Post-GPI attachment to proteins factor 2-like protein

Overview
NamePost-GPI attachment to proteins factor 2-like protein
Smed IDSMED30035279
Length (bp)1173
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Post-GPI attachment to proteins factor 2-like protein (SMED30035279) t-SNE clustered cells

Violin plots show distribution of expression levels for Post-GPI attachment to proteins factor 2-like protein (SMED30035279) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Post-GPI attachment to proteins factor 2-like protein (SMED30035279) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Post-GPI attachment to proteins factor 2-like protein (SMED30035279) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035279

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035279SMESG000051249.1 SmedASXL_025898SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30035279SMESG000051249.1 dd_Smed_v6_21319_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30035279SMESG000051249.1 OX_Smed_1.0.16243ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30035279SMESG000051249.1 Contig2530newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035279SMESG000070985.1 Contig2530newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Human
Match: PGAP2 (post-GPI attachment to proteins 2 [Source:HGNC Symbol;Acc:HGNC:17893])

HSP 1 Score: 119.398 bits (298), Expect = 4.546e-30
Identity = 76/218 (34.86%), Postives = 118/218 (54.13%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSIS-AITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRV---FYINQDLSEMKSYHQKCFCLA-VTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQAS 741
            F+F+    TDC   N LPS+S AI G  PQ Y+WRF I LH+ PRFL+A+ Y   YL  ++          +    L   N  +N++E  +LL LT VSS E+F IH   F+ F  +S+ HM+++  + R+     ++Q+  +  S+ Q+ F +  ++   +L + F   +H +YC    Y+ F++LEY  VL NM FH  A +D G+  L  + Q  
Sbjct:  105 FHFEYTVATDCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSP--------CSCYRPLCRLNFGLNVVENLALLVLTYVSSSEDFTIHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKSYSWKQRLFIINFISFFSALAVYF---RHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPE 311          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Human
Match: PGAP2 (post-GPI attachment to proteins 2 [Source:HGNC Symbol;Acc:HGNC:17893])

HSP 1 Score: 119.398 bits (298), Expect = 4.546e-30
Identity = 76/218 (34.86%), Postives = 118/218 (54.13%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSIS-AITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRV---FYINQDLSEMKSYHQKCFCLA-VTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQAS 741
            F+F+    TDC   N LPS+S AI G  PQ Y+WRF I LH+ PRFL+A+ Y   YL  ++          +    L   N  +N++E  +LL LT VSS E+F IH   F+ F  +S+ HM+++  + R+     ++Q+  +  S+ Q+ F +  ++   +L + F   +H +YC    Y+ F++LEY  VL NM FH  A +D G+  L  + Q  
Sbjct:  105 FHFEYTVATDCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSP--------CSCYRPLCRLNFGLNVVENLALLVLTYVSSSEDFTIHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKSYSWKQRLFIINFISFFSALAVYF---RHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPE 311          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Human
Match: PGAP2 (post-GPI attachment to proteins 2 [Source:HGNC Symbol;Acc:HGNC:17893])

HSP 1 Score: 116.316 bits (290), Expect = 1.500e-29
Identity = 75/218 (34.40%), Postives = 116/218 (53.21%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSIS-AITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRV---FYINQDLSEMKSYHQKCFCLA-VTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQAS 741
            F+F     T C   N LPS+S AI G  PQ Y+WRF I LH+ PRFL+A+ Y   YL  ++          +    L   N  +N++E  +LL LT VSS E+F IH   F+ F  +S+ HM+++  + R+     ++Q+  +  S+ Q+ F +  ++   +L + F   +H +YC    Y+ F++LEY  VL NM FH  A +D G+  L  + Q  
Sbjct:   44 FHFKETTATHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSP--------CSCYRPLCRLNFGLNVVENLALLVLTYVSSSEDFTIHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKSYSWKQRLFIINFISFFSALAVYF---RHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPE 250          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Human
Match: PGAP2 (post-GPI attachment to proteins 2 [Source:HGNC Symbol;Acc:HGNC:17893])

HSP 1 Score: 115.546 bits (288), Expect = 2.628e-29
Identity = 73/213 (34.27%), Postives = 109/213 (51.17%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSIS-AITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQA 738
            F+F     T C   N LPS+S AI G  PQ Y+WRF I LH+ PRFL+A+ Y   YL  ++          +    L   N  +N++E  +LL LT VSS E+F IH   F+ F  +S+ HM+++  + R   + +  ++ KSY  K     +  +        + +H +YC    Y+ F++LEY  VL NM FH  A +D G+  L  + Q 
Sbjct:   44 FHFKETTATHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSP--------CSCYRPLCRLNFGLNVVENLALLVLTYVSSSEDFTIHENAFIVFIASSLGHMLLTCILWR---LTKKHTDRKSYSWKQRLFIINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQP 245          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Human
Match: PGAP2 (post-GPI attachment to proteins 2 [Source:HGNC Symbol;Acc:HGNC:17893])

HSP 1 Score: 116.316 bits (290), Expect = 4.818e-29
Identity = 75/218 (34.40%), Postives = 116/218 (53.21%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSIS-AITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRV---FYINQDLSEMKSYHQKCFCLA-VTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQAS 741
            F+F     T C   N LPS+S AI G  PQ Y+WRF I LH+ PRFL+A+ Y   YL  ++          +    L   N  +N++E  +LL LT VSS E+F IH   F+ F  +S+ HM+++  + R+     ++Q+  +  S+ Q+ F +  ++   +L + F   +H +YC    Y+ F++LEY  VL NM FH  A +D G+  L  + Q  
Sbjct:  101 FHFKETTATHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSP--------CSCYRPLCRLNFGLNVVENLALLVLTYVSSSEDFTIHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKSYSWKQRLFIINFISFFSALAVYF---RHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPE 307          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Celegans
Match: tag-189 (Post-GPI attachment to proteins factor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q22141])

HSP 1 Score: 98.9821 bits (245), Expect = 1.569e-23
Identity = 74/205 (36.10%), Postives = 108/205 (52.68%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISA-ITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYI----SRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFD 702
             +FD    T C   N LPSISA ++ + P+ YIWR  I LH  PR ++A  +R F L    +   G       L  L N   ++N+LE F LLALT +SS E+  +H+  F GFAI SI++M++S ++     R    N      +S+  K    A+ +LC    A+ + +H  YC P  Y+ F+L+EY  VL N+ FH    +D
Sbjct:   38 LHFDQATSTHCEVANWLPSISAAVSTYTPEKYIWRILIGLHIGPRLVVAIAFRNFLLGSPLRPLTG----HKRLRFLCNLACFLNLLENFFLLALTSISSSEDHSLHAKCFGGFAICSIIYMLLSTWLFNETGRRTATNLG---QRSHEYKILGAAIFVLCFFLGAYLYWRHNTYCEPGIYTLFALVEYSAVLSNIFFHCTLYYD 235          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Celegans
Match: tag-189 (Post-GPI attachment to proteins factor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q22141])

HSP 1 Score: 98.9821 bits (245), Expect = 1.569e-23
Identity = 74/205 (36.10%), Postives = 108/205 (52.68%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISA-ITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYI----SRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFD 702
             +FD    T C   N LPSISA ++ + P+ YIWR  I LH  PR ++A  +R F L    +   G       L  L N   ++N+LE F LLALT +SS E+  +H+  F GFAI SI++M++S ++     R    N      +S+  K    A+ +LC    A+ + +H  YC P  Y+ F+L+EY  VL N+ FH    +D
Sbjct:   38 LHFDQATSTHCEVANWLPSISAAVSTYTPEKYIWRILIGLHIGPRLVVAIAFRNFLLGSPLRPLTG----HKRLRFLCNLACFLNLLENFFLLALTSISSSEDHSLHAKCFGGFAICSIIYMLLSTWLFNETGRRTATNLG---QRSHEYKILGAAIFVLCFFLGAYLYWRHNTYCEPGIYTLFALVEYSAVLSNIFFHCTLYYD 235          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Celegans
Match: Y38F1A.8 (pep chromosome:WBcel235:II:12997986:13000853:-1 gene:WBGene00012610.1 transcript:Y38F1A.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y38F1A.8)

HSP 1 Score: 56.9954 bits (136), Expect = 7.049e-9
Identity = 61/219 (27.85%), Postives = 101/219 (46.12%), Query Frame = 1
Query:  103 FYFDIV-NRTDCRA---INI-LPSISAITG-HRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINF----NMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEM--KSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLS 723
            F F+ V N T+C+    +NI LP +S   G  +PQ YIW   + +H  PR      YR+ +L  + K        S W Y  +N+     +W    E   L+ ++VV     F +H+L F  + I    +M+ ++ +   F   +D+ +    ++  KC    V   C++     +     +C+PY Y+ FSL E I V  N  F+ IA F+   T ++
Sbjct:   68 FQFEKVSNFTECKECPNMNITLPPVSYSIGIWQPQKYIWMMIMFIHVPPRLFFLMLYRRLFLISAPK--------SVW-YARVNYVYMLTLWA---EPLGLVLVSVVDINGGFILHALGFAIWIICFNFNMLFNIILHH-FGGCRDVHDTMETTWRIKCVIFLVGYFCAISTPITYPYFTAHCSPYAYNLFSLAELIEVGCNSLFYSIAYFEFPKTRIT 273          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Celegans
Match: Y11D7A.9 (pep chromosome:WBcel235:IV:9253979:9256117:-1 gene:WBGene00012433.1 transcript:Y11D7A.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y11D7A.9)

HSP 1 Score: 51.9878 bits (123), Expect = 2.473e-7
Identity = 45/163 (27.61%), Postives = 78/163 (47.85%), Query Frame = 1
Query:  316 WLYHLINFNMWV-NILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLY--ISRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIG-STYLSTSRQASLMSNGIGKKEI*LISMK 792
            WLY L  +  +V  +LE+  L  L+++   EN  +H +FF  F I  I+HM+ +++     ++Y+N       SY+ K    ++ +L +  +   F  +   C  + Y  F+L EY  V +N+ FH  A FDI      S  +   ++ N   K+ I  +  K
Sbjct:  136 WLYELSRYLYFVVGLLELIFLSGLSIIGERENIQVHVIFFYVFGICGIVHMISNIFCHAHSLYYLNP--YGRLSYYLKILFTSLYVLSTPILIASFILYWRKCITWAYDVFALCEYSGVFLNICFHGCAFFDIRYKVTFSVRKIEDVVQNEPNKQAIEALPEK 296          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Fly
Match: CG7990 (gene:FBgn0030997 transcript:FBtr0074695)

HSP 1 Score: 139.043 bits (349), Expect = 1.328e-37
Identity = 77/208 (37.02%), Postives = 120/208 (57.69%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEMK--SYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYL 720
            F +D V+ T CR  NI+PSISAITG  PQ Y WRF IALH  PR  IA+ Y+ +Y  +  ++    +  ++ L  LI   + +N +EI SL  +T +S+ EN+ +H   F+ F + S+ +M+ ++ ++ +    Q LSE +  S   K    AV+IL ++G+  FF KHR YC    +S F+  EY+  + NM FH+   +D  S ++
Sbjct:  100 FQYDDVHETHCRVYNIIPSISAITGVSPQRYFWRFSIALHIGPRIPIAFVYKNYYRSQLRRISPAQVPQTSLLITLI---LVLNCIEIASLGGVTYISNRENYPVHERIFITFMVCSLCYMLATIKLNGILNAGQALSEKQLLSIKWKKILFAVSILSTVGLLVFFAKHRFYCHDLAFSWFAFFEYLIAIANMLFHFTIIWDFPSQFM 304          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Fly
Match: PGAP2 (gene:FBgn0031284 transcript:FBtr0078039)

HSP 1 Score: 78.5666 bits (192), Expect = 2.990e-16
Identity = 64/205 (31.22%), Postives = 100/205 (48.78%), Query Frame = 1
Query:  109 FDIVNRT--DCRAINILPSISAITG-HRPQIYIWRFGIALHAVPRFLIAYTYRQFYLD--KSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLS-EMKSYHQKCFCLAVTILCSLGMA-FFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFD 702
            FD V  T   C   N LPS+SA  G + PQ  +WR  I LH   R  +A  Y + Y +  + ++  LGI+              ++N++E  +L  L+  +S +++  H   FV F   S  +M++S  ++R       L  E KS   K     V ++ + G+A + F +H  +C    Y+ F+L EYI VL NMGFH  + +D
Sbjct:   45 FDFVRSTYTHCDVTNYLPSVSAAIGNYEPQKTVWRLAIFLHLPLRLAVAKIYLEHYREHIRRSRRLLGILA------------CFLNVVEDLALFCLSFWTSADHYETHRNAFVVFIACSECYMLVSYLLNRNIQKTVLLPHEEKSLRYKRNLFLVNVI-AFGLAGYCFVRHNSHCEAGVYTFFALFEYIVVLTNMGFHMTSYWD 236          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Zebrafish
Match: pgap2 (post-GPI attachment to proteins 2 [Source:NCBI gene;Acc:541417])

HSP 1 Score: 103.219 bits (256), Expect = 5.429e-25
Identity = 67/204 (32.84%), Postives = 100/204 (49.02%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYI-SRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGS 711
            ++++    T C+  N LPSISA     P+ YIWRF I LH+ PRFL+A  Y  FY  + ++     +        L  F   + + E   LL LT VSS E + +H   F+ F  +S+ HM+ +  + S +   +    EM SY  K         C +   +F+ +H  YC    Y+ F++ EY+ VL NM FH  A +D G 
Sbjct:   45 YHYNDATYTHCQVPNYLPSISAAISLTPERYIWRFSIGLHSAPRFLVAAAYLSFYRGRFSRRLTEQL--------LSGFTFLLALSENVGLLLLTYVSSTETYSVHKSGFILFIGSSLFHMLCTCKLWSLIVKYSISSEEMMSYWFKLRLFLFNGGCCVLAVYFYRRHNTYCEEGIYTCFAVCEYLVVLSNMAFHMTAYWDFGG 240          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Mouse
Match: Pgap2 (post-GPI attachment to proteins 2 [Source:MGI Symbol;Acc:MGI:2385286])

HSP 1 Score: 115.161 bits (287), Expect = 2.947e-29
Identity = 77/218 (35.32%), Postives = 118/218 (54.13%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSIS-AITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRV---FYINQDLSEMKSYHQKCFCLA-VTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQAS 741
            F+F+    TDC   N LPS+S AI G  PQ Y+WRF I LH+ PRFL A+ Y   YL  ++            L   INF++  N++E  +LL LT VSS E+F IH   F+ F   S+ +M+++  + R+     ++Q+  +  S+ Q+ F +  ++   +L + F   +H +YC    Y+ F++LEY  VL NM FH  A +D G+  L  + Q  
Sbjct:   42 FHFEYTVATDCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLTAFAYWNHYLSCASPC------PGYRLLCRINFSL--NVVENLALLVLTYVSSSEDFTIHENAFIVFIAASLGYMLLTCILWRLTKKHTVSQEDRKSYSWKQRLFVINFISFFSALAVYF---RHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPE 248          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Mouse
Match: Pgap2 (post-GPI attachment to proteins 2 [Source:MGI Symbol;Acc:MGI:2385286])

HSP 1 Score: 111.694 bits (278), Expect = 4.925e-28
Identity = 76/218 (34.86%), Postives = 116/218 (53.21%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSIS-AITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRV---FYINQDLSEMKSYHQKCFCLA-VTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQAS 741
            F+F     T C   N LPS+S AI G  PQ Y+WRF I LH+ PRFL A+ Y   YL  ++            L   INF++  N++E  +LL LT VSS E+F IH   F+ F   S+ +M+++  + R+     ++Q+  +  S+ Q+ F +  ++   +L + F   +H +YC    Y+ F++LEY  VL NM FH  A +D G+  L  + Q  
Sbjct:   44 FHFKETTSTHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLTAFAYWNHYLSCASPC------PGYRLLCRINFSL--NVVENLALLVLTYVSSSEDFTIHENAFIVFIAASLGYMLLTCILWRLTKKHTVSQEDRKSYSWKQRLFVINFISFFSALAVYF---RHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPE 250          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Mouse
Match: Pgap2 (post-GPI attachment to proteins 2 [Source:MGI Symbol;Acc:MGI:2385286])

HSP 1 Score: 111.309 bits (277), Expect = 6.306e-28
Identity = 74/214 (34.58%), Postives = 109/214 (50.93%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSIS-AITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQAS 741
            F+F     T C   N LPS+S AI G  PQ Y+WRF I LH+ PRFL A+ Y   YL  ++            L   INF++  N++E  +LL LT VSS E+F IH   F+ F   S+ +M+++  + R   + +  ++ KSY  K     +  +        + +H +YC    Y+ F++LEY  VL NM FH  A +D G+  L  + Q  
Sbjct:   44 FHFKETTSTHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLTAFAYWNHYLSCASPC------PGYRLLCRINFSL--NVVENLALLVLTYVSSSEDFTIHENAFIVFIAASLGYMLLTCILWR---LTKKHTDRKSYSWKQRLFVINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPE 246          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Mouse
Match: Pgap2 (post-GPI attachment to proteins 2 [Source:MGI Symbol;Acc:MGI:2385286])

HSP 1 Score: 111.309 bits (277), Expect = 6.306e-28
Identity = 74/214 (34.58%), Postives = 109/214 (50.93%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSIS-AITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQAS 741
            F+F     T C   N LPS+S AI G  PQ Y+WRF I LH+ PRFL A+ Y   YL  ++            L   INF++  N++E  +LL LT VSS E+F IH   F+ F   S+ +M+++  + R   + +  ++ KSY  K     +  +        + +H +YC    Y+ F++LEY  VL NM FH  A +D G+  L  + Q  
Sbjct:   44 FHFKETTSTHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLTAFAYWNHYLSCASPC------PGYRLLCRINFSL--NVVENLALLVLTYVSSSEDFTIHENAFIVFIAASLGYMLLTCILWR---LTKKHTDRKSYSWKQRLFVINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPE 246          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Mouse
Match: Pgap2 (post-GPI attachment to proteins 2 [Source:MGI Symbol;Acc:MGI:2385286])

HSP 1 Score: 83.9593 bits (206), Expect = 1.924e-18
Identity = 60/176 (34.09%), Postives = 94/176 (53.41%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSIS-AITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRV---FYINQDLSEMKSYHQKCFCLA-VTILCSLGMAFFFTKHRLYC 615
            F+F     T C   N LPS+S AI G  PQ Y+WRF I LH+ PRFL A+ Y   YL  ++            L   INF++  N++E  +LL LT VSS E+F IH   F+ F   S+ +M+++  + R+     ++Q+  +  S+ Q+ F +  ++   +L + F   +H +YC
Sbjct:   44 FHFKETTSTHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLTAFAYWNHYLSCASPC------PGYRLLCRINFSL--NVVENLALLVLTYVSSSEDFTIHENAFIVFIAASLGYMLLTCILWRLTKKHTVSQEDRKSYSWKQRLFVINFISFFSALAVYF---RHNMYC 208          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. UniProt/SwissProt
Match: sp|Q9VWK6|PGP2L_DROME (Post-GPI attachment to proteins factor 2-like OS=Drosophila melanogaster OX=7227 GN=CG7990 PE=2 SV=4)

HSP 1 Score: 139.043 bits (349), Expect = 1.331e-36
Identity = 77/208 (37.02%), Postives = 120/208 (57.69%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEMK--SYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYL 720
            F +D V+ T CR  NI+PSISAITG  PQ Y WRF IALH  PR  IA+ Y+ +Y  +  ++    +  ++ L  LI   + +N +EI SL  +T +S+ EN+ +H   F+ F + S+ +M+ ++ ++ +    Q LSE +  S   K    AV+IL ++G+  FF KHR YC    +S F+  EY+  + NM FH+   +D  S ++
Sbjct:  100 FQYDDVHETHCRVYNIIPSISAITGVSPQRYFWRFSIALHIGPRIPIAFVYKNYYRSQLRRISPAQVPQTSLLITLI---LVLNCIEIASLGGVTYISNRENYPVHERIFITFMVCSLCYMLATIKLNGILNAGQALSEKQLLSIKWKKILFAVSILSTVGLLVFFAKHRFYCHDLAFSWFAFFEYLIAIANMLFHFTIIWDFPSQFM 304          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. UniProt/SwissProt
Match: sp|Q9UHJ9|PGAP2_HUMAN (Post-GPI attachment to proteins factor 2 OS=Homo sapiens OX=9606 GN=PGAP2 PE=1 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 7.205e-29
Identity = 75/218 (34.40%), Postives = 116/218 (53.21%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSIS-AITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRV---FYINQDLSEMKSYHQKCFCLA-VTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQAS 741
            F+F     T C   N LPS+S AI G  PQ Y+WRF I LH+ PRFL+A+ Y   YL  ++          +    L   N  +N++E  +LL LT VSS E+F IH   F+ F  +S+ HM+++  + R+     ++Q+  +  S+ Q+ F +  ++   +L + F   +H +YC    Y+ F++LEY  VL NM FH  A +D G+  L  + Q  
Sbjct:   44 FHFKETTATHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSP--------CSCYRPLCRLNFGLNVVENLALLVLTYVSSSEDFTIHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKSYSWKQRLFIINFISFFSALAVYF---RHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPE 250          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. UniProt/SwissProt
Match: sp|A8KBG2|PGAP2_XENTR (Post-GPI attachment to proteins factor 2 OS=Xenopus tropicalis OX=8364 GN=pgap2 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.485e-28
Identity = 78/208 (37.50%), Postives = 102/208 (49.04%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISA-ITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQ-DLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYL 720
            F F     T C   N LPS+SA I G  PQ YIWR  I LH+ PRFL+   Y  +Y         G    S     L + N  +N  EIF L+ LT VSS EN+ +H L F+ F + S+ +M ++  + RV       L E  SY  K       +L  L     +  H +YC    Y+ F+LLEY+ VL NMGFH  A +D G+  L
Sbjct:   43 FNFSETTATHCHVPNYLPSVSAAIGGETPQRYIWRLCIGLHSAPRFLVGVAYLHYYQ--------GTPCSSPAYPRLCHLNFLLNCCEIFFLILLTYVSSSENYEVHKLGFMAFMLFSVGYMFVTCSLWRVARKGSGSLEERTSYAWKKRLFGFYLLMFLSSILVYIWHNMYCEAGVYTVFALLEYLVVLSNMGFHMTAWWDFGNKEL 242          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. UniProt/SwissProt
Match: sp|A6H7B8|PGAP2_BOVIN (Post-GPI attachment to proteins factor 2 OS=Bos taurus OX=9913 GN=PGAP2 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 2.390e-28
Identity = 75/218 (34.40%), Postives = 115/218 (52.75%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSIS-AITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRV---FYINQDLSEMKSYHQKCFCLA-VTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQAS 741
            F+F     T C   N LPS+S AI G  PQ Y+WRF I LH+ PRFL+A+ Y   YL  ++               L   N  +N++E  +LL LT VSS E+F IH   F+ F  +S+ HM+++  + R+     ++Q+  +  ++ Q+ F +  V+   +L + F   +H +YC    Y+ F++LEY  VL NM FH  A +D G+  L  + Q  
Sbjct:   44 FHFKETTATHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSP--------CAGYRPLCRLNFGLNVVENVALLVLTYVSSSEDFTIHENAFIVFIASSLSHMLLTCILWRLTKKHTVSQEDRKSYNWKQRLFIINFVSFFTALAVYF---RHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPE 250          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. UniProt/SwissProt
Match: sp|Q3TQR0|PGAP2_MOUSE (Post-GPI attachment to proteins factor 2 OS=Mus musculus OX=10090 GN=Pgap2 PE=1 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 3.445e-27
Identity = 76/218 (34.86%), Postives = 116/218 (53.21%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSIS-AITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRV---FYINQDLSEMKSYHQKCFCLA-VTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQAS 741
            F+F     T C   N LPS+S AI G  PQ Y+WRF I LH+ PRFL A+ Y   YL  ++            L   INF++  N++E  +LL LT VSS E+F IH   F+ F   S+ +M+++  + R+     ++Q+  +  S+ Q+ F +  ++   +L + F   +H +YC    Y+ F++LEY  VL NM FH  A +D G+  L  + Q  
Sbjct:   44 FHFKETTSTHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLTAFAYWNHYLSCASPC------PGYRLLCRINFSL--NVVENLALLVLTYVSSSEDFTIHENAFIVFIAASLGYMLLTCILWRLTKKHTVSQEDRKSYSWKQRLFVINFISFFSALAVYF---RHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPE 250          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. TrEMBL
Match: E0VDS0 (Fgf receptor activating protein, putative OS=Pediculus humanus subsp. corporis OX=121224 GN=8238390 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.485e-36
Identity = 80/213 (37.56%), Postives = 117/213 (54.93%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQAS 741
            F  D ++ T C+  N++PSISAITG  PQ Y+WR  +A H  PR +IA  Y+Q+Y   S  L    +N  NWL   +NF  W++I EI +L  +T +S+ EN+ IH   F+ F  +S+ +M+ SL I  V ++ +   E  SY  K      +IL S G+  FF KHR  C    +S FS+ EY+    NMGFH     D  +  ++ S+ + 
Sbjct:   50 FQKDDIHETHCKVYNVVPSISAITGISPQKYLWRICVAFHVGPRLVIAIVYKQYY---SKLLEKENLNGKNWL---LNFCFWLSITEIVTLCGVTYISNRENYPIHEKIFITFMFSSLSYMLASLKIFNVVHVRKTNEENYSYKLKKLFFTASILTSFGLFIFFVKHRFLCHDMAFSWFSVCEYLIAFFNMGFHTTVILDFPTEQVTVSKGSE 256          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. TrEMBL
Match: B4JKL7 (GH12034 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH12034 PE=4 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.865e-36
Identity = 77/208 (37.02%), Postives = 123/208 (59.13%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLS--EMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYL 720
            F +D V+ T CR  NI+PSISAITG  PQ Y WRF IALH  PR  IA+ Y+ +Y  +  ++   ++  ++WL  LI   + +N +EI +L  +T +S+ EN+ +H   F+ F I S+ +M+ ++ ++ + Y  Q L+  + +S   K    AV+IL ++G+  FF KHR YC    +S F+  EY+  + NM FH+   +D  S ++
Sbjct:  120 FQYDDVHETHCRVYNIVPSISAITGVSPQRYFWRFSIALHIGPRIPIAFVYKNYYRAQLARIAPALVPKTSWLITLI---LVLNCIEIAALGGVTYISNRENYPVHERIFITFMICSLCYMLATIKLNDILYARQTLTAQQRQSIKWKKILFAVSILSTMGLLVFFAKHRFYCHDLAFSWFAFFEYLIAIANMLFHFTIIWDFPSQFM 324          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. TrEMBL
Match: A0A0A9XFM9 (Post-GPI attachment to proteins factor 2-like protein OS=Lygus hesperus OX=30085 GN=CG7990 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.013e-36
Identity = 78/218 (35.78%), Postives = 122/218 (55.96%), Query Frame = 1
Query:  118 VNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQASLMSNGIGKKE 771
            ++ T C+  N++PSISAITG  P+ Y+WR  IALH  PRFLI+  Y  +Y  +  KL +   +   W   L+    WVNI EI SL+ +T +S+ +N+ +H   F+ F I+S+++M++SL I R  +      +  SY  K      +I+C+ G+  FF KHRL+C    +S F+L EYI    NMG+H     D  +  ++ + + S      GK++
Sbjct:   60 IHETHCKVYNVIPSISAITGISPERYLWRMSIALHLGPRFLISSVYYNYYASR-VKLIVPASDQ-EWYTKLVKICYWVNITEISSLMGVTYISNRDNYPVHEKIFITFMISSLVYMLVSLIIYRRIHQPMTKRQEISYAIKKLLFITSIVCTAGLVIFFMKHRLFCHVLAFSWFALCEYIIASANMGYHVTVFLDFPNEVMAIAPKES----STGKED 271          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. TrEMBL
Match: A0A484ARL6 (Uncharacterized protein (Fragment) OS=Drosophila navojoa OX=7232 GN=AWZ03_014490 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 4.037e-36
Identity = 76/208 (36.54%), Postives = 122/208 (58.65%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLS--EMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYL 720
            F +D V+ T CR  NI+PSISAITG  PQ Y WRF IALH  PR  IA+ Y+ +Y  + T+L   ++  ++WL  LI   + +N +EI +L  +T +S+ EN+ +H   F+ F + S+ +M+ ++ ++ +    Q L+  +++S   K      +IL ++G+  FF KHR YC    +S F+  EY+  + NM FH+   +D  S Y+
Sbjct:   60 FQYDDVHETHCRVYNIIPSISAITGVSPQRYFWRFSIALHIGPRIPIAFVYKNYYRAQLTRLAPSLVPKTSWLITLI---LVLNCIEIAALGGVTYISNRENYPVHERIFITFMVCSLCYMLATIKLNGILNARQTLNAQQLQSIKWKKILFVTSILSTIGLLVFFAKHRFYCHDLAFSWFAFFEYLIAIANMLFHFTIIWDFPSQYM 264          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. TrEMBL
Match: B7PJL3 (FGF receptor activating protein, putative OS=Ixodes scapularis OX=6945 GN=8029906 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 7.649e-36
Identity = 82/211 (38.86%), Postives = 117/211 (55.45%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISAITG-HRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQ-DLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTS 729
            F F  V  T C+  N+LPSISA  G + PQ YIWR GI LHA PR L++  YR++Y          ++  +     L +   W+N++E   LL LT VSS EN+ IH   FV F ++++L+M++S +I  V + +    +E KS   K   +  ++ CSL   +FF +H  YC P  Y+ F+L EYI VL N+GFH  A +D     L  S
Sbjct:   37 FQFKQVTATHCQVANLLPSISAAIGSYTPQRYIWRTGIGLHAAPRLLVSVMYRRYYA--------AMLADTPKYQFLASAAFWLNVVENLCLLGLTNVSSSENYPIHEKMFVTFMVSALLYMLVSCFIPTVAFKHMLSQTERKSLRTKKQLMITSVFCSLLATYFFLRHNWYCEPGVYTFFALAEYIVVLCNIGFHMTAYWDFDDQQLYVS 239          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Cavefish
Match: pgap2 (post-GPI attachment to proteins 2 [Source:NCBI gene;Acc:103040677])

HSP 1 Score: 105.145 bits (261), Expect = 1.108e-25
Identity = 70/204 (34.31%), Postives = 99/204 (48.53%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYI-SRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGS 711
            ++++    T C+  N LPSISA     P+ YIWRF I LH+ PRFL+A  Y  FY  + ++     +        L  F     + E   LL LT V S E + +H   F+ F  +S+LHM+ +  +   +   +    EM S   K       I   L   +FF +H  YC P  Y+ F+L EY+ VL NM FH  A +D GS
Sbjct:   45 YHYNEATYTHCQVYNYLPSISAAISLTPERYIWRFCIGLHSAPRFLLAAAYFNFYRGRFSRQLKDQL--------LSVFTFLCALSENVGLLLLTYVCSTETYSLHKNGFIVFIASSLLHMLCTCRLWQMITKYSVSAEEMTSCRYKIRLFLFNISLCLLAGYFFRRHNKYCEPGIYTLFALCEYLVVLSNMAFHMTAFWDFGS 240          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Cavefish
Match: pgap2 (post-GPI attachment to proteins 2 [Source:NCBI gene;Acc:103040677])

HSP 1 Score: 79.337 bits (194), Expect = 1.702e-16
Identity = 58/184 (31.52%), Postives = 87/184 (47.28%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYI-SRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLE 651
            ++++    T C+  N LPSISA     P+ YIWRF I LH+ PRFL+A  Y  FY  + ++     +        L  F     + E   LL LT V S E + +H   F+ F  +S+LHM+ +  +   +   +    EM S   K       I   L   +FF +H  YC P   S+F++L+
Sbjct:   45 YHYNEATYTHCQVYNYLPSISAAISLTPERYIWRFCIGLHSAPRFLLAAAYFNFYRGRFSRQLKDQL--------LSVFTFLCALSENVGLLLLTYVCSTETYSLHKNGFIVFIASSLLHMLCTCRLWQMITKYSVSAEEMTSCRYKIRLFLFNISLCLLAGYFFRRHNKYCEP--GSEFNVLD 218          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Nematostella
Match: EDO47130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNE7])

HSP 1 Score: 112.464 bits (280), Expect = 8.425e-29
Identity = 76/219 (34.70%), Postives = 115/219 (52.51%), Query Frame = 1
Query:  106 YFDIVNRTDCRAINILPSISAITGH-RPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEMKSYHQKCFCLAVTILC------SLGMA-FFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQA 738
            ++D V +T C   N +PSISA TG   P+ YIWR GIA H++ R +  +    FY  K++         S W   L   N  V ++E  +L+ LT VSS EN+ +H   F+ F ++++++M+ +  I R       LS + + HQ+   +   ++C      S  MA +FF +H  YC    YS F+L EY+ VL N+GFH     DIG + L+ S  A
Sbjct:   37 HWDQVTKTHCNVPNYVPSISAATGDFSPEKYIWRIGIAYHSLLRMVFPFVNYNFYKYKASSNI-----KSKWFPWLNFLNACVTVVENLALVLLTYVSSSENYSVHEASFITFQVSAMVYMLTNCIIFR-----WTLSSLPT-HQESVSMRWKVICLLLNYSSFAMAVYFFFRHNWYCESGVYSLFALCEYVTVLSNIGFHGTVAIDIGGSLLTLSSIA 244          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Medaka
Match: PGAP2 (post-GPI attachment to proteins factor 2 [Source:NCBI gene;Acc:101159033])

HSP 1 Score: 113.235 bits (282), Expect = 1.095e-28
Identity = 77/205 (37.56%), Postives = 113/205 (55.12%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISR-VFYINQDLSEMKSYHQKCFCLAVTILCSLGMA-FFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGS 711
            F+F+    T C+  N LPSISA     P+ YIWRF I LH+ PR ++A+TY +FY     K+        + L  L   N+  +I E   LL LT VSS E +++H   FV F ++S+ +M+I+  + + V   + +  + KS+H K   L +  LC  G A FF+ KH +YC    Y+ F+L EY+ V+ NM FH  A +D  S
Sbjct:   45 FHFEDATGTHCQVPNYLPSISAAISLSPECYIWRFCIGLHSAPRLMVAFTYFRFY-----KICFDTRFPESPLSCL---NLAFSIFENIGLLLLTYVSSSETYFVHKEGFVLFIVSSLTYMLITCRLWKSVKRYSLNPEDAKSHHWKVRLLLLN-LCFYGFAGFFYWKHNVYCESGSYTFFALFEYLVVISNMAFHLTAMWDFKS 240          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Medaka
Match: pgap2 (post-GPI attachment to proteins factor 2 [Source:NCBI gene;Acc:101163350])

HSP 1 Score: 95.1301 bits (235), Expect = 4.243e-22
Identity = 66/206 (32.04%), Postives = 101/206 (49.03%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISL---YISRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGS 711
            ++++    T C+  N LPSIS+     P+ YIWR  I LH+ PR+L +  Y  FY  +  +    ++        L    +  NI E   LL LT VSS E +  H   F+ F  +S+LHM+++    ++ +  Y+N +  E+ SY  K       I C    A+ F +H  +C    Y+ F+  EY+ V  NM FH  A +D GS
Sbjct:   45 YHYEDSTYTHCQVSNYLPSISSAISRVPERYIWRCCIGLHSAPRYLFSVVYFNFYRRRFERKLPELL--------LSGLALLCNIAENSGLLLLTYVSSTETYSYHKNGFIVFVGSSLLHMLVTCRLWFVLKRQYLNPE--EVTSYVWKLRLFLFNISCCGAAAYCFRRHNKFCEDGVYTVFAFFEYMVVFSNMAFHMTAFWDFGS 240          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Medaka
Match: PGAP2 (post-GPI attachment to proteins factor 2 [Source:NCBI gene;Acc:101159033])

HSP 1 Score: 81.2629 bits (199), Expect = 2.967e-17
Identity = 60/162 (37.04%), Postives = 87/162 (53.70%), Query Frame = 1
Query:  136 RAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISR-VFYINQDLSEMKSYHQKCFCLAVTILCSLGMA-FFFTKHRLYC 615
            +  N LPSISA     P+ YIWRF I LH+ PR ++A+TY +FY       F      S     L   N+  +I E   LL LT VSS E +++H   FV F ++S+ +M+I+  + + V   + +  + KS+H K   L +  LC  G A FF+ KH +YC
Sbjct:   39 QVPNYLPSISAAISLSPECYIWRFCIGLHSAPRLMVAFTYFRFY----KICFDTRFPESP----LSCLNLAFSIFENIGLLLLTYVSSSETYFVHKEGFVLFIVSSLTYMLITCRLWKSVKRYSLNPEDAKSHHWKVRLLLLN-LCFYGFAGFFYWKHNVYC 191          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Planmine SMEST
Match: SMESG000051249.1 (SMESG000051249.1)

HSP 1 Score: 457.988 bits (1177), Expect = 4.068e-163
Identity = 223/224 (99.55%), Postives = 224/224 (100.00%), Query Frame = 1
Query:  103 FYFDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQASLMSNGIGKKEI 774
            FYFDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWL+HLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQASLMSNGIGKKEI
Sbjct:   31 FYFDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLFHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGSTYLSTSRQASLMSNGIGKKEI 254          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Planmine SMEST
Match: SMESG000044614.1 (SMESG000044614.1)

HSP 1 Score: 116.701 bits (291), Expect = 4.266e-30
Identity = 70/198 (35.35%), Postives = 103/198 (52.02%), Query Frame = 1
Query:  109 FDIVNRTDCRAINILPSISAITGHRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFD 702
            FD +N   C   N +PS+SAITG  PQ YIWR  IALH+ PRFLIA  +  FY   +  + +   N  N    +   N  +N++E  SL+ ++ + S++N+ +H   F+ F           + +S     N    EM SY  K     + +LC+ G+ +F   HR+YCTP  +S FS  EY   + NMGF+  A+ D
Sbjct:   42 FDKINEIVCGVKNFIPSVSAITGTSPQRYIWRVFIALHSAPRFLIACIHYNFY---NNNIDVVPFNKRNSYLLIAKLNFIINVIENLSLIGVSYIPSIDNYPMHEKIFITF-----------MRLSHGDSANWTKLEMLSYKFKVNFFILILLCTTGLVYFIAIHRIYCTPNAFSWFSACEYGIGMSNMGFNLSASLD 225          
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Planmine SMEST
Match: SMESG000002779.1 (SMESG000002779.1)

HSP 1 Score: 62.003 bits (149), Expect = 7.157e-11
Identity = 63/202 (31.19%), Postives = 97/202 (48.02%), Query Frame = 1
Query:  109 FDIVNRTDCRAINILPSISAITG-HRPQIYIWRFGIALHAVPRFLIAYTYRQFYLDKSTKLFLGIINHSNWLYHLINFNMWVNILEIFSLLALTVVSSVENFYIHSLFFVGFAITSILHMVISLYISRVFYINQDLSEMKSYHQKCFCLAVTILCSLGMAFFFTKHRLYCTPYDYSKFSLLEYIFVLINMGFHYIATFDIGS 711
            FD VN T C   N LPS SA  G +  Q+ IW++      + R  I Y     +L+K  K        +N    +I     +N +EI SL++L++ SS   + IH + F+ F + SI+  V ++Y SR +   Q +         C    ++IL + G++F    H + C  Y YS F L EYI +  N+ FH +   +I S
Sbjct:   32 FDEVNNTHCHVSNFLPSFSAAVGNYELQLTIWQYVTVPVCLFRLFILYLVYICWLEKYPK--------AN---SIITIMTIINFIEIVSLISLSIFSSSRYYDIHKISFITFLLMSIVFQVFNVYFSRKY---QKIENNFLRRSICTSYMISILLA-GLSFVI--HNILCISYVYSVFGLSEYILITTNVVFHTLVAKEIDS 216          
The following BLAST results are available for this feature:
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGAP24.546e-3034.86post-GPI attachment to proteins 2 [Source:HGNC Sym... [more]
PGAP24.546e-3034.86post-GPI attachment to proteins 2 [Source:HGNC Sym... [more]
PGAP21.500e-2934.40post-GPI attachment to proteins 2 [Source:HGNC Sym... [more]
PGAP22.628e-2934.27post-GPI attachment to proteins 2 [Source:HGNC Sym... [more]
PGAP24.818e-2934.40post-GPI attachment to proteins 2 [Source:HGNC Sym... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tag-1891.569e-2336.10Post-GPI attachment to proteins factor 2 [Source:... [more]
tag-1891.569e-2336.10Post-GPI attachment to proteins factor 2 [Source:... [more]
Y38F1A.87.049e-927.85pep chromosome:WBcel235:II:12997986:13000853:-1 ge... [more]
Y11D7A.92.473e-727.61pep chromosome:WBcel235:IV:9253979:9256117:-1 gene... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG79901.328e-3737.02gene:FBgn0030997 transcript:FBtr0074695[more]
PGAP22.990e-1631.22gene:FBgn0031284 transcript:FBtr0078039[more]
back to top
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgap25.429e-2532.84post-GPI attachment to proteins 2 [Source:NCBI gen... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgap22.947e-2935.32post-GPI attachment to proteins 2 [Source:MGI Symb... [more]
Pgap24.925e-2834.86post-GPI attachment to proteins 2 [Source:MGI Symb... [more]
Pgap26.306e-2834.58post-GPI attachment to proteins 2 [Source:MGI Symb... [more]
Pgap26.306e-2834.58post-GPI attachment to proteins 2 [Source:MGI Symb... [more]
Pgap21.924e-1834.09post-GPI attachment to proteins 2 [Source:MGI Symb... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VWK6|PGP2L_DROME1.331e-3637.02Post-GPI attachment to proteins factor 2-like OS=D... [more]
sp|Q9UHJ9|PGAP2_HUMAN7.205e-2934.40Post-GPI attachment to proteins factor 2 OS=Homo s... [more]
sp|A8KBG2|PGAP2_XENTR1.485e-2837.50Post-GPI attachment to proteins factor 2 OS=Xenopu... [more]
sp|A6H7B8|PGAP2_BOVIN2.390e-2834.40Post-GPI attachment to proteins factor 2 OS=Bos ta... [more]
sp|Q3TQR0|PGAP2_MOUSE3.445e-2734.86Post-GPI attachment to proteins factor 2 OS=Mus mu... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E0VDS01.485e-3637.56Fgf receptor activating protein, putative OS=Pedic... [more]
B4JKL72.865e-3637.02GH12034 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH... [more]
A0A0A9XFM94.013e-3635.78Post-GPI attachment to proteins factor 2-like prot... [more]
A0A484ARL64.037e-3636.54Uncharacterized protein (Fragment) OS=Drosophila n... [more]
B7PJL37.649e-3638.86FGF receptor activating protein, putative OS=Ixode... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pgap21.108e-2534.31post-GPI attachment to proteins 2 [Source:NCBI gen... [more]
pgap21.702e-1631.52post-GPI attachment to proteins 2 [Source:NCBI gen... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO471308.425e-2934.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PGAP21.095e-2837.56post-GPI attachment to proteins factor 2 [Source:N... [more]
pgap24.243e-2232.04post-GPI attachment to proteins factor 2 [Source:N... [more]
PGAP22.967e-1737.04post-GPI attachment to proteins factor 2 [Source:N... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 2-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000051249.14.068e-16399.55SMESG000051249.1[more]
SMESG000044614.14.266e-3035.35SMESG000044614.1[more]
SMESG000002779.17.157e-1131.19SMESG000002779.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035279 ID=SMED30035279|Name=Post-GPI attachment to proteins factor 2-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1173bp
GATAGTAGTAAAATGTTAATAATTAAATTAGATCTTTTAATTACAATATT
ATTATGCTTGCCATTATCTTCATTATTGATATGCTTTTTAATCTCAGTAT
TATTCTATTTCGACATTGTCAACAGAACAGATTGTCGAGCAATAAATATT
CTTCCCAGTATAAGCGCAATCACAGGTCATCGACCACAGATTTATATTTG
GAGGTTTGGAATAGCTTTACACGCAGTTCCTCGATTTTTAATAGCTTATA
CCTATCGTCAATTCTATTTGGATAAATCGACAAAATTATTTCTCGGAATA
ATTAATCACTCTAATTGGCTTTATCATTTAATTAATTTTAACATGTGGGT
TAACATATTAGAAATATTCAGTTTGTTAGCTTTAACAGTAGTATCGTCAG
TGGAAAATTTCTACATACATTCCTTATTTTTTGTCGGATTTGCCATAACC
TCAATTCTTCATATGGTTATTAGTCTTTATATTAGCCGAGTATTTTATAT
AAATCAAGATCTATCCGAGATGAAATCCTACCACCAGAAGTGTTTTTGTT
TAGCAGTCACTATTCTCTGTTCATTGGGAATGGCATTTTTCTTCACTAAA
CATAGACTTTATTGTACACCGTACGATTATTCAAAATTTTCATTGCTTGA
ATATATTTTTGTTTTAATCAATATGGGTTTTCACTACATCGCGACATTTG
ACATTGGATCCACTTACCTGTCCACTAGTAGACAAGCAAGTCTTATGAGT
AACGGCATTGGTAAAAAGGAAATTTGACTAATTTCCATGAAAACAATTAA
TTGATTCAACTGATTTTCTCTCCGTTTTTCACAATGGAAATTTTAATTTT
CCTGATTTCTTTTATTCTGATTCTTTTAATTGGTCTCGGAATCCAAAATC
TGAGATCGAAATATCTTGATCATATTGTTGCATTTTGTTGAGTCTGATTT
TATTTTCAAGGCCTGAGATCTATGAGAATTCTATTAACTTCAATTTTATT
TTTATCCTATTTGTTTTTTTGTCGATAATAAACAGGAAACAACTTTTAGT
TTCCACAGTGCATTTCGTTTTCAGGCATAATTACGTGTTCAATGATTCGG
AAACAATTTCCAATAACGAAATCAAAATGGAGAATTGCCATTAAAAATAT
CCAATCCAATTGTGACTTTGTTG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005575cellular_component
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR039545PGAP2
IPR019402Frag1/DRAM/Sfk1
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019402Frag1/DRAM/Sfk1PFAMPF10277Frag1coord: 12..236
e-value: 1.2E-28
score: 100.1
NoneNo IPR availablePANTHERPTHR12892:SF17POST-GPI ATTACHMENT TO PROTEINS FACTOR 2-LIKEcoord: 6..245
NoneNo IPR availableTMHMMTMhelixcoord: 218..240
NoneNo IPR availableTMHMMTMhelixcoord: 181..198
NoneNo IPR availableTMHMMTMhelixcoord: 138..160
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
IPR039545Post-GPI attachment to proteins factor 2PANTHERPTHR12892FGF RECEPTOR ACTIVATING PROTEIN 1coord: 6..245