DLISH+DI+ T+Q FIS+  LPHLLFYGPPGTGKTS+ILA AKQ+Y D+   S+VLELNASDDRGI++VR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL  E + PRL H++ EE V+ +PDG++AL+ LSNGDMR+++N+LQ T+M++  V    VY C G P   D+  IL+ +LN++  ++ K + E++T K +AL DI+TE+   + +V+FP      L+IK+AD+E  L+ G S+KIQ  SL++AF + RD + A A
Sbjct:   30 PLVEKYRPQTLDDLISHQDILSTIQRFISEDKLPHLLFYGPPGTGKTSTILACAKQLYKDREFNSMVLELNASDDRGIDIVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLSPEMMVPRLEHVVKEECVDISPDGMKALVTLSNGDMRRSLNILQSTNMAYGKVTEDTVYTCTGHPLRSDIANILDWMLNKDFTSAYKNIMELKTLKGLALHDILTEVHLYVHRVDFPASVRMHLLIKMADVEYRLASGTSEKIQLSSLIAAFQVARDMVAAEA 349          
BLAST of Replication factor C subunit 5 vs. Ensembl Xenopus
Match: rfc5 (replication factor C subunit 5 [Source:NCBI gene;Acc:496525])

HSP 1 Score: 370.548 bits (950), Expect = 3.446e-127
Identity = 181/318 (56.92%), Postives = 243/318 (76.42%), Query Frame = 3
Query:   39 IEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            +EKYRPQ L+DLISH+DI+ T+Q FIS+  LPHLLFYGPPGTGKTS+ILA AKQ+Y D+   S+VLELNASDDRGI++VR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL  E + PRL H++ EE V+ +PDG++AL+ LSNGDMR+++N+LQ T+M++  V    VY C G P   D+  IL+ +LN++  ++ K + E++T K +AL DI+TE+   + +V+FP      L+IK+AD+E  L+ G S+KIQ  SL++AF + RD + A A
Sbjct:    8 VEKYRPQTLDDLISHQDILSTIQRFISEDKLPHLLFYGPPGTGKTSTILACAKQLYKDREFNSMVLELNASDDRGIDIVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLSPEMMVPRLEHVVKEECVDISPDGMKALVTLSNGDMRRSLNILQSTNMAYGKVTEDTVYTCTGHPLRSDIANILDWMLNKDFTSAYKNIMELKTLKGLALHDILTEVHLYVHRVDFPASVRMHLLIKMADVEYRLASGTSEKIQLSSLIAAFQVARDMVAAEA 325          
BLAST of Replication factor C subunit 5 vs. Ensembl Xenopus
Match: rfc5 (replication factor C subunit 5 [Source:NCBI gene;Acc:496525])

HSP 1 Score: 370.548 bits (950), Expect = 3.719e-127
Identity = 181/318 (56.92%), Postives = 243/318 (76.42%), Query Frame = 3
Query:   39 IEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            +EKYRPQ L+DLISH+DI+ T+Q FIS+  LPHLLFYGPPGTGKTS+ILA AKQ+Y D+   S+VLELNASDDRGI++VR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL  E + PRL H++ EE V+ +PDG++AL+ LSNGDMR+++N+LQ T+M++  V    VY C G P   D+  IL+ +LN++  ++ K + E++T K +AL DI+TE+   + +V+FP      L+IK+AD+E  L+ G S+KIQ  SL++AF + RD + A A
Sbjct:   15 VEKYRPQTLDDLISHQDILSTIQRFISEDKLPHLLFYGPPGTGKTSTILACAKQLYKDREFNSMVLELNASDDRGIDIVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLSPEMMVPRLEHVVKEECVDISPDGMKALVTLSNGDMRRSLNILQSTNMAYGKVTEDTVYTCTGHPLRSDIANILDWMLNKDFTSAYKNIMELKTLKGLALHDILTEVHLYVHRVDFPASVRMHLLIKMADVEYRLASGTSEKIQLSSLIAAFQVARDMVAAEA 332          
BLAST of Replication factor C subunit 5 vs. Ensembl Xenopus
Match: rfc5 (replication factor C subunit 5 [Source:NCBI gene;Acc:496525])

HSP 1 Score: 370.163 bits (949), Expect = 4.161e-127
Identity = 181/318 (56.92%), Postives = 243/318 (76.42%), Query Frame = 3
Query:   39 IEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            +EKYRPQ L+DLISH+DI+ T+Q FIS+  LPHLLFYGPPGTGKTS+ILA AKQ+Y D+   S+VLELNASDDRGI++VR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL  E + PRL H++ EE V+ +PDG++AL+ LSNGDMR+++N+LQ T+M++  V    VY C G P   D+  IL+ +LN++  ++ K + E++T K +AL DI+TE+   + +V+FP      L+IK+AD+E  L+ G S+KIQ  SL++AF + RD + A A
Sbjct:   10 VEKYRPQTLDDLISHQDILSTIQRFISEDKLPHLLFYGPPGTGKTSTILACAKQLYKDREFNSMVLELNASDDRGIDIVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLSPEMMVPRLEHVVKEECVDISPDGMKALVTLSNGDMRRSLNILQSTNMAYGKVTEDTVYTCTGHPLRSDIANILDWMLNKDFTSAYKNIMELKTLKGLALHDILTEVHLYVHRVDFPASVRMHLLIKMADVEYRLASGTSEKIQLSSLIAAFQVARDMVAAEA 327          
BLAST of Replication factor C subunit 5 vs. Ensembl Mouse
Match: Rfc5 (replication factor C (activator 1) 5 [Source:MGI Symbol;Acc:MGI:1919401])

HSP 1 Score: 378.252 bits (970), Expect = 3.053e-130
Identity = 187/322 (58.07%), Postives = 243/322 (75.47%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            NLPW+EKYRPQ L DLISH+DI+ T+Q FIS+  LPHLL YGPPGTGKTS+ILA AKQ+Y DK   S+VLELNASDDRGI++VR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL  E + PRL H++ EE V+ + DG++AL+ LS+GDMR+A+N+LQ T+M+F  V    VY C G P   D+  IL+ +LN++   + K + E++T K +AL DI+TE+   + +V+FP      L+ K+ADIE  LS+G S+KIQ  SL++AF + RD I A A
Sbjct:   18 NLPWVEKYRPQTLADLISHQDILSTIQKFISEDRLPHLLLYGPPGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVQEENVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKTDIANILDWMLNQDFTTAYKNIMELKTLKGLALHDILTEVHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTSEKIQLSSLIAAFQVTRDLIVAEA 339          
BLAST of Replication factor C subunit 5 vs. Ensembl Mouse
Match: Rfc2 (replication factor C (activator 1) 2 [Source:MGI Symbol;Acc:MGI:1341868])

HSP 1 Score: 235.728 bits (600), Expect = 2.570e-74
Identity = 113/225 (50.22%), Postives = 159/225 (70.67%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASN-MTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTP 701
            LPW+EKYRP +LN+++ +ED +  L+ F  +GN+P+++  GPPGTGKT+SIL +A+ +    ++  VLELNAS+DRGI+VVR +I  FA   +T+ +G+ K+IILDEAD+MT  AQ AL+R +E YS+ TRF L CN  +KII  IQSRC   R++ L   Q+  RL+++I +EKV YT DGLEA+I  + GDMRQA+N LQ T   F  +N+ NV+    +P P
Sbjct:   31 LPWVEKYRPLKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAVLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQVLTRLMNVIEKEKVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFGYINSENVFKVCDEPHP 255          
BLAST of Replication factor C subunit 5 vs. Ensembl Mouse
Match: Rfc4 (replication factor C (activator 1) 4 [Source:MGI Symbol;Acc:MGI:2146571])

HSP 1 Score: 203.756 bits (517), Expect = 1.002e-61
Identity = 98/213 (46.01%), Postives = 148/213 (69.48%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKS--------KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTS 641
            +PW+EKYRP+ ++++   ++++  L+  +   +LP+LLFYGPPGTGKTS+ILA A++++   + R  VLELNASD+RGI+VVR ++ NFA  +T+   +S        K++ILDEAD+MT  AQ AL+R +EK S+ TRFCLICNY ++II  + SRC++FRF PL  +  Q RL+ I  +E V    + +  L+++S GD+R+AI  LQ  +
Sbjct:   38 VPWVEKYRPKCVDEVAFQDEVVAVLRKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFA-QLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQERLLDIAEKENVKIGNEEIAYLVKISEGDLRKAITFLQSAT 249          
BLAST of Replication factor C subunit 5 vs. Ensembl Mouse
Match: Rfc4 (replication factor C (activator 1) 4 [Source:MGI Symbol;Acc:MGI:2146571])

HSP 1 Score: 202.986 bits (515), Expect = 2.070e-61
Identity = 98/213 (46.01%), Postives = 148/213 (69.48%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKS--------KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTS 641
            +PW+EKYRP+ ++++   ++++  L+  +   +LP+LLFYGPPGTGKTS+ILA A++++   + R  VLELNASD+RGI+VVR ++ NFA  +T+   +S        K++ILDEAD+MT  AQ AL+R +EK S+ TRFCLICNY ++II  + SRC++FRF PL  +  Q RL+ I  +E V    + +  L+++S GD+R+AI  LQ  +
Sbjct:   38 VPWVEKYRPKCVDEVAFQDEVVAVLRKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFA-QLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQERLLDIAEKENVKIGNEEIAYLVKISEGDLRKAITFLQSAT 249          
BLAST of Replication factor C subunit 5 vs. Ensembl Mouse
Match: Rfc4 (replication factor C (activator 1) 4 [Source:MGI Symbol;Acc:MGI:2146571])

HSP 1 Score: 186.808 bits (473), Expect = 8.506e-57
Identity = 90/197 (45.69%), Postives = 137/197 (69.54%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKS--------KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRL 593
            +PW+EKYRP+ ++++   ++++  L+  +   +LP+LLFYGPPGTGKTS+ILA A++++   + R  VLELNASD+RGI+VVR ++ NFA  +T+   +S        K++ILDEAD+MT  AQ AL+R +EK S+ TRFCLICNY ++II  + SRC++FRF PL  +  Q RL+ I  +E V    + +  L+++
Sbjct:   38 VPWVEKYRPKCVDEVAFQDEVVAVLRKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFA-QLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQERLLDIAEKENVKIGNEEIAYLVKI 233          
BLAST of Replication factor C subunit 5 vs. UniProt/SwissProt
Match: sp|P40937|RFC5_HUMAN (Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5 PE=1 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 3.172e-130
Identity = 186/322 (57.76%), Postives = 246/322 (76.40%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            NLPW+EKYRPQ LNDLISH+DI+ T+Q FI++  LPHLL YGPPGTGKTS+ILA AKQ+Y DK   S+VLELNASDDRGI+++R  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL  E + PRL H++ EEKV+ + DG++AL+ LS+GDMR+A+N+LQ T+M+F  V    VY C G P   D+  IL+ +LN++   + + +TE++T K +AL DI+TE+   + +V+FP      L+ K+ADIE  LS+G ++KIQ  SL++AF + RD I A A
Sbjct:   19 NLPWVEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYGPPGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIIRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA 340          
BLAST of Replication factor C subunit 5 vs. UniProt/SwissProt
Match: sp|Q9D0F6|RFC5_MOUSE (Replication factor C subunit 5 OS=Mus musculus OX=10090 GN=Rfc5 PE=1 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 2.136e-129
Identity = 187/322 (58.07%), Postives = 243/322 (75.47%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            NLPW+EKYRPQ L DLISH+DI+ T+Q FIS+  LPHLL YGPPGTGKTS+ILA AKQ+Y DK   S+VLELNASDDRGI++VR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL  E + PRL H++ EE V+ + DG++AL+ LS+GDMR+A+N+LQ T+M+F  V    VY C G P   D+  IL+ +LN++   + K + E++T K +AL DI+TE+   + +V+FP      L+ K+ADIE  LS+G S+KIQ  SL++AF + RD I A A
Sbjct:   18 NLPWVEKYRPQTLADLISHQDILSTIQKFISEDRLPHLLLYGPPGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVQEENVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKTDIANILDWMLNQDFTTAYKNIMELKTLKGLALHDILTEVHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTSEKIQLSSLIAAFQVTRDLIVAEA 339          
BLAST of Replication factor C subunit 5 vs. UniProt/SwissProt
Match: sp|P34429|RFC5_CAEEL (Probable replication factor C subunit 5 OS=Caenorhabditis elegans OX=6239 GN=F44B9.8 PE=3 SV=3)

HSP 1 Score: 337.421 bits (864), Expect = 7.225e-113
Identity = 169/315 (53.65%), Postives = 224/315 (71.11%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYD-KHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKS---------KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTK---KCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQ 932
            NLPW+EKYRP +L++L++HE I+ TL  FI    LPHLLFYGPPGTGKT+++LA A+QMY    + S+VLELNASD+RGI+VVR  I+NFA    +Q   +         KL+ILDEADAMTKDAQNAL+R+IEKY++  RFC+ICNY   I+PAIQSRCTRFRF+PL  + I PRL +I+  E++  TPDG +AL+ +S GDMR  IN LQ T+MSFDTV+   VY C+G+PTP++MK ++  LLN+    S K M  I+TK      AL D++T L   +  ++ PD AM+ +I  L ++E NLS GCS++ Q
Sbjct:   28 NLPWVEKYRPSKLDELVAHEQIVKTLTKFIENRTLPHLLFYGPPGTGKTTTVLAAARQMYSPTKMASMVLELNASDERGIDVVRNTIVNFAQTKGLQAFSTSSNTGTVPFKLVILDEADAMTKDAQNALRRVIEKYTDNVRFCIICNYLASIVPAIQSRCTRFRFAPLDQKLIVPRLEYIVETEQLKMTPDGKDALLIVSKGDMRTVINTLQSTAMSFDTVSENTVYQCIGQPTPKEMKEVVKTLLNDP---SKKCMNTIQTKLFENGYALQDVITHLHDFVFTLDIPDEAMSAIITGLGEVEENLSTGCSNETQ 339          
BLAST of Replication factor C subunit 5 vs. UniProt/SwissProt
Match: sp|Q9CAQ8|RFC5_ARATH (Replication factor C subunit 5 OS=Arabidopsis thaliana OX=3702 GN=RFC5 PE=1 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 4.510e-110
Identity = 167/330 (50.61%), Postives = 228/330 (69.09%), Query Frame = 3
Query:   33 PWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKS--KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDT--------VNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAAQ 992
            PW+EKYRPQ L+D+ +H DII T+    ++  LPHLL YGPPGTGKTS+ILA+A+++Y    R+++LELNASDDRGI+VVR +I +FAS  +   GKS  KL++LDEADAMTKDAQ AL+R+IEKY++ TRF LI N+ NKIIPA+QSRCTRFRF+PL    +  RL H+I  E++  +  GL AL+RLSNGDMR+A+N+LQ T M+           +   +VY C G P P+D++ I + LLN+      K ++EI+T+K +A+ DIV E+   + K+  P     +LI  LADIE  LS GC+DK+Q  +++S F   R  I  AA+
Sbjct:   40 PWVEKYRPQSLDDVAAHRDIIDTIDRLTNENKLPHLLLYGPPGTGKTSTILAVARKLYGPKYRNMILELNASDDRGIDVVRQQIQDFASTQSFSLGKSSVKLVLLDEADAMTKDAQFALRRVIEKYTKSTRFALIGNHVNKIIPALQSRCTRFRFAPLDGVHMSQRLKHVIEAERLVVSDCGLAALVRLSNGDMRKALNILQSTHMASKEITEEESKQITEEDVYLCTGNPLPKDIEQISHWLLNKPFDECYKDVSEIKTRKGLAIVDIVKEITLFIFKIKMPSAVRVQLINDLADIEYRLSFGCNDKLQLGAIISTFTHARSIIVGAAK 369          
BLAST of Replication factor C subunit 5 vs. UniProt/SwissProt
Match: sp|Q6YZ54|RFC3_ORYSJ (Replication factor C subunit 3 OS=Oryza sativa subsp. japonica OX=39947 GN=RFC3 PE=2 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 9.970e-110
Identity = 161/323 (49.85%), Postives = 223/323 (69.04%), Query Frame = 3
Query:   33 PWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKS---KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAAQ 992
            PW+EKYRPQ L D+ +H DI+ T+    ++  LPHLL YGPPGTGKTS+ILA+A+++Y     +++LELNASD+RGI+VVR +I +FAS  ++  G     K+++LDEADAMTKDAQ AL+R+IEK++  TRF LICN+ NKIIPA+QSRCTRFRF+PL    ++ RL HII  E ++    GL AL+RLSNGDMR+A+N+LQ T M+   +    VY C G P P+D++ I   LLNE  + S K +++++ +K +AL DI+ E+   + K+  P     +LI  LADIE  LS  C+DK+Q  +L+S F   R  + AAA 
Sbjct:   39 PWVEKYRPQSLGDVAAHRDIVDTIDRLTNENRLPHLLLYGPPGTGKTSTILAVARKLYGSQYGNMILELNASDERGIDVVRQQIQDFASARSLSFGAKQSVKMVLLDEADAMTKDAQFALRRVIEKHTRSTRFALICNHVNKIIPALQSRCTRFRFAPLDGTHVRERLKHIIQSEGLDVDDGGLTALVRLSNGDMRKALNILQSTHMASKQITEEAVYLCTGNPMPKDIEQIAYWLLNESFSTSFKCISDMKMRKGLALVDIIREVTMFVFKIQMPSDVRIKLINDLADIEYRLSFACNDKLQLGALISTFTGARTAMVAAAH 361          
BLAST of Replication factor C subunit 5 vs. TrEMBL
Match: A0A0V1DHQ0 (Replication factor C subunit 5 (Fragment) OS=Trichinella britovi OX=45882 GN=Rfc5 PE=4 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 2.911e-133
Identity = 191/321 (59.50%), Postives = 252/321 (78.50%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKH-VRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            LPW+EKYRP +L +LISH+DI+ T+  FI++  LPHLLFYGPPGTGKTS+ILA AKQ+Y+K+ ++S+VLELNASDDRGI VVR +ILNFAS  TI  G+ K+IILDEADAMT+DAQNAL+RIIEKY++  RFCLICNY +KIIP +QSRCTRFRF+PLKS QI PRL+H+I  EKV +T +GL+ L+ LS GDMR+A+N+LQ T+M+FD VN  NVYACVGKP P D++ I+  L N++ + + KR+T ++ KK +AL DI+ E+   + KV  P +    LI +LA+IE +L+ G SDK+Q  +L++AF++ RD I   A
Sbjct:   16 LPWVEKYRPSKLEELISHKDILETIGRFINENRLPHLLFYGPPGTGKTSTILACAKQLYEKNQLKSMVLELNASDDRGIGVVREQILNFASTKTIFGGRFKMIILDEADAMTRDAQNALRRIIEKYTDNVRFCLICNYLSKIIPPLQSRCTRFRFAPLKSNQITPRLMHVIEAEKVKFTEEGLQHLVLLSGGDMRRALNILQSTAMAFDMVNMENVYACVGKPKPDDIRAIVEWLFNKDFSETYKRITFLKLKKGLALQDILEEVHLFVQKVEIPALVRIYLIDRLAEIEESLTRGASDKLQLSALIAAFHIARDIIEKEA 336          
BLAST of Replication factor C subunit 5 vs. TrEMBL
Match: A0A0V1KBT6 (Replication factor C subunit 5 (Fragment) OS=Trichinella pseudospiralis OX=6337 GN=RFC5 PE=4 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 2.728e-131
Identity = 189/321 (58.88%), Postives = 251/321 (78.19%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKH-VRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            LPW+EKYRP +L +LISH+DI+ T+  FI++  LPHLLFYGPPGTGKTS+ILA A+Q+Y+K+ ++S+VLELNASDDRGI VVR +ILNFAS  TI  G+ K+IILDEADAMT+DAQNAL+RII+KY++  RFCLICNY +KIIP +QSRCTRFRF+PLKS QI PRL+H+I  EKV +T +GL+ L+ LS GDMR+A+N+LQ T+M+FD VN  NVYACVGKP P D+K I+  L N++ + + KR+T ++ KK +AL DI+ E+   + KV  P +    LI +LA+IE +L+ G SDK+Q  +L++ F++ RD I   A
Sbjct:   23 LPWVEKYRPSKLEELISHKDILETIGRFINEDRLPHLLFYGPPGTGKTSTILACARQLYEKNQLKSMVLELNASDDRGIGVVREQILNFASTKTIFGGRFKMIILDEADAMTRDAQNALRRIIKKYTDNVRFCLICNYLSKIIPPLQSRCTRFRFAPLKSNQIIPRLMHVIEAEKVKFTEEGLQHLVVLSGGDMRRALNILQSTTMAFDLVNMENVYACVGKPKPDDIKAIVEWLFNKDFSETYKRITFLKLKKGLALQDILEEVHLFVHKVEIPTLVRMYLIDRLAEIEESLTRGASDKLQLSALIATFHIARDIIEKEA 343          
BLAST of Replication factor C subunit 5 vs. TrEMBL
Match: A0A1U7SB46 (replication factor C subunit 5 isoform X1 OS=Alligator sinensis OX=38654 GN=RFC5 PE=4 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 5.423e-131
Identity = 192/322 (59.63%), Postives = 250/322 (77.64%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            NLPW+EKYRPQ L+DLISH+DI+ T+Q FIS+  LPHLL YGPPGTGKTS+ILA AKQ+Y DK   S+VLELNASDDRGI++VR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL  E + PR+ H+I+EEKV+ T DG++AL+ LS+GDMR+A+N+LQ TSM+F+ V    VY C G P   D+  IL+ +LN++   + KR+ E++T K +AL DI+TE+   + +V+FP    T+L+IK+ADIE  L+ G S+KIQ  SL++AF + RD I A A
Sbjct:   15 NLPWVEKYRPQTLSDLISHQDILSTIQKFISEDRLPHLLLYGPPGTGKTSTILACAKQLYKDKEFNSMVLELNASDDRGIDIVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRVQHVIDEEKVDITDDGMKALVTLSSGDMRRALNILQSTSMAFEKVTEETVYTCTGHPLKSDIANILDWMLNQDFTMAYKRIMELKTLKGLALHDILTEIHLFVHRVDFPASVRTQLLIKMADIEYRLAAGTSEKIQLSSLIAAFQVTRDLIVAEA 336          
BLAST of Replication factor C subunit 5 vs. TrEMBL
Match: A0A151N4L9 (Replication factor C subunit 5 OS=Alligator mississippiensis OX=8496 GN=RFC5 PE=4 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 7.046e-131
Identity = 193/322 (59.94%), Postives = 249/322 (77.33%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            NLPW+EKYRPQ L+DLISH+DI+ T+Q FIS+  LPHLL YGPPGTGKTS+ILA AKQ+Y DK   S+VLELNASDDRGI++VR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL  E + PRL H+I+EEKV+ T DG++AL+ LS+GDMR+A+N+LQ TSM+F  V    VY C G P   D+  IL+ +LN++   + KR+ E++T K +AL DI+TE+   + +V+FP    T+L+IK+ADIE  L+ G S+KIQ  SL++AF + RD I A A
Sbjct:   15 NLPWVEKYRPQTLSDLISHQDILSTIQKFISEDRLPHLLLYGPPGTGKTSTILACAKQLYKDKEFNSMVLELNASDDRGIDIVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLQHVIDEEKVDITNDGMKALVTLSSGDMRRALNILQSTSMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTMAYKRIMELKTLKGLALHDILTEIHLFVHRVDFPASVRTQLLIKMADIEYRLAAGTSEKIQLSSLIAAFQVTRDLIVAEA 336          
BLAST of Replication factor C subunit 5 vs. TrEMBL
Match: A0A0V1KBN6 (Replication factor C subunit 5 OS=Trichinella pseudospiralis OX=6337 GN=RFC5 PE=4 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 7.155e-131
Identity = 189/321 (58.88%), Postives = 251/321 (78.19%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKH-VRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            LPW+EKYRP +L +LISH+DI+ T+  FI++  LPHLLFYGPPGTGKTS+ILA A+Q+Y+K+ ++S+VLELNASDDRGI VVR +ILNFAS  TI  G+ K+IILDEADAMT+DAQNAL+RII+KY++  RFCLICNY +KIIP +QSRCTRFRF+PLKS QI PRL+H+I  EKV +T +GL+ L+ LS GDMR+A+N+LQ T+M+FD VN  NVYACVGKP P D+K I+  L N++ + + KR+T ++ KK +AL DI+ E+   + KV  P +    LI +LA+IE +L+ G SDK+Q  +L++ F++ RD I   A
Sbjct:   41 LPWVEKYRPSKLEELISHKDILETIGRFINEDRLPHLLFYGPPGTGKTSTILACARQLYEKNQLKSMVLELNASDDRGIGVVREQILNFASTKTIFGGRFKMIILDEADAMTRDAQNALRRIIKKYTDNVRFCLICNYLSKIIPPLQSRCTRFRFAPLKSNQIIPRLMHVIEAEKVKFTEEGLQHLVVLSGGDMRRALNILQSTTMAFDLVNMENVYACVGKPKPDDIKAIVEWLFNKDFSETYKRITFLKLKKGLALQDILEEVHLFVHKVEIPTLVRMYLIDRLAEIEESLTRGASDKLQLSALIATFHIARDIIEKEA 361          
BLAST of Replication factor C subunit 5 vs. Ensembl Cavefish
Match: rfc5 (replication factor C subunit 5 [Source:NCBI gene;Acc:103039707])

HSP 1 Score: 373.629 bits (958), Expect = 1.288e-128
Identity = 183/316 (57.91%), Postives = 241/316 (76.27%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRD 971
            NLPW+EKYRPQ L+DLISH+DI+ T+Q FIS+  LPHLLFYGPPGTGKTS+ILA AKQ+Y DK   S+VLELNASDDRGI+VVR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL   Q+ PRL H+I +E ++ +PDG++A++ LS GDMR+++N+LQ T M++  V    VY C G P   D+  IL+  LN++   +  ++ +++T K +AL DI+TE+  L+ +V+FP      L+IKLADIE  L+ G ++KIQ  S+V+AF  VRD
Sbjct:   13 NLPWVEKYRPQTLDDLISHQDILSTIQKFISEDRLPHLLFYGPPGTGKTSTILACAKQLYKDKEFNSMVLELNASDDRGIDVVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLSQNQMIPRLEHVIQQENIDISPDGMKAIVTLSTGDMRRSLNILQSTHMAYGKVTEETVYTCTGHPLRSDIANILDWALNKDFTTAYNQILQLKTLKGLALHDILTEVHLLIHRVDFPPSIRMGLLIKLADIEYRLASGTNEKIQLSSMVAAFQAVRD 328          
BLAST of Replication factor C subunit 5 vs. Ensembl Cavefish
Match: rfc2 (replication factor C (activator 1) 2 [Source:ZFIN;Acc:ZDB-GENE-050306-29])

HSP 1 Score: 236.498 bits (602), Expect = 4.316e-74
Identity = 111/228 (48.68%), Postives = 161/228 (70.61%), Query Frame = 3
Query:   21 TVNLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASN-MTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTP 701
            +  LPW+EKYRP +LN+++ +E+ +  L+ F  +GN+P+++  GPPGTGKT+SIL +A+ +    ++  VLELNAS+DRGI+VVR +I  FA   +T+ +G+ K+IILDEAD+MT  AQ AL+R +E YS+ TRF L CN  +KII  IQSRC   R+S L+ EQI  RL+ ++ +E ++ T DGLEA+I  + GDMRQA+N LQ T+  F  +N+ NV+    +P P
Sbjct:   69 SYELPWVEKYRPMKLNEIVGNEETVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPAMKDAVLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYSKLRDEQIMMRLMEVVEKENLHTTNDGLEAIIFTAQGDMRQALNNLQSTNSGFGFINSENVFKVCDEPHP 296          
BLAST of Replication factor C subunit 5 vs. Ensembl Cavefish
Match: rfc2 (replication factor C (activator 1) 2 [Source:ZFIN;Acc:ZDB-GENE-050306-29])

HSP 1 Score: 235.343 bits (599), Expect = 1.856e-73
Identity = 111/228 (48.68%), Postives = 161/228 (70.61%), Query Frame = 3
Query:   21 TVNLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASN-MTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTP 701
            +  LPW+EKYRP +LN+++ +E+ +  L+ F  +GN+P+++  GPPGTGKT+SIL +A+ +    ++  VLELNAS+DRGI+VVR +I  FA   +T+ +G+ K+IILDEAD+MT  AQ AL+R +E YS+ TRF L CN  +KII  IQSRC   R+S L+ EQI  RL+ ++ +E ++ T DGLEA+I  + GDMRQA+N LQ T+  F  +N+ NV+    +P P
Sbjct:   69 SYELPWVEKYRPMKLNEIVGNEETVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPAMKDAVLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYSKLRDEQIMMRLMEVVEKENLHTTNDGLEAIIFTAQGDMRQALNNLQSTNSGFGFINSENVFKVCDEPHP 296          
BLAST of Replication factor C subunit 5 vs. Ensembl Cavefish
Match: rfc4 (replication factor C (activator 1) 4 [Source:ZFIN;Acc:ZDB-GENE-040824-3])

HSP 1 Score: 219.935 bits (559), Expect = 5.232e-68
Identity = 106/213 (49.77%), Postives = 155/213 (72.77%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFASNMTIQ----QGKS----KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTS 641
            +PW+EKYRP+ ++++   E+++  L+  +   +LP+LLFYGPPGTGKTS+ILA A+++Y   + R  VLELNASD+RGI+VVR ++ NFA  +T+      GK     K+IILDEAD+MT  AQ AL+R +EK S  TRFCLICNY ++II  + SRC++FRF PL ++  + RL+ I  +E + YT +G+EAL+++S GD+R+AI +LQ T+
Sbjct:   49 VPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELYGPELYRQRVLELNASDERGIQVVREKVKNFA-QLTVAGKRPDGKHCPPFKIIILDEADSMTNAAQAALRRTMEKESRTTRFCLICNYVSRIIEPLTSRCSKFRFKPLANDIQRERLVEICEKENLKYTKEGIEALVKVSEGDLRKAITLLQSTA 260          
BLAST of Replication factor C subunit 5 vs. Ensembl Cavefish
Match: rfc4 (replication factor C (activator 1) 4 [Source:ZFIN;Acc:ZDB-GENE-040824-3])

HSP 1 Score: 189.889 bits (481), Expect = 3.876e-57
Identity = 100/223 (44.84%), Postives = 147/223 (65.92%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFASNMTIQ----QGKS----KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQ-CTSMSFDTVNAA 668
            +PW+EKYRP+ ++++   E+++  L+  +   +LP+LLFYGPPGTGKTS+ILA A+++Y   + R  VLELNASD+RGI+VVR ++ NFA  +T+      GK     K+IILDEAD+MT  AQ AL+R +EK S  TRFCLICNY ++II  + SRC++FRF PL ++  + RL+ I  +E + YT + +   +           N+LQ C   +F+ + AA
Sbjct:   32 VPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELYGPELYRQRVLELNASDERGIQVVREKVKNFA-QLTVAGKRPDGKHCPPFKIIILDEADSMTNAAQAALRRTMEKESRTTRFCLICNYVSRIIEPLTSRCSKFRFKPLANDIQRERLVEICEKENLKYTKEVIPPKV---------TENLLQICYKGTFEKLEAA 244          
BLAST of Replication factor C subunit 5 vs. Ensembl Sea Lamprey
Match: rfc5 (replication factor C (activator 1) 5 [Source:ZFIN;Acc:ZDB-GENE-040907-1])

HSP 1 Score: 367.851 bits (943), Expect = 5.972e-127
Identity = 179/328 (54.57%), Postives = 249/328 (75.91%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKR------IIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            NLPW+EKYRP+ L++LISH+DI+ T+Q FIS+  LPHLLFYGPPGTGKTS+ILA A+Q+Y +K   S+VLELNASDDRGI+VVR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R      ++EK++E TRFCLICNY ++IIPA+QSRCTRFRF PL S+ + PRL+H+I EE+V+ T DG+ AL+ LSNGDMR+A+N+LQ T+M++  V   NVY C G+P   D+  I++ +LN + + + +++ E++T K +AL DI+TE+   + +V+FP      L+ K+A++E  L+ G ++KIQ  SL++AF + RD + A A
Sbjct:    8 NLPWVEKYRPRVLDELISHKDILTTIQKFISEDRLPHLLFYGPPGTGKTSTILACARQLYGEKEAASMVLELNASDDRGIDVVRGPILSFASTRTIFKKGYKLVILDEADAMTQDAQNALRRGFHPPAVMEKFTENTRFCLICNYLSRIIPALQSRCTRFRFGPLSSDLMVPRLLHVIAEEQVDVTDDGMNALVTLSNGDMRRALNMLQSTNMAYGRVTEHNVYTCTGQPLKSDIANIVDWMLNSDFSGAYRQIMELKTLKGLALQDILTEVHTFVHRVDFPMSVRIHLLTKMAEVEYRLASGTNEKIQLSSLIAAFQVARDMVAAEA 335          
BLAST of Replication factor C subunit 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008618.1 (pep scaffold:Pmarinus_7.0:GL477502:54132:62470:-1 gene:ENSPMAG00000007794.1 transcript:ENSPMAT00000008618.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.557 bits (571), Expect = 1.678e-70
Identity = 112/228 (49.12%), Postives = 154/228 (67.54%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFY---GPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASN-MTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTP 701
            LPW+EKYRP +L +++ +E+ +  L+ F  +GN+P+++     GPPGTGKT+SIL +A+ +    VR  VLELNAS+DRGI+VVR +I  FA   +T+ +G+ K+IILDEAD+MT  AQ AL+R +E YS+ TRF L CN  +KII  IQSRC   R+S L   Q+  RL+ + + E V  T DGLEA+I  + GDMRQA+N LQ T   F  VN+ NV+    +P P
Sbjct:   48 LPWVEKYRPLKLKEIVGNEETVSRLEVFAREGNVPNIIIAECQGPPGTGKTTSILCLARALLGPAVRDAVLELNASNDRGIDVVRNKIKMFAQQKVTLPRGRHKIIILDEADSMTDGAQQALRRTMEIYSKSTRFALACNASDKIIEPIQSRCAVLRYSRLTDSQVLSRLLEVCDHECVQRTDDGLEAIIFTAQGDMRQALNNLQSTHTGFGYVNSENVFKVCDEPHP 275          
BLAST of Replication factor C subunit 5 vs. Ensembl Sea Lamprey
Match: rfc4 (replication factor C (activator 1) 4 [Source:ZFIN;Acc:ZDB-GENE-040824-3])

HSP 1 Score: 171.785 bits (434), Expect = 5.450e-51
Identity = 83/176 (47.16%), Postives = 125/176 (71.02%), Query Frame = 3
Query:  129 LPHLLFYGPPGTGKTSSILAIAKQMYDKHVRS-LVLELNASDDRGIEVVRTEILNFA---SNMTIQQGKS----KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQ 632
            LP+LLFYGPPGTGKTS+ILA A+ ++   + +  VLELNASD+RGI+VVR ++ NFA   ++ T + G      K+++LDEAD+MT  AQ AL+R +E+ ++ TRFCLICNY ++II  + SRC++FRF PL     + R+ H+ ++E +    + L  L++++ GD+R+AI +LQ
Sbjct:    1 LPNLLFYGPPGTGKTSAILAAARDLFGPELYAQRVLELNASDERGIQVVRHKVKNFAQLTASSTRKDGSPCPPFKIVVLDEADSMTSAAQAALRRTMERETKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDAAQEQRVRHVCDQEGLKIEQEALTELVKVAEGDLRRAITMLQ 176          
BLAST of Replication factor C subunit 5 vs. Ensembl Sea Lamprey
Match: rfc3 (replication factor C (activator 1) 3 [Source:ZFIN;Acc:ZDB-GENE-020809-3])

HSP 1 Score: 110.923 bits (276), Expect = 9.166e-28
Identity = 65/224 (29.02%), Postives = 111/224 (49.55%), Query Frame = 3
Query:   36 WIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLE---LNASDDRGIE-----------------------VVRTEILNFASNMTIQQGKS---KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAI 620
            W++KYRP  L+ +  H++    L+N +  G+ PHLL YGP G GK + I+ + +++Y   V  L +E   +     + IE                       VV+  I   A +  ++ G     K+++L E D +TKDAQ+AL+R +EKY    R  L+CN  +K+I  I+SRC   R      +++   L  +  +E ++  P+    +   SN ++R+A+
Sbjct:    4 WVDKYRPTSLSKVDFHKEQAIQLKNLVQGGDFPHLLVYGPSGAGKKTRIMCLLRELYGAGVEKLRIEHQTVTTPSKKKIEISTIASNYHIEVTPSDAGNSDRVVVQELIKTVAQSQQLESGTQRDFKVVLLSEVDRLTKDAQHALRRTMEKYMSTCRLILMCNSTSKVIAPIRSRCLGLRVPAPTVDEVCQVLAIVCKKEGLSLPPELARRIAEKSNRNLRKAL 227          
BLAST of Replication factor C subunit 5 vs. Ensembl Sea Lamprey
Match: rfc1 (replication factor C (activator 1) 1 [Source:ZFIN;Acc:ZDB-GENE-070410-99])

HSP 1 Score: 58.9214 bits (141), Expect = 1.146e-9
Identity = 53/244 (21.72%), Postives = 104/244 (42.62%), Query Frame = 3
Query:   36 WIEKYRPQQLNDLISHED-------IIHTLQNFISK--------------------------GNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQ---QGKS-------KLIILDEADAMTKDA-QNALKRIIE--KYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVL 629
            W+++YRPQ L ++I  +        ++  L+ + S                             L   L  GPPG GKT++   + +++    V     ELNASD R    ++ E+     N +I+    G +        ++++DE D M  +  +  +  +I   K S+    C+  +  +  I ++ + C   RF   + EQI+  ++ +  +E +   P  ++ +I  +N D+RQ ++ L
Sbjct:  499 WVDRYRPQSLKNIIGQQGDQSPANKLLRWLRAWHSNHGGGSGGGRKAAPSVGRFRFGGKDDGSGLKAALLSGPPGVGKTTTAALVCQELGLSFV-----ELNASDRRSKNSMKNEVATCLRNTSIEGFYHGSTAQTVSDRHVLLMDEVDGMAGNEDRGGIMELIALIKQSKVPVICMCNDRNHPKIRSLANYCFDLRFPRPRVEQIKGAMMSVAFKEGLKIPPAAMQEIILAANQDIRQVLHNL 737          
BLAST of Replication factor C subunit 5 vs. Ensembl Yeast
Match: RFC3 (Subunit of heteropentameric Replication factor C (RF-C); which is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005234])

HSP 1 Score: 298.13 bits (762), Expect = 9.253e-100
Identity = 145/315 (46.03%), Postives = 218/315 (69.21%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDT-----VNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFP-DIAMTELIIKLADIERNLSLGCSDKIQCYSLVSA 953
            NLPW+EKYRP+ L+++    ++I T++ F+ +G LPHLLFYGPPGTGKTS+I+A+A+++Y K+  ++VLELNASDDRGI+VVR +I +FAS   I     KLIILDEADAMT  AQNAL+R+IE+Y++ TRFC++ NY +K+ PA+ SRCTRFRF PL  E I+ R+ +++  EK+  +P+  +ALI LSNGDMR+ +NVLQ    + D      ++   +Y C G P P D+K +L  +L ++   +   + ++R+ K +AL D++  ++K+L       +     L+ KLADIE ++S G +D+IQ  +++ A
Sbjct:   12 NLPWVEKYRPETLDEVYGQNEVITTVRKFVDEGKLPHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQIFSKGFKLIILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAIERRIANVLVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPRPSDLKAVLKSILEDDWGTAHYTLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHLLTKLADIEYSISKGGNDQIQGSAVIGA 326          
BLAST of Replication factor C subunit 5 vs. Ensembl Yeast
Match: RFC4 (Subunit of heteropentameric Replication factor C (RF-C); which is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005454])

HSP 1 Score: 231.106 bits (588), Expect = 7.972e-74
Identity = 113/229 (49.34%), Postives = 149/229 (65.07%), Query Frame = 3
Query:   18 MTVNLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASN-MTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTP 701
            +++ LPW+EKYRPQ L+D++ +++ I  LQ     GN+PH++  G PG GKT+S+  +A ++  +     VLELNASDDRGI+VVR +I +FA   + +  GK K++ILDEAD+MT  AQ AL+R +E YS  TRF   CN  NKII  +QSRC   R+S L  E +  RL+ II  E V YT DGLEA+I  + GDMRQAIN LQ T      VNA NV+  V  P P
Sbjct:    5 LSLQLPWVEKYRPQVLSDIVGNKETIDRLQQIAKDGNMPHMIISGMPGIGKTTSVHCLAHELLGRSYADGVLELNASDDRGIDVVRNQIKHFAQKKLHLPPGKHKIVILDEADSMTAGAQQALRRTMELYSNSTRFAFACNQSNKIIEPLQSRCAILRYSKLSDEDVLKRLLQIIKLEDVKYTNDGLEAIIFTAEGDMRQAINNLQSTVAGHGLVNADNVFKIVDSPHP 233          
BLAST of Replication factor C subunit 5 vs. Ensembl Yeast
Match: RFC2 (Subunit of heteropentameric Replication factor C (RF-C); RF-C is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon [Source:SGD;Acc:S000003829])

HSP 1 Score: 200.675 bits (509), Expect = 1.140e-61
Identity = 115/322 (35.71%), Postives = 181/322 (56.21%), Query Frame = 3
Query:   33 PWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKS----------KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTV-NAANVYAC----VGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMK-LLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLV 947
            PW+EKYRP+ L+++ + +  +  L+  +   NLPH+LFYGPPGTGKTS+ILA+ K++Y   + +S +LELNASD+RGI +VR ++ NFA     +  K           K+IILDEAD+MT DAQ+AL+R +E YS  TRFCLICNY  +II  + SRC++FRF  L +     RL  I  +E V      LE ++ +S GD+R+ I +LQ  S     + +  N+ +     +    P D+ + +   +     + +K+      K   + + +V +L +  +T  NF      ++   L   +  L+ G ++ IQ  +L+
Sbjct:   26 PWVEKYRPKNLDEVTAQDHAVTVLKKTLKSANLPHMLFYGPPGTGKTSTILALTKELYGPDLMKSRILELNASDERGISIVREKVKNFARLTVSKPSKHDLENYPCPPYKIIILDEADSMTADAQSALRRTMETYSGVTRFCLICNYVTRIIDPLASRCSKFRFKALDASNAIDRLRFISEQENVKCDDGVLERILDISAGDLRRGITLLQSASKGAQYLGDGKNITSTQVEELAGVVPHDILIEIVEKVKSGDFDEIKKYVNTFMKSGWSAASVVNQLHEYYITNDNFDTNFKNQISWLLFTTDSRLNNGTNEHIQLLNLL 347          
BLAST of Replication factor C subunit 5 vs. Ensembl Yeast
Match: RFC5 (Subunit of heteropentameric Replication factor C (RF-C); RF-C is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon [Source:SGD;Acc:S000000291])

HSP 1 Score: 110.923 bits (276), Expect = 6.593e-28
Identity = 77/256 (30.08%), Postives = 133/256 (51.95%), Query Frame = 3
Query:   36 WIEKYRPQQLNDLISHEDIIHTLQNFISKG-NLPHLLFYGPPGTGKTSSILAIAKQMYDK-------HVRSLV------LELN---------------ASDDRGI------EVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNY-TPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKP 695
            W++KYRP+ LN L  +E++ + L++   +  +LPHLL YGP GTGK +  +A+ + ++          VR  V      LELN                ++DR +      EV + E ++F  +      + K +I++EA+++TKDAQ AL+R +EKYS+  R  ++C+  + II  I+SRC   R       +I   L  ++  E++   T D L+ + + SNG++R  +++L   SM+ +   A    + + KP
Sbjct:    4 WVDKYRPKSLNALSHNEELTNFLKSLSDQPRDLPHLLLYGPNGTGKKTRCMALLESIFGPGVYRLKIDVRQFVTASNRKLELNVVSSPYHLEITPSDMGNNDRIVIQELLKEVAQMEQVDFQDSKDGLAHRYKCVIINEANSLTKDAQAALRRTMEKYSKNIRLIMVCDSMSPIIAPIKSRCLLIRCPAPSDSEISTILSDVVTNERIQLETKDILKRIAQASNGNLR--VSLLMLESMALNNELALKSSSPIIKP 257          
BLAST of Replication factor C subunit 5 vs. Ensembl Yeast
Match: RFC1 (Subunit of heteropentameric Replication factor C (RF-C); RF-C is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon [Source:SGD;Acc:S000005743])

HSP 1 Score: 81.6481 bits (200), Expect = 3.419e-17
Identity = 70/248 (28.23%), Postives = 116/248 (46.77%), Query Frame = 3
Query:   36 WIEKYRPQQLNDLISHEDIIHTLQNFIS------KGNLPHL-----------LFYGPPGTGKTSSILAIAKQM-YDKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQ------------QGKSKLIILDEADAMTKDAQNALKRIIE---KYSEFTRFCLICNYQN--KIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANV 674
            W  KY P  L  +  ++  +  L+N+++      K +  H            + YGPPG GKT++   +A+++ YD      +LE NASD R   ++   + N   NM++              GK  +II+DE D M+   +  + ++ +   K S  T   LICN +N  K+ P     C   +F    +  I+ RL+ I   EK    P+ ++ LI+ + GD+RQ IN+L   S +  T+N  N+
Sbjct:  298 WTVKYAPTNLQQVCGNKGSVMKLKNWLANWENSKKNSFKHAGKDGSGVFRAAMLYGPPGIGKTTAAHLVAQELGYD------ILEQNASDVRSKTLLNAGVKNALDNMSVVGYFKHNEEAQNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQFCRKTS--TPLILICNERNLPKMRP-FDRVCLDIQFRRPDANSIKSRLMTIAIREKFKLDPNVIDRLIQTTRGDIRQVINLLSTISTTTKTINHENI 536          
BLAST of Replication factor C subunit 5 vs. Ensembl Nematostella
Match: EDO41130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S523])

HSP 1 Score: 368.622 bits (945), Expect = 4.552e-127
Identity = 179/320 (55.94%), Postives = 243/320 (75.94%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGA 983
            NLPW+EKYRP+ L+DLISH DII+T+Q FI++  LPHLLFYGPPGTGKTS+ILA+AKQ+Y DK   S+VLELNASDDRGI +VR +IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R++EK++E TRFCLICNY  KIIPA+QSRCTRFRF PL  +Q+ PRL H+I  E+VN T DG ++L+RL+ GDMR+ +N+LQ TSM++  VN  +VY C G+P P D+  I++ +LN++   +   + +++T K +AL DI+ E    + +V+FP      L+ K+A++E  L+ G S+KIQ  S+++AF + RD I A
Sbjct:   10 NLPWVEKYRPKCLDDLISHTDIINTIQRFINEERLPHLLFYGPPGTGKTSTILAVAKQLYPDKQFGSMVLELNASDDRGIGIVRGDILSFASTRTIFKSGFKLVILDEADAMTQDAQNALRRVMEKFTENTRFCLICNYLTKIIPALQSRCTRFRFGPLSVDQMLPRLEHVIESERVNVTDDGRKSLLRLAQGDMRKVLNILQSTSMAYSVVNEDHVYLCTGQPQPTDIGNIVDWMLNKDFTTAYTNILKLKTLKGLALQDILEETHSYVHRVDFPAKIRIHLLDKMAEVEYRLASGTSEKIQLGSMIAAFQVARDMIEA 329          
BLAST of Replication factor C subunit 5 vs. Ensembl Nematostella
Match: EDO39385 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA25])

HSP 1 Score: 230.335 bits (586), Expect = 3.925e-72
Identity = 111/225 (49.33%), Postives = 157/225 (69.78%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASN-MTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTP 701
            LPW+EKYRP +L++++ +E+ +  L+ F  +GN+P+++  GPPGTGKT+SIL +A+ +    ++  VLELNAS+DRGI+VVR +I  FA   +T+ +G+ K+IILDEAD+MT  AQ AL+R +E YS+ TRF L CN  +KII AIQSRC   R++ L   Q+  RL+ I ++E+V    DGLEA+I  + GDMRQAIN LQ T   F  VN+ NV+    +P P
Sbjct:   53 LPWVEKYRPTKLHEIVGNEETVSRLEVFAQQGNVPNIIIAGPPGTGKTTSILCLARALLGVSLKDAVLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNTSDKIIEAIQSRCAILRYTRLTDAQVLTRLLEICDKEQVPKVDDGLEAIIFTAEGDMRQAINNLQSTYYGFGMVNSENVFKVCDEPHP 277          
BLAST of Replication factor C subunit 5 vs. Ensembl Nematostella
Match: EDO40950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5R5])

HSP 1 Score: 210.305 bits (534), Expect = 6.878e-65
Identity = 100/208 (48.08%), Postives = 149/208 (71.63%), Query Frame = 3
Query:   33 PWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKH-VRSLVLELNASDDRGIEVVRTEILNFA---SNMTIQQGKS----KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQ 632
            PW+EKYRP+ ++D+   E+++  L+  +   +LP+LLFYGPPGTGKTS+ILA+A+++Y    ++  VLELNASD+RGI+V+R ++  F+   ++ +   GK     KL+ILDEAD+MT  AQ AL+R +EK ++ TRFCLICNY ++II  + SRC++FRF PL SE ++ RL  I  +E+VN     ++ +I++S GDMR+AI  LQ
Sbjct:   32 PWVEKYRPKCVDDVAQQEEVVMVLKKSLEGADLPNLLFYGPPGTGKTSTILAVARELYGHEMLKQRVLELNASDERGIQVIRDKVKTFSQLSASASRPDGKPCPPFKLVILDEADSMTPSAQAALRRTMEKQTKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSSEILERRLKEICVKEEVNCEDKAIDEVIKISEGDMRKAITFLQ 239          
BLAST of Replication factor C subunit 5 vs. Ensembl Nematostella
Match: EDO40823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S695])

HSP 1 Score: 116.701 bits (291), Expect = 1.606e-29
Identity = 75/227 (33.04%), Postives = 112/227 (49.34%), Query Frame = 3
Query:   36 WIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLV------------------------LELNASD----DRGIEVVRTEIL-NFASNMTIQQGKS---KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAI 620
            W++KYRP  L  L  H+D+   L+  +  G+ PHLL YGP G GK + I  I +++Y   V  L                         LE+NASD    DR   VV  E+L N A   +++       K+++L E D +TKDAQ+AL+R +EKY+   R  L CN  +K+IPAI+SRC   R      E+I   L  +  +E +    +    +   S  ++R+A+
Sbjct:    4 WVDKYRPTSLGKLDYHKDLAAHLKKLVHSGDFPHLLVYGPSGAGKKTRITCILRELYGSGVEKLKIEHHSFTTPSNKKVEISTIGSIFHLEVNASDVGIYDR---VVVQELLKNTAQAHSLELSAHRDFKVVVLTEVDRLTKDAQHALRRTMEKYTSTCRLILCCNSTSKVIPAIRSRCLGVRIPAPSVEEICQILQFVCKKEGLTIPSELSRRIAEKSGRNLRKAL 227          
BLAST of Replication factor C subunit 5 vs. Ensembl Nematostella
Match: EDO32627 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUL3])

HSP 1 Score: 73.559 bits (179), Expect = 3.987e-14
Identity = 58/235 (24.68%), Postives = 112/235 (47.66%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLIS------------------HEDIIHTL--QNFISK----GNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRG---IEVVRTEILN-------FASNMTIQQGKSKLIILDEADAMT-KDAQNALKRIIE--KYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAIN 623
            L W++KY+P  +  +I                   H++   TL   +F +K     +L   L  GPPG GKT++   + +++   +V     E+NASD R    +E V +E L+         SN+  + G   ++++DE D M   + +  ++ +I   K S+    C+  +  ++ I ++ + C   RFS  + EQI+  ++ I  +E +   P  ++ +I+ +N D+RQ ++
Sbjct:  223 LMWVDKYKPSGIKQIIGQQGDKSNMRKLLNWVRNWHKNRTKTLPKSSFFNKDTDGASLKAALLSGPPGVGKTTTATLVCQELGYSYV-----EMNASDARSKKTLEQVVSESLSNKSMDAFVGSNLAAKSGLKHVLLMDEVDGMAGSEDRGGMQELISLIKTSKIPIICMCNDRNSQKIRSLANYCFDLRFSRPRVEQIKGAMMSIAYKEGIKIPPPAMDQIIQGANQDIRQVLH 452          
BLAST of Replication factor C subunit 5 vs. Ensembl Medaka
Match: rfc5 (replication factor C subunit 5 [Source:NCBI gene;Acc:101164811])

HSP 1 Score: 375.941 bits (964), Expect = 1.922e-129
Identity = 183/322 (56.83%), Postives = 247/322 (76.71%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            NLPW+EKYRPQ+L+DLISH DI+ T+Q F+ +  LPHLL YGPPGTGKTS+ILA A+Q+Y DK   S+VLELNASDDRGI+VVR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL ++Q+ PRL H+I EE ++ T DG++A++ LS+GDMR+++NVLQ TSM++  V   +VY C G+P   D+  IL+  LN++  ++ K++ +++T K +AL DI+TEL  L+ +V+FP      L++KLAD+E  L+ G  +KIQ  S+V AF  VRD + + A
Sbjct:   13 NLPWVEKYRPQKLDDLISHRDILSTIQRFVREDRLPHLLLYGPPGTGKTSTILACARQLYKDKEFNSMVLELNASDDRGIDVVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLSADQMIPRLRHVIQEESIDITEDGMKAIVTLSSGDMRRSLNVLQSTSMAYGKVTEDSVYTCTGQPLRSDIANILDWCLNKDFTSAYKQILQLKTLKGLALHDILTELHLLVHRVDFPPATRMTLLVKLADVEHRLASGTDEKIQLSSMVGAFQEVRDLVVSEA 334          
BLAST of Replication factor C subunit 5 vs. Ensembl Medaka
Match: rfc5 (replication factor C subunit 5 [Source:NCBI gene;Acc:101164811])

HSP 1 Score: 364.385 bits (934), Expect = 4.048e-125
Identity = 179/318 (56.29%), Postives = 243/318 (76.42%), Query Frame = 3
Query:   39 IEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMY-DKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAA 989
            +EKYRPQ+L+DLISH DI+ T+Q F+ +  LPHLL YGPPGTGKTS+ILA A+Q+Y DK   S+VLELNASDDRGI+VVR  IL+FAS  TI +   KL+ILDEADAMT+DAQNAL+R+IEK++E TRFCLICNY +KIIPA+QSRCTRFRF PL ++Q+ PRL H+I EE ++ T DG++A++ LS+GDMR+++NVLQ TSM++  V   +VY C G+P   D+  IL+  LN++  ++ K++ +++T K +AL DI+TEL  L+ +V+FP      L++KLAD+E  L+ G  +KIQ  S+V AF  VRD + + A
Sbjct:    2 VEKYRPQKLDDLISHRDILSTIQRFVREDRLPHLLLYGPPGTGKTSTILACARQLYKDKEFNSMVLELNASDDRGIDVVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLSADQMIPRLRHVIQEESIDITEDGMKAIVTLSSGDMRRSLNVLQSTSMAYGKVTEDSVYTCTGQPLRSDIANILDWCLNKDFTSAYKQILQLKTLKGLALHDILTELHLLVHRVDFPPATRMTLLVKLADVEHRLASGTDEKIQLSSMVGAFQEVRDLVVSEA 319          
BLAST of Replication factor C subunit 5 vs. Ensembl Medaka
Match: rfc2 (replication factor C subunit 2 [Source:NCBI gene;Acc:101163395])

HSP 1 Score: 232.646 bits (592), Expect = 4.654e-73
Identity = 111/226 (49.12%), Postives = 159/226 (70.35%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASN-MTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTP 701
            +LPW+EKYRP +LN+++ +E+ +  L+ F  +GN+P+++  GPPGTGKT+SIL +A+ +    ++  VLELNAS+DRGI+VVR +I  FA   +T+ +G+ K+IILDEAD+MT  AQ AL+RI+E YS+ TRF L CN  +KII  IQSRC   R++ L   QI  RL  +I +E+++ + DGLEA+I  S GDMRQA+N LQ T   F  +N+ NV+    +P P
Sbjct:   36 DLPWVEKYRPLKLNEIVGNEETVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGSAMKDAVLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRIMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYAKLTDGQILSRLQEVIEKERLSVSDDGLEAVIFTSQGDMRQALNNLQSTHSGFGYINSENVFKVCDEPHP 261          
BLAST of Replication factor C subunit 5 vs. Ensembl Medaka
Match: rfc4 (replication factor C subunit 4 [Source:NCBI gene;Acc:101172149])

HSP 1 Score: 214.542 bits (545), Expect = 2.243e-66
Identity = 104/213 (48.83%), Postives = 149/213 (69.95%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFAS---NMTIQQGK----SKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTS 641
             +PW+EKYRP+ ++++   E+++  L+  +   +LP+LLFYGPPGTGKTS+ILA A+++Y   + R  VLELNASD+RGI+VVR ++  FA      T   GK     K+IILDEAD+MT  AQ AL+R +EK S  TRFCLICNY ++II  + SRC++FRF PL +   + RL+ I  +E + YT + +EAL+++S GD+R+AI  LQC +
Sbjct:   30 TVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELYGPELYRQRVLELNASDERGIQVVREKVKTFAQLTVAGTRPDGKLCPPFKIIILDEADSMTAPAQAALRRTMEKESRTTRFCLICNYISRIIEPLTSRCSKFRFKPLANRIQEERLLEICEKENLKYTRESIEALVQVSEGDLRKAITFLQCAA 242          
BLAST of Replication factor C subunit 5 vs. Ensembl Medaka
Match: rfc4 (replication factor C subunit 4 [Source:NCBI gene;Acc:101172149])

HSP 1 Score: 214.927 bits (546), Expect = 3.001e-66
Identity = 102/214 (47.66%), Postives = 150/214 (70.09%), Query Frame = 3
Query:   27 NLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHV-RSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKS--------KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTS 641
             +PW+EKYRP+ ++++   E+++  L+  +   +LP+LLFYGPPGTGKTS+ILA A+++Y   + R  VLELNASD+RGI+VVR ++  FA  +T+   +         K+IILDEAD+MT  AQ AL+R +EK S  TRFCLICNY ++II  + SRC++FRF PL +   + RL+ I  +E + YT + +EAL+++S GD+R+AI  LQC +
Sbjct:   30 TVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELYGPELYRQRVLELNASDERGIQVVREKVKTFA-QLTVAGTRPDGKLCPPFKIIILDEADSMTAPAQAALRRTMEKESRTTRFCLICNYISRIIEPLTSRCSKFRFKPLANRIQEERLLEICEKENLKYTRESIEALVQVSEGDLRKAITFLQCAA 242          
BLAST of Replication factor C subunit 5 vs. Planmine SMEST
Match: SMESG000008724.1 (SMESG000008724.1)

HSP 1 Score: 516.153 bits (1328), Expect = 0.000e+0
Identity = 264/264 (100.00%), Postives = 264/264 (100.00%), Query Frame = 3
Query:  201 MYDKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAAQ 992
            MYDKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKLILNILLNEELANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAAQ
Sbjct:    1 MYDKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTPQDMKLILNILLNEELANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKIGAAAQ 264          
BLAST of Replication factor C subunit 5 vs. Planmine SMEST
Match: SMESG000041132.1 (SMESG000041132.1)

HSP 1 Score: 227.639 bits (579), Expect = 1.446e-71
Identity = 113/225 (50.22%), Postives = 152/225 (67.56%), Query Frame = 3
Query:   30 LPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASN-MTIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAANVYACVGKPTP 701
            LPW+EKYRP  L+D++ +E  I  L+ F  +GNLP+L+  GPPG+GKT+SIL +A+ M  +  ++ VLELNAS+DRGIEVVR +I +FA N + +  G  K+IILDE D+MT+ AQ AL+R +E YS  TRF   CN  +KII  IQSRC   R++ L   +I  RL+ II  E V YT DGLEA+I  + GDMRQAIN ++ T   F +V + NV+    +P P
Sbjct:   12 LPWLEKYRPLVLSDIVGNEGTIKRLEIFSKQGNLPNLIIAGPPGSGKTTSILCLARAMLGETYKNAVLELNASNDRGIEVVRNKIKSFARNKVNLPDGMHKIIILDEGDSMTEGAQQALRRTMEMYSNTTRFAFACNDSSKIIEPIQSRCAMLRYTKLSDSEILARLLEIIKMESVIYTDDGLEAIIFTAQGDMRQAINNVELTHKGFGSVTSDNVFKVCDEPHP 236          
BLAST of Replication factor C subunit 5 vs. Planmine SMEST
Match: SMESG000059207.1 (SMESG000059207.1)

HSP 1 Score: 205.682 bits (522), Expect = 8.043e-63
Identity = 124/335 (37.01%), Postives = 186/335 (55.52%), Query Frame = 3
Query:    9 KFIMTVNLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQGKS----------KLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQAINVLQCTSMSFDTVNAAN--VYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGCSDKIQCYSLVSAFYLVRDKI 977
            K I+  ++PWIEKYRP+ ++D+   ++++  L+  IS  + P+ LFYGPPGTGKTS+ILA AK ++    R  VLELNASD+RGI V+R ++  F+ N    + ++          KLIILDEAD+MT  AQ+AL+R +E   + TRFCLICNY +KII  I SRC +FRF  L  +    RL+ I   E VN T   L  L+ +S GD+RQAI +LQ  S++    NA N  +   + +  PQ         +     + +K    I      +++ ++ EL   + + N  D    E   +L   E+ +  G  + +Q  +L S F + + K+
Sbjct:   22 KNILKEHIPWIEKYRPKTMDDIAHQDEVVAMLKKCISGSDFPNFLFYGPPGTGKTSTILAAAKDLFGLKYRDRVLELNASDERGISVIREKVKRFSQNSVSAKFRNGDDEKIIPSFKLIILDEADSMTTAAQSALRRTMEVECKTTRFCLICNYISKIIDPITSRCAKFRFKSLDRDVAISRLLTICAAENVNITQAVLSKLVEMSEGDLRQAITLLQRASLTAGK-NAINEDLLNEIVEIFPQSYVKQFMEAVRSNSFDQIKLNNNIILSSKYSITGLIAELQVNILQSNIKDSIKAEFFERLTLCEQQIVTGADEYLQMMAL-SCFMMEKFKL 354          
BLAST of Replication factor C subunit 5 vs. Planmine SMEST
Match: SMESG000020661.1 (SMESG000020661.1)

HSP 1 Score: 105.531 bits (262), Expect = 3.551e-25
Identity = 96/350 (27.43%), Postives = 159/350 (45.43%), Query Frame = 3
Query:   36 WIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLE------------------------LNASD----DRGIEVVRTEILNFASNM---TIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALI-RLSNGDMRQAINVLQ-CTSMSFDTVNAANVYACVGKPTPQDMKXXXXXXXXXXXANSVKRMTEIRTK------KCIALSDIVTELMKLLTKVNFPDIAMTELIIKL-ADIERNLSLGCSDKIQCYSLVSAFYLV 965
            W +K++P  L++L  H+D  + +Q  ++ G+ PHLL  G  G+GK + I  I +++Y + V  L LE                        +N SD    DR I  ++  I + AS +   +IQQ + K+I++ E D +T DAQ+AL+R +EKY    R  L     NKIIPAI+SRC   R      ++I+  +I    +E +   P  L   I   S G++RQ + + + C    +   +  ++        P  +  I   +       S K++ E+R +       CI  S I+ EL   L    F D+ +   + ++ A  E  ++LG        + V+ F  V
Sbjct:    4 WADKHKPLTLSELDYHKDQANRIQTLVTNGDFPHLLICGAAGSGKKTRIHCILRELYGQGVDKLRLEHQEFVTPSHKKIDINLVVSNYHIEVNPSDVGIHDRVI--IQDLIKSSASTLQLDSIQQKEFKVIVMHEVDKLTPDAQHALRRTMEKYISSCRLILCAESTNKIIPAIRSRCLFIRVPSPSEKEIEKIIISTCQKESL-IIPRALAKRIAEASKGNLRQGLLIAEACKVQQYPFTDNQSIV------LPDWVNFIKETVSIIISEQSPKKLLEVRGRLYELLAHCIPESTIIRELTDELAA--FCDLPLKLTLYQIAAQYEYQMNLGQKAIFHLEAFVAKFMSV 342          
BLAST of Replication factor C subunit 5 vs. Planmine SMEST
Match: SMESG000020661.1 (SMESG000020661.1)

HSP 1 Score: 102.834 bits (255), Expect = 1.343e-24
Identity = 72/226 (31.86%), Postives = 114/226 (50.44%), Query Frame = 3
Query:   36 WIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTGKTSSILAIAKQMYDKHVRSLVLE------------------------LNASDDRGIE---VVRTEILNFASNM---TIQQGKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQSRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALI-RLSNGDMRQAI 620
            W +K++P  L++L  H+D  + +Q  ++ G+ PHLL  G  G+GK + I  I +++Y + V  L LE                        +N SD  GI    +++  I + AS +   +IQQ + K+I++ E D +T DAQ+AL+R +EKY    R  L     NKIIPAI+SRC   R      ++I+  +I    +E +   P  L   I   S G++RQ +
Sbjct:    4 WADKHKPLTLSELDYHKDQANRIQTLVTNGDFPHLLICGAAGSGKKTRIHCILRELYGQGVDKLRLEHQEFVTPSHKKIDINLVVSNYHIEVNPSD-VGIHDRVIIQDLIKSSASTLQLDSIQQKEFKVIVMHEVDKLTPDAQHALRRTMEKYISSCRLILCAESTNKIIPAIRSRCLFIRVPSPSEKEIEKIIISTCQKESL-IIPRALAKRIAEASKGNLRQGL 227          
The following BLAST results are available for this feature:
BLAST of Replication factor C subunit 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RFC56.604e-13157.76replication factor C subunit 5 [Source:HGNC Symbol... [more]
RFC59.307e-12757.23replication factor C subunit 5 [Source:HGNC Symbol... [more]
RFC22.450e-7349.78replication factor C subunit 2 [Source:HGNC Symbol... [more]
RFC44.456e-6536.59replication factor C subunit 4 [Source:HGNC Symbol... [more]
RFC44.456e-6536.59replication factor C subunit 4 [Source:HGNC Symbol... [more]
back to top
BLAST of Replication factor C subunit 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F44B9.85.680e-11453.65Probable replication factor C subunit 5 [Source:U... [more]
rfc-24.253e-6939.23RFC (DNA replication factor) family [Source:UniPr... [more]
rfc-44.146e-5744.00Replication factor C subunit 4 [Source:UniProtKB/... [more]
rfc-33.116e-2326.07RFC (DNA replication factor) family [Source:UniPr... [more]
rfc-12.675e-1125.70Replication factor C subunit 1 [Source:UniProtKB/... [more]
back to top
BLAST of Replication factor C subunit 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RfC34.582e-12556.56gene:FBgn0032244 transcript:FBtr0080019[more]
RfC44.176e-7036.28gene:FBgn0260985 transcript:FBtr0073264[more]
CG81422.484e-6246.86gene:FBgn0030871 transcript:FBtr0074472[more]
RfC381.451e-2729.18gene:FBgn0028700 transcript:FBtr0080225[more]
RfC381.451e-2729.18gene:FBgn0028700 transcript:FBtr0344786[more]
back to top
BLAST of Replication factor C subunit 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfc55.520e-13058.54replication factor C (activator 1) 5 [Source:ZFIN;... [more]
rfc23.682e-7349.33replication factor C (activator 1) 2 [Source:ZFIN;... [more]
rfc47.573e-5849.46replication factor C (activator 1) 4 [Source:ZFIN;... [more]
rfc47.573e-5849.46replication factor C (activator 1) 4 [Source:ZFIN;... [more]
rfc41.541e-5746.41replication factor C (activator 1) 4 [Source:ZFIN;... [more]
back to top
BLAST of Replication factor C subunit 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfc53.020e-13157.45replication factor C subunit 5 [Source:NCBI gene;A... [more]
rfc52.572e-12756.88replication factor C subunit 5 [Source:NCBI gene;A... [more]
rfc53.446e-12756.92replication factor C subunit 5 [Source:NCBI gene;A... [more]
rfc53.719e-12756.92replication factor C subunit 5 [Source:NCBI gene;A... [more]
rfc54.161e-12756.92replication factor C subunit 5 [Source:NCBI gene;A... [more]
back to top
BLAST of Replication factor C subunit 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rfc53.053e-13058.07replication factor C (activator 1) 5 [Source:MGI S... [more]
Rfc22.570e-7450.22replication factor C (activator 1) 2 [Source:MGI S... [more]
Rfc41.002e-6146.01replication factor C (activator 1) 4 [Source:MGI S... [more]
Rfc42.070e-6146.01replication factor C (activator 1) 4 [Source:MGI S... [more]
Rfc48.506e-5745.69replication factor C (activator 1) 4 [Source:MGI S... [more]
back to top
BLAST of Replication factor C subunit 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P40937|RFC5_HUMAN3.172e-13057.76Replication factor C subunit 5 OS=Homo sapiens OX=... [more]
sp|Q9D0F6|RFC5_MOUSE2.136e-12958.07Replication factor C subunit 5 OS=Mus musculus OX=... [more]
sp|P34429|RFC5_CAEEL7.225e-11353.65Probable replication factor C subunit 5 OS=Caenorh... [more]
sp|Q9CAQ8|RFC5_ARATH4.510e-11050.61Replication factor C subunit 5 OS=Arabidopsis thal... [more]
sp|Q6YZ54|RFC3_ORYSJ9.970e-11049.85Replication factor C subunit 3 OS=Oryza sativa sub... [more]
back to top
BLAST of Replication factor C subunit 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V1DHQ02.911e-13359.50Replication factor C subunit 5 (Fragment) OS=Trich... [more]
A0A0V1KBT62.728e-13158.88Replication factor C subunit 5 (Fragment) OS=Trich... [more]
A0A1U7SB465.423e-13159.63replication factor C subunit 5 isoform X1 OS=Allig... [more]
A0A151N4L97.046e-13159.94Replication factor C subunit 5 OS=Alligator missis... [more]
A0A0V1KBN67.155e-13158.88Replication factor C subunit 5 OS=Trichinella pseu... [more]
back to top
BLAST of Replication factor C subunit 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfc51.288e-12857.91replication factor C subunit 5 [Source:NCBI gene;A... [more]
rfc24.316e-7448.68replication factor C (activator 1) 2 [Source:ZFIN;... [more]
rfc21.856e-7348.68replication factor C (activator 1) 2 [Source:ZFIN;... [more]
rfc45.232e-6849.77replication factor C (activator 1) 4 [Source:ZFIN;... [more]
rfc43.876e-5744.84replication factor C (activator 1) 4 [Source:ZFIN;... [more]
back to top
BLAST of Replication factor C subunit 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfc55.972e-12754.57replication factor C (activator 1) 5 [Source:ZFIN;... [more]
ENSPMAT00000008618.11.678e-7049.12pep scaffold:Pmarinus_7.0:GL477502:54132:62470:-1 ... [more]
rfc45.450e-5147.16replication factor C (activator 1) 4 [Source:ZFIN;... [more]
rfc39.166e-2829.02replication factor C (activator 1) 3 [Source:ZFIN;... [more]
rfc11.146e-921.72replication factor C (activator 1) 1 [Source:ZFIN;... [more]
back to top
BLAST of Replication factor C subunit 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RFC39.253e-10046.03Subunit of heteropentameric Replication factor C (... [more]
RFC47.972e-7449.34Subunit of heteropentameric Replication factor C (... [more]
RFC21.140e-6135.71Subunit of heteropentameric Replication factor C (... [more]
RFC56.593e-2830.08Subunit of heteropentameric Replication factor C (... [more]
RFC13.419e-1728.23Subunit of heteropentameric Replication factor C (... [more]
back to top
BLAST of Replication factor C subunit 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO411304.552e-12755.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393853.925e-7249.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409506.878e-6548.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408231.606e-2933.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326273.987e-1424.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Replication factor C subunit 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfc51.922e-12956.83replication factor C subunit 5 [Source:NCBI gene;A... [more]
rfc54.048e-12556.29replication factor C subunit 5 [Source:NCBI gene;A... [more]
rfc24.654e-7349.12replication factor C subunit 2 [Source:NCBI gene;A... [more]
rfc42.243e-6648.83replication factor C subunit 4 [Source:NCBI gene;A... [more]
rfc43.001e-6647.66replication factor C subunit 4 [Source:NCBI gene;A... [more]
back to top
BLAST of Replication factor C subunit 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008724.10.000e+0100.00SMESG000008724.1[more]
SMESG000041132.11.446e-7150.22SMESG000041132.1[more]
SMESG000059207.18.043e-6337.01SMESG000059207.1[more]
SMESG000020661.13.551e-2527.43SMESG000020661.1[more]
SMESG000020661.11.343e-2431.86SMESG000020661.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035282 ID=SMED30035282|Name=Replication factor C subunit 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1167bp
TTTAATTAAAATTTATAATGACTGTTAATTTGCCCTGGATTGAAAAATAT
CGACCGCAGCAGTTAAATGACCTTATAAGTCATGAAGATATAATACATAC
TCTTCAAAATTTTATTTCAAAAGGGAATTTGCCACACTTATTGTTTTATG
GTCCACCGGGAACTGGTAAAACAAGTTCTATATTGGCTATTGCGAAACAA
ATGTACGATAAACACGTGAGATCTTTGGTTTTAGAGTTAAATGCTTCAGA
TGATAGAGGAATAGAAGTTGTGAGGACTGAAATTCTTAATTTTGCATCTA
ATATGACAATACAACAAGGAAAAAGTAAATTGATTATACTCGACGAAGCT
GATGCTATGACAAAAGATGCACAGAATGCATTGAAAAGAATAATTGAAAA
ATATTCTGAATTCACCAGATTTTGCTTGATCTGCAATTATCAAAATAAAA
TTATCCCAGCAATTCAATCTAGATGCACTCGATTTAGATTCTCACCTTTA
AAATCGGAGCAAATCCAGCCGAGATTAATTCATATAATTAATGAAGAAAA
GGTGAATTATACACCAGATGGATTGGAAGCATTGATACGGTTATCCAACG
GAGACATGCGACAGGCCATAAATGTACTTCAATGTACGTCGATGTCATTC
GATACCGTTAACGCGGCCAATGTCTATGCCTGTGTTGGTAAACCCACGCC
GCAGGACATGAAATTAATTTTGAATATTCTACTGAATGAGGAACTGGCAA
ATAGCGTGAAAAGAATGACCGAGATAAGAACCAAAAAATGCATTGCTTTA
AGTGACATAGTTACTGAATTGATGAAACTTCTAACTAAAGTCAATTTCCC
AGACATTGCTATGACAGAATTAATTATAAAATTGGCCGACATTGAAAGGA
ATTTATCGCTTGGTTGTTCAGATAAAATACAGTGCTATTCTTTAGTTTCT
GCATTTTATTTGGTCAGGGACAAGATTGGTGCAGCTGCTCAATAGATTGA
ATATTTTCCTGTCAAATTAACTGTTGAAATCAACATTATCATATTTATGT
TGTAGAGAATAAAGTTTCTGTCTCTCAAAAACTCTTGATTTGTATGCCTT
GATTTGGAATTTGCTTGTATATTAGTCTCAATCAAAATTTATAAACCTGT
TTAAATATGCTTATCCG
back to top

protein sequence of SMED30035282-orf-1

>SMED30035282-orf-1 ID=SMED30035282-orf-1|Name=SMED30035282-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=326bp
MTVNLPWIEKYRPQQLNDLISHEDIIHTLQNFISKGNLPHLLFYGPPGTG
KTSSILAIAKQMYDKHVRSLVLELNASDDRGIEVVRTEILNFASNMTIQQ
GKSKLIILDEADAMTKDAQNALKRIIEKYSEFTRFCLICNYQNKIIPAIQ
SRCTRFRFSPLKSEQIQPRLIHIINEEKVNYTPDGLEALIRLSNGDMRQA
INVLQCTSMSFDTVNAANVYACVGKPTPQDMKLILNILLNEELANSVKRM
TEIRTKKCIALSDIVTELMKLLTKVNFPDIAMTELIIKLADIERNLSLGC
SDKIQCYSLVSAFYLVRDKIGAAAQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR003593AAA+_ATPase
IPR013748Rep_factorC_C
IPR027417P-loop_NTPase
IPR003959ATPase_AAA_core
IPR008921DNA_pol3_clamp-load_cplx_C
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003677DNA binding
GO:0000166nucleotide binding
GO:0005515protein binding
GO:0019899enzyme binding
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0000722telomere maintenance via recombination
GO:0006281DNA repair
GO:0006283transcription-coupled nucleotide-excision repair
GO:0006296nucleotide-excision repair, DNA incision, 5'-to lesion
GO:0006297nucleotide-excision repair, DNA gap filling
GO:0019985translesion synthesis
GO:0033683nucleotide-excision repair, DNA incision
GO:0042276error-prone translesion synthesis
GO:0042769DNA damage response, detection of DNA damage
GO:0070987error-free translesion synthesis
GO:1900264positive regulation of DNA-directed DNA polymerase activity
GO:1901796regulation of signal transduction by p53 class mediator
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005663DNA replication factor C complex
GO:0031390Ctf18 RFC-like complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 108..128
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..161
e-value: 1.6E-56
score: 192.8
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 162..225
e-value: 1.3E-24
score: 87.2
NoneNo IPR availableGENE3DG3DSA:1.20.272.10coord: 226..322
e-value: 4.5E-23
score: 83.1
NoneNo IPR availablePANTHERPTHR11669REPLICATION FACTOR C / DNA POLYMERASE III GAMMA-TAU SUBUNITcoord: 4..320
NoneNo IPR availablePANTHERPTHR11669:SF9REPLICATION FACTOR C SUBUNIT 5coord: 4..320
NoneNo IPR availableCDDcd18140HLD_clamp_RFCcoord: 161..223
e-value: 1.67925E-20
score: 81.4213
NoneNo IPR availableCDDcd00009AAAcoord: 20..160
e-value: 1.15363E-22
score: 90.2831
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 37..164
e-value: 2.0E-12
score: 57.3
IPR013748Replication factor C, C-terminalPFAMPF08542Rep_fac_Ccoord: 226..311
e-value: 8.3E-12
score: 45.4
IPR003959ATPase, AAA-type, corePFAMPF00004AAAcoord: 41..159
e-value: 3.1E-16
score: 60.0
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 4..223
IPR008921DNA polymerase III, clamp loader complex, gamma/delta/delta subunit, C-terminalSUPERFAMILYSSF48019post-AAA+ oligomerization domain-likecoord: 226..318