Wilms tumor protein 1-interacting protein homolog

Overview
NameWilms tumor protein 1-interacting protein homolog
Smed IDSMED30035262
Length (bp)830
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Wilms tumor protein 1-interacting protein homolog (SMED30035262) t-SNE clustered cells

Violin plots show distribution of expression levels for Wilms tumor protein 1-interacting protein homolog (SMED30035262) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Wilms tumor protein 1-interacting protein homolog (SMED30035262) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Wilms tumor protein 1-interacting protein homolog (SMED30035262) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035262

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30035262SMESG000031934.1 dd_Smed_v4_7984_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035262SMESG000031934.1 dd_Smed_v4_7984_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Human
Match: WTIP (WT1 interacting protein [Source:HGNC Symbol;Acc:HGNC:20964])

HSP 1 Score: 176.022 bits (445), Expect = 2.897e-54
Identity = 76/159 (47.80%), Postives = 112/159 (70.44%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C +C   I  A+ ACQAMG L+H +CF+C  C R+L+GK FY    K++C+ED+LY GFQQ+AD+C +CGH+I   IL+A G  YH  CFRC++CNECLDG PFT+D +  I C++DY+   +  C SC +PI+P +   +T +VV +++++H AC+ 
Sbjct:   40 ICIKCGLGIYGAQQACQAMGSLYHTDCFTCDSCGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLIMEMILQALGKSYHPGCFRCSVCNECLDGVPFTVDVENNIYCVRDYHTVFAPKCASCARPILPAQGCETTIRVVSMDRDYHVACYH 198          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Human
Match: LIMD1 (LIM domains containing 1 [Source:HGNC Symbol;Acc:HGNC:6612])

HSP 1 Score: 185.267 bits (469), Expect = 2.547e-53
Identity = 82/157 (52.23%), Postives = 112/157 (71.34%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +CS  +  A  ACQAMG L+H+ CF+C  C R+L+GK FY  +GK+FCEED+LY GFQQSADRC +CGH+I + IL+A G  YH  CFRC ICNECLDG PFT+D + KI C++DY+   +  C +C  PI+P + S  T +VV +++++H  C+
Sbjct:  472 CVKCSKGVFGAGQACQAMGNLYHDTCFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGHLIMDMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGLPILPPEGSDETIRVVSMDRDYHVECY 628          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Human
Match: WTIP (WT1 interacting protein [Source:HGNC Symbol;Acc:HGNC:20964])

HSP 1 Score: 178.333 bits (451), Expect = 1.522e-52
Identity = 76/158 (48.10%), Postives = 112/158 (70.89%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            +C +C   I  A+ ACQAMG L+H +CF+C  C R+L+GK FY    K++C+ED+LY GFQQ+AD+C +CGH+I   IL+A G  YH  CFRC++CNECLDG PFT+D +  I C++DY+   +  C SC +PI+P +   +T +VV +++++H AC+
Sbjct:  224 ICIKCGLGIYGAQQACQAMGSLYHTDCFTCDSCGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLIMEMILQALGKSYHPGCFRCSVCNECLDGVPFTVDVENNIYCVRDYHTVFAPKCASCARPILPAQGCETTIRVVSMDRDYHVACY 381          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Human
Match: LIMD1 (LIM domains containing 1 [Source:HGNC Symbol;Acc:HGNC:6612])

HSP 1 Score: 170.629 bits (431), Expect = 3.042e-48
Identity = 76/137 (55.47%), Postives = 99/137 (72.26%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEK 475
            C +CS  +  A  ACQAMG L+H+ CF+C  C R+L+GK FY  +GK+FCEED+LY GFQQSADRC +CGH+I + IL+A G  YH  CFRC ICNECLDG PFT+D + KI C++DY+   +  C +C  PI+P +
Sbjct:  472 CVKCSKGVFGAGQACQAMGNLYHDTCFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGHLIMDMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGLPILPPE 608          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Human
Match: AJUBA (ajuba LIM protein [Source:HGNC Symbol;Acc:HGNC:20250])

HSP 1 Score: 160.614 bits (405), Expect = 4.793e-45
Identity = 69/157 (43.95%), Postives = 107/157 (68.15%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +C+  I    +ACQA+  L+H  CF CC C R L+ K FY  +G ++CEEDYL+ GFQ++A++C +CGH+I  KIL+A G  YH  CFRC +CN+CLDG PFT+D   ++ C+ DY+ +++  C +C QPI+P +      +V+ +++++HF C+
Sbjct:  338 CIKCNKGIYGQSNACQALDSLYHTQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGKSYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIVRVISMDRDYHFECY 494          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Celegans
Match: zyx-1 (Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4])

HSP 1 Score: 114.775 bits (286), Expect = 4.777e-31
Identity = 58/159 (36.48%), Postives = 86/159 (54.09%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C  C   I   +  C AM  +FH +CF C  C + L G  FY    K  CE  Y     Q S ++C  C   I++K+L+A G  YHV+CF C  C + LDG PFTLDKD  + C+  ++   +  C  C++PI+P+     + +VV ++K FH  C++
Sbjct:    7 ICVGCGKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCEGCY-----QNSLEKCTACNRAISDKLLRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCFHDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYK 160          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Celegans
Match: zyx-1 (Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4])

HSP 1 Score: 114.775 bits (286), Expect = 1.374e-30
Identity = 58/159 (36.48%), Postives = 86/159 (54.09%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C  C   I   +  C AM  +FH +CF C  C + L G  FY    K  CE  Y     Q S ++C  C   I++K+L+A G  YHV+CF C  C + LDG PFTLDKD  + C+  ++   +  C  C++PI+P+     + +VV ++K FH  C++
Sbjct:   52 ICVGCGKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCEGCY-----QNSLEKCTACNRAISDKLLRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCFHDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYK 205          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Celegans
Match: zyx-1 (Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4])

HSP 1 Score: 114.39 bits (285), Expect = 1.520e-29
Identity = 58/159 (36.48%), Postives = 86/159 (54.09%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C  C   I   +  C AM  +FH +CF C  C + L G  FY    K  CE  Y     Q S ++C  C   I++K+L+A G  YHV+CF C  C + LDG PFTLDKD  + C+  ++   +  C  C++PI+P+     + +VV ++K FH  C++
Sbjct:  144 ICVGCGKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCEGCY-----QNSLEKCTACNRAISDKLLRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCFHDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYK 297          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Celegans
Match: zyx-1 (Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4])

HSP 1 Score: 112.079 bits (279), Expect = 9.719e-28
Identity = 58/160 (36.25%), Postives = 87/160 (54.37%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCG-FQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C  C   I   +  C AM  +FH +CF C  C + L G  FY    K  CE      G +Q S ++C  C   I++K+L+A G  YHV+CF C  C + LDG PFTLDKD  + C+  ++   +  C  C++PI+P+     + +VV ++K FH  C++
Sbjct:  410 ICVGCGKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCE------GCYQNSLEKCTACNRAISDKLLRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCFHDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYK 563          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Celegans
Match: zyx-1 (Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4])

HSP 1 Score: 112.079 bits (279), Expect = 9.719e-28
Identity = 58/160 (36.25%), Postives = 87/160 (54.37%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCG-FQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C  C   I   +  C AM  +FH +CF C  C + L G  FY    K  CE      G +Q S ++C  C   I++K+L+A G  YHV+CF C  C + LDG PFTLDKD  + C+  ++   +  C  C++PI+P+     + +VV ++K FH  C++
Sbjct:  410 ICVGCGKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCE------GCYQNSLEKCTACNRAISDKLLRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCFHDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYK 563          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Fly
Match: jub (gene:FBgn0030530 transcript:FBtr0340292)

HSP 1 Score: 181.8 bits (460), Expect = 3.583e-52
Identity = 81/158 (51.27%), Postives = 107/158 (67.72%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            +C  C   +  A  ACQAMG L+H NCF CC C R L+GK FY  HG+++CEEDY+Y GFQQ+A++C ICGH+I   IL+A G  YH  CFRC +CNECLDG PFT+D D KI C+ DY+   +  C SC + I P + +  T +VV ++K+FH  C+
Sbjct:  505 ICHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGKGITPVEGTDETVRVVSMDKDFHVDCY 662          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Fly
Match: jub (gene:FBgn0030530 transcript:FBtr0303418)

HSP 1 Score: 181.8 bits (460), Expect = 3.583e-52
Identity = 81/158 (51.27%), Postives = 107/158 (67.72%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            +C  C   +  A  ACQAMG L+H NCF CC C R L+GK FY  HG+++CEEDY+Y GFQQ+A++C ICGH+I   IL+A G  YH  CFRC +CNECLDG PFT+D D KI C+ DY+   +  C SC + I P + +  T +VV ++K+FH  C+
Sbjct:  505 ICHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGKGITPVEGTDETVRVVSMDKDFHVDCY 662          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Fly
Match: jub (gene:FBgn0030530 transcript:FBtr0073834)

HSP 1 Score: 181.8 bits (460), Expect = 4.062e-52
Identity = 81/158 (51.27%), Postives = 107/158 (67.72%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            +C  C   +  A  ACQAMG L+H NCF CC C R L+GK FY  HG+++CEEDY+Y GFQQ+A++C ICGH+I   IL+A G  YH  CFRC +CNECLDG PFT+D D KI C+ DY+   +  C SC + I P + +  T +VV ++K+FH  C+
Sbjct:  515 ICHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGKGITPVEGTDETVRVVSMDKDFHVDCY 672          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Fly
Match: jub (gene:FBgn0030530 transcript:FBtr0303419)

HSP 1 Score: 175.252 bits (443), Expect = 7.203e-50
Identity = 81/163 (49.69%), Postives = 107/163 (65.64%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYL-----YCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            +C  C   +  A  ACQAMG L+H NCF CC C R L+GK FY  HG+++CEEDY+     Y GFQQ+A++C ICGH+I   IL+A G  YH  CFRC +CNECLDG PFT+D D KI C+ DY+   +  C SC + I P + +  T +VV ++K+FH  C+
Sbjct:  505 ICHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYMNSLLQYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGKGITPVEGTDETVRVVSMDKDFHVDCY 667          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Fly
Match: Zyx (gene:FBgn0011642 transcript:FBtr0309882)

HSP 1 Score: 116.701 bits (291), Expect = 1.688e-29
Identity = 58/158 (36.71%), Postives = 86/158 (54.43%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            C +C+  +      C AM  ++H  CF+C  C   L+GK FY   GK +CE DYL     Q+ ++C +C   I  +IL+A G  YH  CF C +C + LDG  FT+D   +  CI D++   +  C  C QPI+P+     T +VV L++ FH  C++
Sbjct:  299 CVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYL-----QTLEKCSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYK 451          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Zebrafish
Match: wtip (WT1 interacting protein [Source:NCBI gene;Acc:566046])

HSP 1 Score: 184.882 bits (468), Expect = 1.571e-53
Identity = 81/158 (51.27%), Postives = 111/158 (70.25%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            +C +C   +  A  ACQAMG L+H NCF+CC C R+L+GK FY  +GK++CEED+LY GFQQ+A++C +CGH+I   IL+A G  YH  CFRC IC E LDG PFT+D +  I C+KDY+   +  C SCNQPI+P + S  T +VV ++K++H  C+
Sbjct:  438 ICVKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTAEKCFVCGHLIMEMILQALGRSYHPGCFRCVICKEGLDGVPFTVDVENNIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVDCY 595          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Zebrafish
Match: ajuba (ajuba LIM protein [Source:ZFIN;Acc:ZDB-GENE-030131-9341])

HSP 1 Score: 162.155 bits (409), Expect = 4.904e-45
Identity = 68/157 (43.31%), Postives = 106/157 (67.52%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +C   +  A++ACQA+  L+H  CF+C  C R L+ K FY  +G ++C+EDY++ GFQ++A++C +CGH+I  +IL+A GN YH  CFRCT+C++ LDG PFT+D    + C+ DY  + +  C +C QPI+P + S    +VV + K++HF C+
Sbjct:  486 CVKCGKGVYGADNACQALDSLYHTRCFTCVSCGRTLRNKDFYNVNGSVYCKEDYMFSGFQEAAEKCSVCGHLILEQILQALGNSYHPGCFRCTVCSKALDGVPFTVDYLNNVYCVSDYNRTFAPKCAACLQPILPAEGSEEILRVVSMNKDYHFECY 642          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Zebrafish
Match: zyx (zyxin [Source:ZFIN;Acc:ZDB-GENE-070928-18])

HSP 1 Score: 136.346 bits (342), Expect = 4.527e-36
Identity = 70/159 (44.03%), Postives = 94/159 (59.12%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C +C   +++++ A +AM  LFH++CF C  C R L+G  FY   G   CEE Y+      S   C  CG  IT+++LKA G  +H  CF CT CN  L+GAPF  D D K  C+KDY+   S  C SCN+PIIP+  S  T +VV LEK FH  C++
Sbjct:  416 VCGKCGETLSRSQPAVRAMDKLFHSHCFCCVSCQRPLQGMQFYDRDGTPQCEECYM-----SSLSVCSRCGERITDRVLKAMGQCFHAHCFLCTTCNCSLEGAPFITDDDNKPYCVKDYHRRFSPLCVSCNEPIIPDPGSEETVRVVALEKNFHLKCYR 569          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Zebrafish
Match: zyx (zyxin [Source:ZFIN;Acc:ZDB-GENE-070928-18])

HSP 1 Score: 136.346 bits (342), Expect = 4.527e-36
Identity = 70/159 (44.03%), Postives = 94/159 (59.12%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C +C   +++++ A +AM  LFH++CF C  C R L+G  FY   G   CEE Y+      S   C  CG  IT+++LKA G  +H  CF CT CN  L+GAPF  D D K  C+KDY+   S  C SCN+PIIP+  S  T +VV LEK FH  C++
Sbjct:  416 VCGKCGETLSRSQPAVRAMDKLFHSHCFCCVSCQRPLQGMQFYDRDGTPQCEECYM-----SSLSVCSRCGERITDRVLKAMGQCFHAHCFLCTTCNCSLEGAPFITDDDNKPYCVKDYHRRFSPLCVSCNEPIIPDPGSEETVRVVALEKNFHLKCYR 569          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Zebrafish
Match: lpp (LIM domain containing preferred translocation partner in lipoma [Source:ZFIN;Acc:ZDB-GENE-040426-918])

HSP 1 Score: 117.472 bits (293), Expect = 2.108e-29
Identity = 57/158 (36.08%), Postives = 84/158 (53.16%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            C  C   +      C AM  +FH +CF C  C  +L+GK FY    K +CE  Y+      + + C IC   I  +IL+A G  YH  CF C +C+  LDG PFT+D    I CI+D++   +  C  CN+PI+P      T ++V L+++FH  C++
Sbjct:  360 CSSCGENVVGEGTGCTAMDQVFHVDCFICMTCGSKLRGKPFYAVEKKAYCEPCYI-----NTLETCNICYKPIMERILRATGKAYHPQCFTCVVCHRSLDGIPFTVDASNHIHCIEDFHKKFAPRCSVCNEPIMPAPGQEETVRIVALDRDFHVQCYR 512          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-GENE-484079])

HSP 1 Score: 191.815 bits (486), Expect = 1.059e-55
Identity = 83/158 (52.53%), Postives = 113/158 (71.52%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            +C +C   +  A  ACQAMG L+H NCF+CC C R+L+GK FY  +GK++CEED+LY GFQQ+AD+C +CGH+I   IL+A G  YH  CFRC +CNECLDG PFT+D +  I C+KDY+   +  C SCNQPI+P + S  T +VV ++K++H  C+
Sbjct:  488 ICIKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTADKCFVCGHLIMEMILQALGKSYHPGCFRCVVCNECLDGVPFTVDVENNIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVECY 645          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-GENE-484079])

HSP 1 Score: 191.43 bits (485), Expect = 3.074e-55
Identity = 83/158 (52.53%), Postives = 113/158 (71.52%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            +C +C   +  A  ACQAMG L+H NCF+CC C R+L+GK FY  +GK++CEED+LY GFQQ+AD+C +CGH+I   IL+A G  YH  CFRC +CNECLDG PFT+D +  I C+KDY+   +  C SCNQPI+P + S  T +VV ++K++H  C+
Sbjct:  550 ICIKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTADKCFVCGHLIMEMILQALGKSYHPGCFRCVVCNECLDGVPFTVDVENNIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVECY 707          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Xenopus
Match: gnpda1 (glucosamine-6-phosphate deaminase 1 [Source:Xenbase;Acc:XB-GENE-966376])

HSP 1 Score: 178.333 bits (451), Expect = 2.611e-51
Identity = 80/158 (50.63%), Postives = 111/158 (70.25%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            C +CS  +  A  ACQAMG L+HN CF C  C R+L+GK FY  +GK++CEED+LY GF QSADRC +CGH I + IL+A G  +H  CFRC +CNECLDG PFT+D + KI C+KDY+   +  C +C+ PI+P + +  T +VV ++K++H  C++
Sbjct:  393 CVKCSKGVYGANQACQAMGNLYHNGCFICSACSRKLRGKAFYFVNGKVYCEEDFLYSGFHQSADRCFVCGHWIMDMILQALGKSFHPGCFRCAVCNECLDGVPFTVDMENKIYCVKDYHKILAPKCAACSLPILPSEGTDETIRVVSMDKDYHIDCYR 550          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-GENE-484079])

HSP 1 Score: 156.377 bits (394), Expect = 6.581e-43
Identity = 67/127 (52.76%), Postives = 92/127 (72.44%), Query Frame = 2
Query:  155 YCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            Y  R+L+GK FY  +GK++CEED+LY GFQQ+AD+C +CGH+I   IL+A G  YH  CFRC +CNECLDG PFT+D +  I C+KDY+   +  C SCNQPI+P + S  T +VV ++K++H  C+
Sbjct:  485 YFGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTADKCFVCGHLIMEMILQALGKSYHPGCFRCVVCNECLDGVPFTVDVENNIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVECY 611          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Xenopus
Match: nudt17 (nudix hydrolase 17 [Source:Xenbase;Acc:XB-GENE-979158])

HSP 1 Score: 122.479 bits (306), Expect = 6.825e-32
Identity = 56/158 (35.44%), Postives = 87/158 (55.06%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            C +C   +      C AM  +FH  CF+C  C  +L+G+ FY    K FCE  Y+     ++ ++C +C   I  +IL+A G  YH  CF C +C   LDG PFT+D  G+I CI+D++   +  C  C +PI+P      T ++V L+++FH  C++
Sbjct:  185 CSRCGENVVGEGTGCTAMDQVFHVECFTCMTCNSKLRGQPFYAVEKKAFCEPCYI-----RTLEKCSVCAKPIMERILRATGKAYHPHCFTCVVCFRSLDGIPFTVDASGQIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVQCYR 337          

HSP 2 Score: 50.447 bits (119), Expect = 1.236e-6
Identity = 38/116 (32.76%), Postives = 55/116 (47.41%), Query Frame = 2
Query:   98 EDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKD-HGKLFCEEDYLYCGFQQSADRCKIC--------GHMITNKILKADGNYYHVDCFRCTICNECLDGAP----FTLDKDGKILC 406
            E   +A G  +H +CF+C  C+R L G  F  D  G++ C ED+     ++ A RC +C        G   T +I+  D ++ HV C+RC  C   L        + L  DG ILC
Sbjct:  254 ERILRATGKAYHPHCFTCVVCFRSLDGIPFTVDASGQIHCIEDF----HKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDF-HVQCYRCEDCGSLLSEGENQGCYPL--DGHILC 362          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Mouse
Match: Limd1 (LIM domains containing 1 [Source:MGI Symbol;Acc:MGI:1352502])

HSP 1 Score: 184.111 bits (466), Expect = 4.036e-53
Identity = 82/157 (52.23%), Postives = 112/157 (71.34%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +CS  +  A  ACQAMG L+H+ CF+C  C R+L+GK FY  +GK+FCEED+LY GFQQSADRC +CGH+I + IL+A G  YH  CFRC ICNECLDG PFT+D + KI C++DY+   +  C +C  PI+P + S  T +VV +++++H  C+
Sbjct:  464 CVKCSKGVFGAGQACQAMGDLYHDACFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGHLIMDMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGLPILPPEGSDETIRVVSMDRDYHVECY 620          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Mouse
Match: Wtip (WT1-interacting protein [Source:MGI Symbol;Acc:MGI:2141920])

HSP 1 Score: 175.637 bits (444), Expect = 6.011e-52
Identity = 76/158 (48.10%), Postives = 109/158 (68.99%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            +C +C   I  A  ACQAMG L+H +CF C  C R+L+GK FY    K++C+ED+LY GFQQ+AD+C +CGH+I   IL+A G  YH  CFRC++CNECLDG PFT+D D  I C++DY+   +  C SC +PI+P +   +T +VV +++++H  C+
Sbjct:  192 ICIKCGLGIYGARQACQAMGSLYHTDCFICDSCGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLIMEMILQALGKSYHPGCFRCSVCNECLDGVPFTVDVDNNIYCVRDYHTVFAPKCASCARPILPAQGCETTIRVVSMDRDYHVECY 349          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Mouse
Match: Ajuba (ajuba LIM protein [Source:MGI Symbol;Acc:MGI:1341886])

HSP 1 Score: 161.384 bits (407), Expect = 1.911e-45
Identity = 69/157 (43.95%), Postives = 107/157 (68.15%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +C+  I    +ACQA+  L+H  CF CC C R L+ K FY  +G ++CEEDYL+ GFQ++A++C +CGH+I  KIL+A G  YH  CFRC +CN+CLDG PFT+D   ++ C+ DY+ +++  C +C QPI+P +      +V+ +++++HF C+
Sbjct:  347 CIKCNKGIYGQSNACQALDSLYHTQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGKSYHPGCFRCIVCNKCLDGVPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIVRVISMDRDYHFECY 503          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Mouse
Match: Lpp (LIM domain containing preferred translocation partner in lipoma [Source:MGI Symbol;Acc:MGI:2441849])

HSP 1 Score: 116.316 bits (290), Expect = 3.547e-29
Identity = 55/158 (34.81%), Postives = 87/158 (55.06%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            C +C   +      C AM  +FH +CF+C  C  +L+G+ FY    K +CE  Y+      + ++C +C   I  +IL+A G  YH  CF C +C+  LDG PFT+D  G I CI+D++   +  C  C +PI+P      T ++V L+++FH  C++
Sbjct:  292 CARCGENVVGEGTGCTAMDQVFHVDCFTCIVCDVKLRGQPFYAVEKKAYCEPCYI-----NTLEQCSVCSKPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDACGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVHCYR 444          

HSP 2 Score: 48.521 bits (114), Expect = 5.176e-6
Identity = 38/115 (33.04%), Postives = 53/115 (46.09%), Query Frame = 2
Query:   47 INGSVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDH-GKLFCEEDYLYCGFQQSADRCKIC--------GHMITNKILKADGNYYHVDCFRCTICNECLD 364
            IN    C  CS  I   E   +A G  +H +CF+C  C+R L G  F  D  G + C ED+     ++ A RC +C        G   T +I+  D ++ HV C+RC  C   L 
Sbjct:  346 INTLEQCSVCSKPI--MERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDACGLIHCIEDF----HKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDF-HVHCYRCEDCGGLLS 453          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Mouse
Match: Lpp (LIM domain containing preferred translocation partner in lipoma [Source:MGI Symbol;Acc:MGI:2441849])

HSP 1 Score: 115.161 bits (287), Expect = 1.564e-28
Identity = 55/158 (34.81%), Postives = 87/158 (55.06%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            C +C   +      C AM  +FH +CF+C  C  +L+G+ FY    K +CE  Y+      + ++C +C   I  +IL+A G  YH  CF C +C+  LDG PFT+D  G I CI+D++   +  C  C +PI+P      T ++V L+++FH  C++
Sbjct:  417 CARCGENVVGEGTGCTAMDQVFHVDCFTCIVCDVKLRGQPFYAVEKKAYCEPCYI-----NTLEQCSVCSKPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDACGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVHCYR 569          

HSP 2 Score: 48.521 bits (114), Expect = 5.387e-6
Identity = 38/114 (33.33%), Postives = 53/114 (46.49%), Query Frame = 2
Query:   47 INGSVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDH-GKLFCEEDYLYCGFQQSADRCKIC--------GHMITNKILKADGNYYHVDCFRCTICNECL 361
            IN    C  CS  I   E   +A G  +H +CF+C  C+R L G  F  D  G + C ED+     ++ A RC +C        G   T +I+  D ++ HV C+RC  C   L
Sbjct:  471 INTLEQCSVCSKPI--MERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDACGLIHCIEDF----HKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDF-HVHCYRCEDCGGLL 577          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. UniProt/SwissProt
Match: sp|A9LS46|WTIP_XENLA (Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis OX=8355 GN=wtip PE=1 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 4.690e-55
Identity = 83/158 (52.53%), Postives = 113/158 (71.52%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            +C +C   +  A  ACQAMG L+H NCF+CC C R+L+GK FY  +GK++CEED+LY GFQQ+AD+C +CGH+I   IL+A G  YH  CFRC +CNECLDG PFT+D +  I C+KDY+   +  C SCNQPI+P + S  T +VV ++K++H  C+
Sbjct:  480 ICIKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTADKCFVCGHLIMEMILQALGKSYHPGCFRCVVCNECLDGVPFTVDVENNIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVECY 637          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. UniProt/SwissProt
Match: sp|A8DZE6|WTIP_DANRE (Wilms tumor protein 1-interacting protein homolog OS=Danio rerio OX=7955 GN=wtip PE=3 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 1.186e-52
Identity = 81/158 (51.27%), Postives = 111/158 (70.25%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            +C +C   +  A  ACQAMG L+H NCF+CC C R+L+GK FY  +GK++CEED+LY GFQQ+A++C +CGH+I   IL+A G  YH  CFRC IC E LDG PFT+D +  I C+KDY+   +  C SCNQPI+P + S  T +VV ++K++H  C+
Sbjct:  438 ICVKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTAEKCFVCGHLIMEMILQALGRSYHPGCFRCVICKEGLDGVPFTVDVENNIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVDCY 595          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. UniProt/SwissProt
Match: sp|Q9UGP4|LIMD1_HUMAN (LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.223e-52
Identity = 82/157 (52.23%), Postives = 112/157 (71.34%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +CS  +  A  ACQAMG L+H+ CF+C  C R+L+GK FY  +GK+FCEED+LY GFQQSADRC +CGH+I + IL+A G  YH  CFRC ICNECLDG PFT+D + KI C++DY+   +  C +C  PI+P + S  T +VV +++++H  C+
Sbjct:  472 CVKCSKGVFGAGQACQAMGNLYHDTCFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGHLIMDMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGLPILPPEGSDETIRVVSMDRDYHVECY 628          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. UniProt/SwissProt
Match: sp|G5E5X0|LIMD1_BOVIN (LIM domain-containing protein 1 OS=Bos taurus OX=9913 GN=LIMD1 PE=3 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 1.421e-52
Identity = 82/157 (52.23%), Postives = 112/157 (71.34%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +CS  +  A  ACQAMG L+H+ CF+C  C R+L+GK FY  +GK+FCEED+LY GFQQSADRC +CGH+I + IL+A G  YH  CFRC ICNECLDG PFT+D + KI C++DY+   +  C +C  PI+P + S  T +VV +++++H  C+
Sbjct:  470 CVKCSKGVFGAGQACQAMGNLYHDACFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGHLIMDMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGLPILPPEGSDETIRVVSMDRDYHVECY 626          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. UniProt/SwissProt
Match: sp|B5DEH0|LIMD1_RAT (LIM domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Limd1 PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 2.208e-52
Identity = 82/157 (52.23%), Postives = 112/157 (71.34%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +CS  +  A  ACQAMG L+H+ CF+C  C R+L+GK FY  +GK+FCEED+LY GFQQSADRC +CGH+I + IL+A G  YH  CFRC ICNECLDG PFT+D + KI C++DY+   +  C +C  PI+P + S  T +VV +++++H  C+
Sbjct:  459 CVKCSKGVFGAGQACQAMGDLYHDACFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGHLIMDMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGLPILPPEGSDETIRVVSMDRDYHVECY 615          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. TrEMBL
Match: A0A091QPT6 (Wilms tumor protein 1-interacting protein (Fragment) OS=Mesitornis unicolor OX=54374 GN=N332_11393 PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 5.688e-56
Identity = 83/159 (52.20%), Postives = 113/159 (71.07%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C +C   +  A  ACQAMG L+H NCF+CC C R+L+GK FY  +GK++CEED+LY GFQQ+AD+C +CGH+I   IL+A G  YH  CFRC +CNECLDG PFT+D +  I C+KDY+   +  C SCNQPI+P + S  T +VV ++K++H  C+ 
Sbjct:    2 ICIKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTADKCFVCGHLIMEMILQALGKSYHPGCFRCVVCNECLDGVPFTVDVENNIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVECYH 160          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. TrEMBL
Match: A0A093EQS0 (Wilms tumor protein 1-interacting protein (Fragment) OS=Pterocles gutturalis OX=240206 GN=N339_02970 PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 5.688e-56
Identity = 83/159 (52.20%), Postives = 113/159 (71.07%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C +C   +  A  ACQAMG L+H NCF+CC C R+L+GK FY  +GK++CEED+LY GFQQ+AD+C +CGH+I   IL+A G  YH  CFRC +CNECLDG PFT+D +  I C+KDY+   +  C SCNQPI+P + S  T +VV ++K++H  C+ 
Sbjct:    2 ICIKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTADKCFVCGHLIMEMILQALGKSYHPGCFRCVVCNECLDGVPFTVDVENNIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVECYH 160          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. TrEMBL
Match: A0A091IHI8 (Wilms tumor protein 1-interacting protein (Fragment) OS=Calypte anna OX=9244 GN=N300_03377 PE=4 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 6.537e-56
Identity = 84/159 (52.83%), Postives = 114/159 (71.70%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C +C   +  A  ACQAMG L+H NCF+CC C R+L+GK FY  +GK++CEED+LY GFQQ+AD+C +CGH+I   IL+A G  YH  CFRC +CNECLDG PFT+D + KI C+KDY+   +  C SCNQPI+P + S  T +VV ++K++H  C+ 
Sbjct:    2 ICIKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTADKCFVCGHLIMEMILQALGKSYHPGCFRCVVCNECLDGVPFTVDVENKIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVECYH 160          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. TrEMBL
Match: A0A4E0RNG9 (Wilms tumor protein 1-interacting protein OS=Fasciola hepatica OX=6192 GN=D915_006310 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 9.137e-56
Identity = 85/157 (54.14%), Postives = 112/157 (71.34%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +C   I    DAC A+G L+HN+CF CCYC R L+GKIFYKD  K++CEEDYLYCGFQQ+ ++C +CGH+I+  IL+A GN YH  CFRC +C +CLDG PFT+D +  I C+ DY+L H+  C +C   IIPE+ S    +VV L+KEFH +C+
Sbjct:   94 CAECGLRIINLADACHALGYLYHNSCFVCCYCQRSLRGKIFYKDQDKIYCEEDYLYCGFQQTTEKCSVCGHLISETILQAMGNSYHPGCFRCCVCTKCLDGVPFTVDANKLIYCLPDYHLVHAPRCGACGLVIIPEEGSDEIVRVVALDKEFHLSCY 250          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. TrEMBL
Match: A0A504YTW2 (Wilms tumor protein 1-interacting protein OS=Fasciola gigantica OX=46835 GN=FGIG_11222 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.074e-55
Identity = 85/157 (54.14%), Postives = 112/157 (71.34%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +C   I    DAC A+G L+HN+CF CCYC R L+GKIFYKD  K++CEEDYLYCGFQQ+ ++C +CGH+I+  IL+A GN YH  CFRC +C +CLDG PFT+D +  I C+ DY+L H+  C +C   IIPE+ S    +VV L+KEFH +C+
Sbjct:   94 CAECGLRIINLADACHALGYLYHNSCFVCCYCQRSLRGKIFYKDQDKIYCEEDYLYCGFQQTTEKCSVCGHLISETILQAMGNSYHPGCFRCCVCTKCLDGVPFTVDANKLIYCLPDYHLVHAPRCGACGLVIIPEEGSDEIVRVVALDKEFHLSCY 250          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Cavefish
Match: LIMD1 (LIM domains containing 1 [Source:NCBI gene;Acc:103029777])

HSP 1 Score: 191.045 bits (484), Expect = 5.057e-56
Identity = 85/157 (54.14%), Postives = 113/157 (71.97%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +CS  +  A  ACQAMG L+H+NCF+C  C R+L+GK FY   GK+FCEED+LY GFQQSAD+C +CGH+I + IL+A G  YH  CFRC ICNE LDG PFT+D + KI C+KDY+   +  C +CNQPI+P + S  T +VV ++K++H  C+
Sbjct:  442 CVKCSKPVYGASQACQAMGSLYHDNCFTCSACSRKLRGKAFYYVCGKVFCEEDFLYSGFQQSADKCNVCGHLIMDMILQALGKSYHPGCFRCVICNESLDGVPFTVDTENKIYCVKDYHRVLAPKCAACNQPILPSEGSDETIRVVSMDKDYHVECY 598          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Cavefish
Match: wtip (WT1 interacting protein [Source:NCBI gene;Acc:566046])

HSP 1 Score: 164.081 bits (414), Expect = 4.097e-46
Identity = 75/159 (47.17%), Postives = 103/159 (64.78%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C +C   +  A  ACQAMG L+H NCF+CC C R+L+GK FY  +GK        Y GFQQ+A++C +CGH+I   IL+A G  YH  CFRC +C E LDG PFT+D +  I C+KDY+   +  C SCNQPI+P + S  T +VV ++K++H  C+ 
Sbjct:  430 ICVKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGK--------YSGFQQTAEKCFVCGHLIMEMILQALGKSYHPSCFRCVVCKEGLDGVPFTVDMENNIYCVKDYHTVFAPKCASCNQPILPAEGSEETIRVVSMDKDYHVECYH 580          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Cavefish
Match: ajuba (ajuba LIM protein [Source:NCBI gene;Acc:103024444])

HSP 1 Score: 160.614 bits (405), Expect = 1.267e-44
Identity = 68/157 (43.31%), Postives = 104/157 (66.24%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +C   +  A++ACQA+  L+H  CF+C  C R L+ K FY   G ++C+EDY++ GFQ +A++C +CGH+I  +IL+A GN YH  CFRCT+C++ LDG PFT+D    + C+ DY  + +  C +C QPI+P + S    +VV + K++HF C+
Sbjct:  489 CVKCGKGVYGADNACQALDSLYHTRCFTCVSCGRTLRNKDFYNVSGSVYCKEDYMFSGFQAAAEKCSVCGHLILEQILQALGNSYHPGCFRCTVCSKTLDGVPFTVDYLNNVYCVSDYNRTFAPKCAACLQPILPTEGSEEILRVVSMNKDYHFECY 645          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Cavefish
Match: LIMD1 (LIM domains containing 1 [Source:NCBI gene;Acc:103029777])

HSP 1 Score: 154.836 bits (390), Expect = 8.319e-43
Identity = 68/124 (54.84%), Postives = 91/124 (73.39%), Query Frame = 2
Query:  164 RQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            R+L+GK FY   GK+FCEED+LY GFQQSAD+C +CGH+I + IL+A G  YH  CFRC ICNE LDG PFT+D + KI C+KDY+   +  C +CNQPI+P + S  T +VV ++K++H  C+
Sbjct:  441 RKLRGKAFYYVCGKVFCEEDFLYSGFQQSADKCNVCGHLIMDMILQALGKSYHPGCFRCVICNESLDGVPFTVDTENKIYCVKDYHRVLAPKCAACNQPILPSEGSDETIRVVSMDKDYHVECY 564          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Cavefish
Match: zyx (zyxin [Source:NCBI gene;Acc:103029170])

HSP 1 Score: 132.88 bits (333), Expect = 6.980e-35
Identity = 67/159 (42.14%), Postives = 93/159 (58.49%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C +C   +++++ A +AM  LFH++CF C  C R L+G  FY   G   CEE Y++     S   C  CG  IT+++LKA G  +H  CFRCT C   L+GAPF  D D    C+ DY+   S  C SCN+PI+P+  S  T +VV LEK FH  C++
Sbjct:  397 VCGKCKEGLSRSQPAVRAMDKLFHSHCFCCVTCQRPLQGMQFYDRDGTPECEECYVH-----SLAICSRCGERITDRVLKAVGQCFHAHCFRCTACKCTLEGAPFITDDDNNPFCVPDYHRRFSPLCVSCNEPIVPDPGSEETVRVVALEKNFHLKCYR 550          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010404.1 (pep scaffold:Pmarinus_7.0:GL477924:140:5584:1 gene:ENSPMAG00000009420.1 transcript:ENSPMAT00000010404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 1.829e-27
Identity = 42/84 (50.00%), Postives = 60/84 (71.43%), Query Frame = 2
Query:  230 YCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNS 481
            Y GFQQ+AD+C  CGH+I   IL+A G  YH  CFRC +CNECLDG PFT+D+D ++ C++DY+ + +  C +C  PI+P ++ 
Sbjct:    1 YSGFQQNADKCFECGHLIMETILQAVGKSYHPTCFRCVVCNECLDGVPFTVDRDHRVYCVQDYHRTFAPKCAACGLPILPNQSG 84          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010401.1 (pep scaffold:Pmarinus_7.0:GL477924:137:5584:1 gene:ENSPMAG00000009420.1 transcript:ENSPMAT00000010401.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 8.009e-27
Identity = 46/103 (44.66%), Postives = 64/103 (62.14%), Query Frame = 2
Query:  230 YCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYY-LSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            Y GFQQ+AD+C  CGH+I   IL+A G  YH  CFRC +CNECLDG PFT+D+D ++ C++DY+  + +  C +C  PI+P +      KV V  +     C 
Sbjct:    2 YSGFQQNADKCFECGHLIMETILQAVGKSYHPTCFRCVVCNECLDGVPFTVDRDHRVYCVQDYHRRTFAPKCAACGLPILPNQGKYIRVKVRVFVEIIDIDCM 104          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Sea Lamprey
Match: lims2 (LIM and senescent cell antigen-like domains 2 [Source:ZFIN;Acc:ZDB-GENE-050522-56])

HSP 1 Score: 60.8474 bits (146), Expect = 4.433e-11
Identity = 41/136 (30.15%), Postives = 60/136 (44.12%), Query Frame = 2
Query:   11 KSICSLFMSFNSI----NGSVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILC 406
            K  C  +   N      N +   C+     +  E    + G LFH NCF C  C++Q      Y+  G+ +CE D+        A  C   G  I  +++KA  N +H +CFRC IC+E L    F +   G+ LC
Sbjct:   57 KEFCDFYAKLNMASALANAACERCKAGFPPSATERIVNSNGELFHENCFVCAQCFQQF----LYEFEGRKYCEHDFQML----FAPCCGQSGEFIVGRVIKAMNNSWHPECFRCNICSEMLADVGF-VKNAGRHLC 183          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Sea Lamprey
Match: PXN (paxillin [Source:HGNC Symbol;Acc:HGNC:9718])

HSP 1 Score: 58.151 bits (139), Expect = 1.776e-10
Identity = 40/143 (27.97%), Postives = 66/143 (46.15%), Query Frame = 2
Query:  113 AMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITN--KILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            AMG  +H   F C +C  ++  + F++  G+ +CEEDY        + RC  C   + +  +++ A    +H + F C  C        F  ++DGK  C +DYY   +  C  C++ I+  +N LS    V     +H  CF
Sbjct:    5 AMGRTWHPEHFVCVHCQVEIGSRNFFEKDGQPYCEEDY----HSLFSPRCAYCNEAVMDNQRVVTALDRTWHPEHFFCAQCGRPFGEEGFH-ERDGKPYCRQDYYGMFAPKCNGCSRAIM--QNYLSALNTV-----WHPECF 135          

HSP 2 Score: 55.4546 bits (132), Expect = 1.472e-9
Identity = 41/160 (25.62%), Postives = 65/160 (40.62%), Query Frame = 2
Query:   56 SVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFT----LDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFH 523
            S  C  C+  +   +    A+   +H   F C  C R    + F++  GK +C +DY    +   A +C  C   I    L A    +H +CF   IC EC    PF      + +G+  C   Y+    S C  C +PI       + + +  + K+FH
Sbjct:   47 SPRCAYCNEAVMDNQRVVTALDRTWHPEHFFCAQCGRPFGEEGFHERDGKPYCRQDY----YGMFAPKCNGCSRAIMQNYLSALNTVWHPECF---ICRECF--TPFINGSFFEHEGQPYCEVHYHERRGSLCSGCQKPI-------TGRCISAMAKKFH 190          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Sea Lamprey
Match: PXN (paxillin [Source:HGNC Symbol;Acc:HGNC:9718])

HSP 1 Score: 59.3066 bits (142), Expect = 2.774e-10
Identity = 41/147 (27.89%), Postives = 66/147 (44.90%), Query Frame = 2
Query:   95 AEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            A     AMG  +H   F C  C  ++  + F++  G  +CE+DY +      + RC  C   I +K++ A    +H + F C  C        F  +KDGK  C +DY+   +  C  C++ I+  +N +S      L   +H  CF
Sbjct:  330 AGQVVTAMGRTWHPEHFVCTECQEEIGARNFFERDGLPYCEKDYHFL----FSPRCAYCSGPILDKVVTALDKTWHPEHFFCVQCGHFFGDEGFH-EKDGKPYCRQDYFEMFAPKCGGCSRAIV--ENYIS-----ALSALWHPECF 464          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Yeast
Match: RGA2 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; regulated by Pho85p and Cdc28p; RGA2 has a paralog, RGA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002787])

HSP 1 Score: 46.2098 bits (108), Expect = 3.346e-6
Identity = 38/133 (28.57%), Postives = 57/133 (42.86%), Query Frame = 2
Query:   32 MSFNSING-SVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGK--IFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMI--TNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKD 415
            MS + IN  S LC +C+  I  ++   +     +H+ CF+C  C ++L         D G L C +          +D+C  CG  I  T  IL +    Y  +CFRC  C+  +    +   K G  LC  D
Sbjct:    1 MSADPINDQSSLCVRCNKSIASSQ-VYELESKKWHDQCFTCYKCDKKLNADSDFLVLDIGTLICYD---------CSDKCTNCGDKIDDTAIILPSSNEAYCSNCFRCCRCSNRIKNLKYAKTKRG--LCCMD 121          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Yeast
Match: RGA1 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; RGA1 has a paralog, RGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000005653])

HSP 1 Score: 45.8246 bits (107), Expect = 4.697e-6
Identity = 46/175 (26.29%), Postives = 63/175 (36.00%), Query Frame = 2
Query:   65 CCQCSGLINKA---EDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQ-----QSADRCKICGHMITNK--ILKADGNYYHVDCFRCTICNECLDGAPFTLDKDG--------KILCIKDYYLSH----SSNCESCNQPIIPEKNSLSTKKVVVL-EKEF 520
            C +C   I      E  C      +H +CF+C  C + L             CE D+L  G         +D CK CG  I +   IL +    Y  DCF+C  C E +    +   K G        K+L  + YY         N  S   P+I   ++       VL EK F
Sbjct:   13 CVRCKEFITTGHAYELGCDR----WHTHCFACYKCEKPLS------------CESDFLVLGTGALICFDCSDSCKNCGKKIDDLAIILSSSNEAYCSDCFKCCKCGENIADLRYAKTKRGLFCLSCHEKLLAKRKYYEEKKRRLKKNLPSLPTPVIDNGHTDEVSASAVLPEKTF 171          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Nematostella
Match: EDO39581 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J0])

HSP 1 Score: 124.02 bits (310), Expect = 2.058e-34
Identity = 65/159 (40.88%), Postives = 90/159 (56.60%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C +C   ++     C AM  LFH  CF C  C  QL GK+FYK     +CE DYL      S + C  C   IT++IL+A G  +H  CF C  C++ LDG PFTLD   K+ C++DYY  +S  C SC+Q I+PE     T ++V + K+FH  C++
Sbjct:   35 MCSKCGQKVSGEGTGCTAMDKLFHIKCFICVKCGCQLTGKVFYKVDNDAYCEADYL-----DSLETCWYCHQHITDRILRATGKCFHPHCFNCEECHKNLDGVPFTLDNFNKVHCLEDYYRKYSPRCASCHQLILPEDGQDETVRIVSMNKDFHVRCYK 188          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Nematostella
Match: EDO32541 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS6])

HSP 1 Score: 120.939 bits (302), Expect = 3.503e-34
Identity = 57/141 (40.43%), Postives = 84/141 (59.57%), Query Frame = 2
Query:  116 MGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            MG L+H  CF C  C ++L+G+ FY+   +++C++DY      Q   RC  C  +I  +IL+  G  YH  CFRC +C   L+G PFT+D+   I CI DY+  +S  C +C +PI P++ S  T +VV L K+FH  CF+
Sbjct:    1 MGNLYHAQCFLCHTCGKELRGQEFYRLENRVYCKQDYKSLERHQRPKRCHSCKEVIGQRILQTLGRDYHPVCFRCCVCEVELEGTPFTVDRQNAIYCIPDYHRKYSPRCHACREPIAPDEKSDETIRVVCLGKQFHDRCFK 141          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Nematostella
Match: EDO41181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S548])

HSP 1 Score: 69.3218 bits (168), Expect = 6.471e-14
Identity = 46/157 (29.30%), Postives = 70/157 (44.59%), Query Frame = 2
Query:   56 SVLCCQCSGLINKAEDAC-QAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFH 523
            +  C  C+G I    D+C  A+   +H   F C  C        F++  GK FC EDY    +   A RC  CG  I +  + A   ++H +CF CT C +   G  F  D DG+  C   Y+    + C SC +PI       + + +  + ++FH
Sbjct:   82 APRCAYCNGPI---LDSCVTALDQTWHPEHFVCAECGNPFGDTGFHERDGKPFCREDY----YAMFAPRCGGCGQPIMDNYISALSAHWHAECFICTECRQPFPGGSF-FDHDGRPYCEMHYHAKRGTLCYSCQKPI-------TGRCITAMHRKFH 223          

HSP 2 Score: 65.855 bits (159), Expect = 1.077e-12
Identity = 46/164 (28.05%), Postives = 66/164 (40.24%), Query Frame = 2
Query:   44 SINGSVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            S     +C  C+  I      C A+G  +H   F+C  C   L  + F++  GK +CE DY        A RC  C   I +  + A    +H + F C  C        F  ++DGK  C +DYY   +  C  C QPI+          +  L   +H  CF
Sbjct:   19 STTKKGMCAACNKPI--IGQVCTALGKTWHPEHFACVACEAPLGTQNFFERDGKPYCERDY----HDTFAPRCAYCNGPILDSCVTALDQTWHPEHFVCAECGNPFGDTGFH-ERDGKPFCREDYYAMFAPRCGGCGQPIM-------DNYISALSAHWHAECF 168          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Nematostella
Match: EDO47660 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT9])

HSP 1 Score: 69.3218 bits (168), Expect = 1.232e-13
Identity = 39/119 (32.77%), Postives = 57/119 (47.90%), Query Frame = 2
Query:   56 SVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIK 412
            + +C  C       E    + G + H  CF C  C++     +FY+  G+ FCE D+        A  CK CG  +  +++KA    +H DCFRC ICN+CL    F +   G+ LC K
Sbjct:   18 TAICAVCHEGFGVDERMVNSNGQILHERCFVCVQCFQAFPDGLFYEYDGRRFCEHDFQ----TLFAPCCKQCGKFVIGRVIKAMQANWHPDCFRCEICNDCLADTGF-VKNAGRALCKK 131          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Nematostella
Match: LIMPET (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFX6])

HSP 1 Score: 65.4698 bits (158), Expect = 3.479e-12
Identity = 48/165 (29.09%), Postives = 73/165 (44.24%), Query Frame = 2
Query:   41 NSINGSVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
              IN S +C  C+G     E         FH+ CF C  C + +  K F +   +  C      C   + A  C  C  +I    ++  G+ YH +CF C  C++ L G+PFT  ++G+ +C   Y   ++  C +C+  I       +TK V   EK FH  CF
Sbjct:  371 RGINPSKVCAACNGDFAPGEKKVGYQSKTFHDKCFICDECKQPIGSKQFIRRDERRLCNN----CFDSKFAKVCVKCNQVIKTSSVQHAGSTYHSECFTCHHCDKPLAGSPFT-KQEGRNVCQNCYRERYAKRCGACHNLI-----EGNTKFVAYDEKYFHRECF 525          

HSP 2 Score: 61.2326 bits (147), Expect = 1.059e-10
Identity = 37/118 (31.36%), Postives = 63/118 (53.39%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMI--TNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCI 409
            +C +C+ +I  +  + Q  G  +H+ CF+C +C + L G  F K  G+  C+     C  ++ A RC  C ++I    K +  D  Y+H +CF C  CN+ L G  F + +DG+ +C+
Sbjct:  439 VCVKCNQVIKTS--SVQHAGSTYHSECFTCHHCDKPLAGSPFTKQEGRNVCQN----CYRERYAKRCGACHNLIEGNTKFVAYDEKYFHRECFTCCKCNKPLAGEKFRI-RDGEKICL 549          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Medaka
Match: LIMD1 (LIM domains containing 1 [Source:NCBI gene;Acc:101175430])

HSP 1 Score: 190.274 bits (482), Expect = 2.007e-56
Identity = 83/158 (52.53%), Postives = 113/158 (71.52%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            +C +C+  +  A  ACQAMG L+H++CF+C  C R+L+GK FY   GK+FCEED+LY GFQQSAD+C  CGH+I + IL+A G  YH  CFRC ICNE LDG PFT+D + KI C++DY+   +  C +CNQPI+P + S  T +VV +EK++H  C+
Sbjct:  337 VCVRCNTAVYGASQACQAMGSLYHDSCFTCTACSRRLRGKAFYYVGGKVFCEEDFLYSGFQQSADKCNACGHLIMDMILQALGKSYHPGCFRCVICNESLDGVPFTVDTENKIYCVRDYHRVLAPKCAACNQPILPSEGSDETIRVVSMEKDYHVECY 494          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Medaka
Match: wtip (WT1 interacting protein [Source:NCBI gene;Acc:101158185])

HSP 1 Score: 187.578 bits (475), Expect = 1.412e-54
Identity = 81/159 (50.94%), Postives = 112/159 (70.44%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C +C   +  A  ACQAMG L+H NCF+CC C R+L+GK FY  +GK++CEED+LY GFQQ+A++C +CGH+I   IL+A G  YH  CFRC +C E LDG PFT+D +  I C+KDY+   +  C SCNQPI+P + S  T +VV ++K++H  C+Q
Sbjct:  489 ICIKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTAEKCFVCGHLIMEMILQALGKSYHPGCFRCVVCKEGLDGVPFTVDVENNIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVECYQ 647          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Medaka
Match: wtip (WT1 interacting protein [Source:NCBI gene;Acc:101158185])

HSP 1 Score: 187.193 bits (474), Expect = 3.328e-54
Identity = 81/159 (50.94%), Postives = 112/159 (70.44%), Query Frame = 2
Query:   62 LCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            +C +C   +  A  ACQAMG L+H NCF+CC C R+L+GK FY  +GK++CEED+LY GFQQ+A++C +CGH+I   IL+A G  YH  CFRC +C E LDG PFT+D +  I C+KDY+   +  C SCNQPI+P + S  T +VV ++K++H  C+Q
Sbjct:  489 ICIKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRRLRGKAFYNVNGKVYCEEDFLYSGFQQTAEKCFVCGHLIMEMILQALGKSYHPGCFRCVVCKEGLDGVPFTVDVENNIYCVKDYHTVFAPKCASCNQPILPAQGSEETIRVVSMDKDYHVECYQ 647          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Medaka
Match: ajuba (ajuba LIM protein [Source:NCBI gene;Acc:100529186])

HSP 1 Score: 159.844 bits (403), Expect = 2.441e-44
Identity = 68/157 (43.31%), Postives = 104/157 (66.24%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +C   +  A++ACQA   L+H  CF+C  C R L+ K FY  +G ++C+EDY++ GFQ +A++C +CGH+I  +IL+A GN YH  CFRC +C++ LDG PFT+D+   I C+ DY  + +  C +C QPI+P + S    +VV + K++HF C+
Sbjct:  492 CVKCGKGVYGADNACQAQENLYHTRCFTCVSCGRTLRNKDFYNVNGSVYCKEDYMFSGFQAAAEKCTVCGHLILEQILQALGNSYHPGCFRCVVCSKALDGVPFTVDQHSNIYCVADYNKTFAPKCAACLQPILPTEGSEEILRVVSMNKDYHFECY 648          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Medaka
Match: ajuba (ajuba LIM protein [Source:NCBI gene;Acc:100529186])

HSP 1 Score: 159.844 bits (403), Expect = 2.441e-44
Identity = 68/157 (43.31%), Postives = 104/157 (66.24%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACF 535
            C +C   +  A++ACQA   L+H  CF+C  C R L+ K FY  +G ++C+EDY++ GFQ +A++C +CGH+I  +IL+A GN YH  CFRC +C++ LDG PFT+D+   I C+ DY  + +  C +C QPI+P + S    +VV + K++HF C+
Sbjct:  492 CVKCGKGVYGADNACQAQENLYHTRCFTCVSCGRTLRNKDFYNVNGSVYCKEDYMFSGFQAAAEKCTVCGHLILEQILQALGNSYHPGCFRCVVCSKALDGVPFTVDQHSNIYCVADYNKTFAPKCAACLQPILPTEGSEEILRVVSMNKDYHFECY 648          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Planmine SMEST
Match: SMESG000031934.1 (SMESG000031934.1)

HSP 1 Score: 348.977 bits (894), Expect = 3.459e-131
Identity = 169/169 (100.00%), Postives = 169/169 (100.00%), Query Frame = 2
Query:   32 MSFNSINGSVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            MSFNSINGSVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ
Sbjct:    1 MSFNSINGSVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 169          

HSP 2 Score: 83.5741 bits (205), Expect = 3.459e-131
Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 3
Query:  540 ECQMNLTIESDSSCYPKYDSVGNLHLYCRRCFVKSPHI 653
            ECQMNLTIESDSSCYPKYDSVGNLHLYCRRCFVKSPHI
Sbjct:  172 ECQMNLTIESDSSCYPKYDSVGNLHLYCRRCFVKSPHI 209          

HSP 3 Score: 77.411 bits (189), Expect = 3.459e-131
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 1
Query:  676 PPLRLSHQQILRNFKVLQKSLRHSDKETINLIYATQ 783
            PPLRLSHQQILRNFKVLQKSLRHSDKETINLIYATQ
Sbjct:  217 PPLRLSHQQILRNFKVLQKSLRHSDKETINLIYATQ 252          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Planmine SMEST
Match: SMESG000038145.1 (SMESG000038145.1)

HSP 1 Score: 168.703 bits (426), Expect = 1.651e-49
Identity = 75/158 (47.47%), Postives = 110/158 (69.62%), Query Frame = 2
Query:   65 CCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFACFQ 538
            C +C  LI  +E AC A+G L+H+NCF+CCYC R L+G++FYKD  K++CE DY+  GF +S   C  CGH++T  IL+A G  +H  CF+C+IC++CLDG PFT+D++  I CI DY+ + +  C  C QPIIP K+S    ++VV +++FH  C++
Sbjct:  204 CNKCQCLITDSEGACIALGNLYHSNCFTCCYCNRSLRGRVFYKDQEKIYCENDYMVFGFHKSVKVCFACGHIVTETILEALGKDFHPRCFKCSICHKCLDGIPFTVDRNNNIYCIIDYHNTFAPRCAICLQPIIPRKDSDEVVRIVVNDRDFHVECYR 361          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Planmine SMEST
Match: SMESG000031084.1 (SMESG000031084.1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.701e-22
Identity = 50/165 (30.30%), Postives = 84/165 (50.91%), Query Frame = 2
Query:   38 FNSINGSVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTKKVVVLEKEFHFAC 532
            F   NG     Q +G +N           +FH  CF+C  C   L    F+    +L C      C   +S ++C +C  +I ++I++  G+ YH  CF CT+CN CLDG  FT+D   ++ C++D++  ++  C++C +PI P+      K+++  +K FH  C
Sbjct:  205 FELANGKSSVGQINGPLN----------TVFHQTCFNCYRCEANLNVDSFFYAQKRLLCSR----C-VHESLEKCTVCNFIINDRIIRVLGHPYHPKCFTCTVCNCCLDGKAFTVDVHERMFCLEDFHKRYAPRCDACGEPIRPQNGGQENKRIISGDKTFHLEC 354          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Planmine SMEST
Match: SMESG000011768.1 (SMESG000011768.1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.732e-12
Identity = 39/122 (31.97%), Postives = 57/122 (46.72%), Query Frame = 2
Query:   41 NSINGSVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILC 406
            N I+    C  C G     E   Q     +H +CF C  C++     IFY+   K +CE D+        A  C  CG  I  +++KA G+ +H DCFRC +C+  L  + F  +  G+ LC
Sbjct:   39 NKISDGSFCYHCDGPFELNEKVVQVGDYQWHTSCFVCAQCFQTFPNGIFYEFGDKKYCEHDFHVL----FAPCCGSCGEFIIGRVIKAMGSNWHADCFRCQLCSVVLSDSGFVKNL-GRALC 155          
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Planmine SMEST
Match: SMESG000077137.1 (SMESG000077137.1)

HSP 1 Score: 57.7658 bits (138), Expect = 6.021e-10
Identity = 41/148 (27.70%), Postives = 65/148 (43.92%), Query Frame = 2
Query:   56 SVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGKIFYKDHGKLFCEE--DYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDCFRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNSLSTK 493
            +  C +C+  I   + A  AM  +FH  CF C  C +++ G +F    GK  C++  +      Q++A  C  C   I  + L A    +H++CF CT C   +    F + K+G   CI  Y    +  C  C   I P +  L  +
Sbjct:    2 TTTCSKCNKEILPGQTALSAMEKVFHKECFVCSGCKKEMGGTMFKVVEGKNICDDCFNKKKAEQQKAAGVCGKCNLDIKGQFLGALDKKFHLECFICTKCGTNISRTSFQV-KEGSAYCIDCYTELFAPKCFVCETMIKPTEPYLEVE 148          
The following BLAST results are available for this feature:
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WTIP2.897e-5447.80WT1 interacting protein [Source:HGNC Symbol;Acc:HG... [more]
LIMD12.547e-5352.23LIM domains containing 1 [Source:HGNC Symbol;Acc:H... [more]
WTIP1.522e-5248.10WT1 interacting protein [Source:HGNC Symbol;Acc:HG... [more]
LIMD13.042e-4855.47LIM domains containing 1 [Source:HGNC Symbol;Acc:H... [more]
AJUBA4.793e-4543.95ajuba LIM protein [Source:HGNC Symbol;Acc:HGNC:202... [more]
back to top
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zyx-14.777e-3136.48Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4][more]
zyx-11.374e-3036.48Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4][more]
zyx-11.520e-2936.48Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4][more]
zyx-19.719e-2836.25Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4][more]
zyx-19.719e-2836.25Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4][more]
back to top
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jub3.583e-5251.27gene:FBgn0030530 transcript:FBtr0340292[more]
jub3.583e-5251.27gene:FBgn0030530 transcript:FBtr0303418[more]
jub4.062e-5251.27gene:FBgn0030530 transcript:FBtr0073834[more]
jub7.203e-5049.69gene:FBgn0030530 transcript:FBtr0303419[more]
Zyx1.688e-2936.71gene:FBgn0011642 transcript:FBtr0309882[more]
back to top
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wtip1.571e-5351.27WT1 interacting protein [Source:NCBI gene;Acc:5660... [more]
ajuba4.904e-4543.31ajuba LIM protein [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
zyx4.527e-3644.03zyxin [Source:ZFIN;Acc:ZDB-GENE-070928-18][more]
zyx4.527e-3644.03zyxin [Source:ZFIN;Acc:ZDB-GENE-070928-18][more]
lpp2.108e-2936.08LIM domain containing preferred translocation part... [more]
back to top
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf41.059e-5552.53ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-G... [more]
arf43.074e-5552.53ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-G... [more]
gnpda12.611e-5150.63glucosamine-6-phosphate deaminase 1 [Source:Xenbas... [more]
arf46.581e-4352.76ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-G... [more]
nudt176.825e-3235.44nudix hydrolase 17 [Source:Xenbase;Acc:XB-GENE-979... [more]
back to top
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Limd14.036e-5352.23LIM domains containing 1 [Source:MGI Symbol;Acc:MG... [more]
Wtip6.011e-5248.10WT1-interacting protein [Source:MGI Symbol;Acc:MGI... [more]
Ajuba1.911e-4543.95ajuba LIM protein [Source:MGI Symbol;Acc:MGI:13418... [more]
Lpp3.547e-2934.81LIM domain containing preferred translocation part... [more]
Lpp1.564e-2834.81LIM domain containing preferred translocation part... [more]
back to top
BLAST of Wilms tumor protein 1-interacting protein homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A9LS46|WTIP_XENLA4.690e-5552.53Wilms tumor protein 1-interacting protein homolog ... [more]
sp|A8DZE6|WTIP_DANRE1.186e-5251.27Wilms tumor protein 1-interacting protein homolog ... [more]
sp|Q9UGP4|LIMD1_HUMAN1.223e-5252.23LIM domain-containing protein 1 OS=Homo sapiens OX... [more]
sp|G5E5X0|LIMD1_BOVIN1.421e-5252.23LIM domain-containing protein 1 OS=Bos taurus OX=9... [more]
sp|B5DEH0|LIMD1_RAT2.208e-5252.23LIM domain-containing protein 1 OS=Rattus norvegic... [more]
back to top
BLAST of Wilms tumor protein 1-interacting protein homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A091QPT65.688e-5652.20Wilms tumor protein 1-interacting protein (Fragmen... [more]
A0A093EQS05.688e-5652.20Wilms tumor protein 1-interacting protein (Fragmen... [more]
A0A091IHI86.537e-5652.83Wilms tumor protein 1-interacting protein (Fragmen... [more]
A0A4E0RNG99.137e-5654.14Wilms tumor protein 1-interacting protein OS=Fasci... [more]
A0A504YTW21.074e-5554.14Wilms tumor protein 1-interacting protein OS=Fasci... [more]
back to top
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LIMD15.057e-5654.14LIM domains containing 1 [Source:NCBI gene;Acc:103... [more]
wtip4.097e-4647.17WT1 interacting protein [Source:NCBI gene;Acc:5660... [more]
ajuba1.267e-4443.31ajuba LIM protein [Source:NCBI gene;Acc:103024444][more]
LIMD18.319e-4354.84LIM domains containing 1 [Source:NCBI gene;Acc:103... [more]
zyx6.980e-3542.14zyxin [Source:NCBI gene;Acc:103029170][more]
back to top
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010404.11.829e-2750.00pep scaffold:Pmarinus_7.0:GL477924:140:5584:1 gene... [more]
ENSPMAT00000010401.18.009e-2744.66pep scaffold:Pmarinus_7.0:GL477924:137:5584:1 gene... [more]
lims24.433e-1130.15LIM and senescent cell antigen-like domains 2 [Sou... [more]
PXN1.776e-1027.97paxillin [Source:HGNC Symbol;Acc:HGNC:9718][more]
PXN2.774e-1027.89paxillin [Source:HGNC Symbol;Acc:HGNC:9718][more]
back to top
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RGA23.346e-628.57GTPase-activating protein for polarity-establishme... [more]
RGA14.697e-626.29GTPase-activating protein for polarity-establishme... [more]
back to top
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO395812.058e-3440.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325413.503e-3440.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411816.471e-1429.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476601.232e-1332.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LIMPET3.479e-1229.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LIMD12.007e-5652.53LIM domains containing 1 [Source:NCBI gene;Acc:101... [more]
wtip1.412e-5450.94WT1 interacting protein [Source:NCBI gene;Acc:1011... [more]
wtip3.328e-5450.94WT1 interacting protein [Source:NCBI gene;Acc:1011... [more]
ajuba2.441e-4443.31ajuba LIM protein [Source:NCBI gene;Acc:100529186][more]
ajuba2.441e-4443.31ajuba LIM protein [Source:NCBI gene;Acc:100529186][more]
back to top
BLAST of Wilms tumor protein 1-interacting protein homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031934.13.459e-131100.00SMESG000031934.1[more]
SMESG000038145.11.651e-4947.47SMESG000038145.1[more]
SMESG000031084.11.701e-2230.30SMESG000031084.1[more]
SMESG000011768.12.732e-1231.97SMESG000011768.1[more]
SMESG000077137.16.021e-1027.70SMESG000077137.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035262 ID=SMED30035262|Name=Wilms tumor protein 1-interacting protein homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=830bp
TTAAAATGGGAAATCGATTTGTTCATTATTCATGTCTTTCAATTCGATAA
ACGGTTCGGTTCTCTGTTGTCAATGTTCCGGATTAATTAACAAAGCCGAA
GATGCCTGTCAAGCAATGGGAATGTTATTCCATAATAATTGTTTCTCTTG
CTGTTATTGTTATAGACAGCTGAAAGGGAAAATCTTCTATAAGGATCATG
GAAAGCTTTTCTGTGAAGAAGATTATTTGTATTGCGGTTTTCAACAAAGC
GCAGATCGTTGCAAAATCTGTGGACATATGATAACCAACAAGATTCTTAA
GGCTGATGGAAATTATTACCATGTTGATTGCTTTCGTTGCACAATATGTA
ATGAGTGCCTTGACGGAGCACCATTCACGTTGGATAAAGATGGAAAAATT
CTTTGCATAAAAGACTATTATTTATCGCATTCATCAAATTGTGAGTCTTG
CAATCAACCTATCATTCCTGAAAAGAATTCACTATCTACTAAAAAGGTTG
TTGTACTTGAAAAAGAGTTTCATTTTGCCTGCTTTCAATGAATGTCAAAT
GAATTTAACTATAGAGTCCGATTCATCATGTTATCCCAAATATGACAGCG
TTGGAAACCTTCATCTTTACTGTAGGAGATGTTTTGTCAAATCACCTCAC
ATTTCAAGAAGCTTGACATCTTCTTCCTCCTCTTCGTCTCTCGCATCAAC
AAATCCTAAGAAATTTCAAAGTTCTACAAAAGTCACTTCGACATTCAGAT
AAAGAGACGATAAATTTAATTTATGCAACTCAAAAAACTTTATCTTATTC
TTATTGAAATCTGCCAACTAAATACTGGAG
back to top

protein sequence of SMED30035262-orf-1

>SMED30035262-orf-1 ID=SMED30035262-orf-1|Name=SMED30035262-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=170bp
MSFNSINGSVLCCQCSGLINKAEDACQAMGMLFHNNCFSCCYCYRQLKGK
IFYKDHGKLFCEEDYLYCGFQQSADRCKICGHMITNKILKADGNYYHVDC
FRCTICNECLDGAPFTLDKDGKILCIKDYYLSHSSNCESCNQPIIPEKNS
LSTKKVVVLEKEFHFACFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0030030cell projection organization
GO:0045892negative regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0007010cytoskeleton organization
GO:0014032neural crest cell development
GO:0022604regulation of cell morphogenesis
GO:1903507negative regulation of nucleic acid-templated transcription
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR028734LIMD1
IPR001781Znf_LIM
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003714transcription corepressor activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005912adherens junction
GO:0030054cell junction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 11..64
e-value: 1.1E-8
score: 44.9
coord: 76..128
e-value: 5.2E-14
score: 62.5
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 77..130
e-value: 7.0E-11
score: 42.2
coord: 12..66
e-value: 2.4E-8
score: 34.1
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 12..47
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 77..110
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 10..71
score: 11.801
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 75..135
score: 12.939
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 3..68
e-value: 2.1E-12
score: 48.6
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 69..169
e-value: 7.3E-21
score: 76.5
NoneNo IPR availablePANTHERPTHR24219FAMILY NOT NAMEDcoord: 11..169
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 102..168
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 40..106
IPR028734LIM domain-containing protein 1PANTHERPTHR24219:SF3LIM DOMAIN-CONTAINING PROTEIN 1coord: 11..169